Psyllid ID: psy6493

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320-
MHAQVQDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN
cccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccEcHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHccccccccccccccccccHHHHHHHHccc
MHAQVQDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEalnnndlgkdLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGlvssdelandvTGAEALLERHQEHRteidartgtfQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNaeevdsktDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAAdhyaakpiddkrKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLAteesykdpaniqsKHQKHQAFEAELAANADRIQSVLAMGQNlidkrqcvgSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLltsedsgkDLASVQNLIKKHQLVEADIQAHDDRIKdmngqadslidsgqfdasSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLvgsddygrdltgvQNLKKKHKRLEAELASHQPAIQNVQETGEKlmdvsnlgvPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKhdafetdfsvhrDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQlvasnhdqtpaIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFenaeedltdpvrcnSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIksfnvgpnpytwFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILdnrytehstvglAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHfdkdksgklnqTEFKSCLRAlgydlpmveegqpdpefeaildlvdpnrdghVSLQEYMAFMISKETENVQSSEEIENAFHAIaasdrpyvtkEELYANLTKEMADYCVERmkpyvdpktergipgalDYIEFTRTLFQN
mhaqvqdvgedleQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATqlgsahevqrfhrDVDETKDWIQEKdealnnndlgkdLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKantrkeklldsyDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHyaakpiddkrkqVLDRWRLLKEALIekrsrlgesqtlqqfsrDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKttekslklkeankqRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKllvgsddygrdLTGVQNLKKKHKRLEAelashqpaiQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKEthvkseeygrDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFenaeedltdpvRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKRKAaevrsrrsdlkkiEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFdkdksgklnQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHaiaasdrpyvTKEELYANLTKEMADYCVERMKPyvdpktergipgaldYIEFTRTLFQN
MHAQVQDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREahaqfqaslssaqaDFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN
**************************************MNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQ*****************************************************************************************************************EKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLE*****RTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEV*****NVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALI*************************************************************ADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTT***LKLKEANKQRTYIAAVKDLDFWLGEVESLLT**********VQNLIKKHQLV************************************************LAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGV***********************************NLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQA****AQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIEL******************KHANAFHQWLT************************************IEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQL**********************************************EFKSCLRALGYDLPMV********FEAILDLVDPNRDGHVSLQEYMAFMIS*************NAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTL***
*****QDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQL**************QLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANR*********EQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMM****************ALLERHQEHRTEIDARTGTFQAFDLFG********************LAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSARE**************VEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAE******************KHQKHQAFEAELAANADRIQSVL*********************RLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLG********************LIKKHQLVEADIQAHDDRIKDMNGQADS**********SIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKK******************KKKHKRLEAELASHQPAIQNVQETGEKLMD**N***PEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQ*****************LLKKHDAFETDFSVHRDRCADI**********************QQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHV********LSTVQTLLTKQETF**************ITTLKDQLVAS**DQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAE*************EIRALREAHAQFQASLSSAQADFEALAA****************************NLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLT*********************RKAAEVRSRRSDLKKIE**********************GLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFD******LNQTEFKSCLRALGY***********PEFEAILDLVDPNRDGHVSLQEYMAFMISK***********ENAFHAIAAS*RPY*T**ELYANLTKEMADYCVERMKP*******RGIPGALDYIEFTRTLFQ*
********GEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYK*************AFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKR**********DLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN
*****QDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAQVQDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHPETAEQTYAKQKEINEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQAFDLFGQQLLQSGHYAxxxxxxxxxxxxxxxxxxxxxWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNxxxxxxxxxxxxxxxxxxxxxIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDxxxxxxxxxxxxxxxxxxxxxAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHxxxxxxxxxxxxxxxxxxxxxATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1321 2.2.26 [Sep-21-2011]
P133952415 Spectrin alpha chain OS=D yes N/A 0.999 0.546 0.838 0.0
Q138132472 Spectrin alpha chain, non yes N/A 0.995 0.531 0.681 0.0
P165462472 Spectrin alpha chain, non yes N/A 0.995 0.531 0.679 0.0
P160862472 Spectrin alpha chain, non yes N/A 0.995 0.531 0.679 0.0
P077512477 Spectrin alpha chain, non yes N/A 0.995 0.530 0.676 0.0
P080322415 Spectrin alpha chain, ery no N/A 0.990 0.541 0.478 0.0
P025492419 Spectrin alpha chain, ery no N/A 0.990 0.540 0.480 0.0
Q62261 2363 Spectrin beta chain, non- no N/A 0.694 0.388 0.314 1e-114
Q01082 2364 Spectrin beta chain, non- no N/A 0.694 0.387 0.314 1e-113
Q00963 2291 Spectrin beta chain OS=Dr no N/A 0.696 0.401 0.301 1e-111
>sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 Back     alignment and function desciption
 Score = 2291 bits (5938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1107/1321 (83%), Positives = 1214/1321 (91%), Gaps = 1/1321 (0%)

Query: 2    HAQVQDV-GEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQT 60
            HAQ+ DV GEDLE+VEV+QKKFDDF  DLKANEVRLA MNEIA+QL SLGQTEAALKIQT
Sbjct: 1095 HAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQT 1154

Query: 61   QLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLR 120
            Q+QDLN+KW +LQ LTAE+A+QLGSAHEVQRFHRD+DETKDWI EK  ALNN+DLGKDLR
Sbjct: 1155 QMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLR 1214

Query: 121  SVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTA 180
            SVQ LQRKHEG+ERDLAAL DKIRQLDETANRLMQ+HP+TAEQTYAKQKEINE W Q+  
Sbjct: 1215 SVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIIT 1274

Query: 181  KANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRT 240
            K+  RKEKLLDSYDLQRFLSDYRDL++WINSMM LV+SDELANDVTGAEAL+ERHQEHRT
Sbjct: 1275 KSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQEHRT 1334

Query: 241  EIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLE 300
            EIDAR GTF AF+ FG +LLQ+ HYAS EI++K+ +LA+AREDLEKAW  RR+QL+Q L+
Sbjct: 1335 EIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLD 1394

Query: 301  LQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQT 360
            LQL+ RDCE AE+WMSAREAFLNA++  +   NVEALIKKHEDFDKAIN HE+KI ALQT
Sbjct: 1395 LQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQT 1454

Query: 361  LADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENW 420
            +ADQLIA +HYA+  +D+KRKQVL+RWR LKE LIEKRSRLG+ QTLQQFSRDADE+ENW
Sbjct: 1455 VADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENW 1514

Query: 421  IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSE 480
            IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMG NLIDK+QC GSE
Sbjct: 1515 IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSE 1574

Query: 481  EAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDS 540
            +AVQ RL  IADQWE+LT KTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLT+EDS
Sbjct: 1575 DAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDS 1634

Query: 541  GKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERY 600
            GKDLASVQNL+KKHQLVEADI AH+DRIKDMN QADSL++SGQFD + IQEKRQSINERY
Sbjct: 1635 GKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERY 1694

Query: 601  ERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH 660
            ERI NLAAHRQARLNEA TLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH
Sbjct: 1695 ERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH 1754

Query: 661  KRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKL 720
            KRLEAEL SH+PAIQ VQE GEKLMDVSNLGVPEIEQRLK LNQAW+ELK LAA RGQKL
Sbjct: 1755 KRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQKL 1814

Query: 721  DESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRC 780
            DESLTYQ FLA+VEEEEAWI+EKQQLLSVEDYGD+MAAVQGLLKKHDAFETDF+ H+DRC
Sbjct: 1815 DESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRC 1874

Query: 781  ADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKAD 840
            + IC  G++L+EAKNHH +SI QRCQQL+LKLDNL ALA +RK  L+DNSAYLQFMWKAD
Sbjct: 1875 SLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKAD 1934

Query: 841  VVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVAS 900
            VVESWI DKE +V+S+E+GRDLSTVQTLLTKQETFDAGL+AFE EGI NIT LKDQL+ +
Sbjct: 1935 VVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINA 1994

Query: 901  NHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSW 960
            +H Q+PAI+KRHGDVIARWQKL   SN RK RLL MQEQFRQIE+LYLTFAKKAS+FNSW
Sbjct: 1995 SHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSW 2054

Query: 961  FENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNP 1020
            FENAEEDLTDPVRCNSIEEIRALR+AHAQFQASLSSA+ADF+ALAALDQ+IKSFNVGPNP
Sbjct: 2055 FENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNP 2114

Query: 1021 YTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRT 1080
            YTWFTMEALE+TWRNLQKII+ERD ELAKEA RQ+END LRKEFAKHAN FHQWLTETRT
Sbjct: 2115 YTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRT 2174

Query: 1081 SMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQ 1140
            SMMEG+GSLEQQLEA++ KA EVR+RR DLKKIE+LGA+LEEHLILDNRYTEHSTVGLAQ
Sbjct: 2175 SMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQ 2234

Query: 1141 QWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCL 1200
            QWDQLDQL MRMQHNLEQQIQARN SGVSED+LKEFSMMFKHFDKDKSGKLN  EFKSCL
Sbjct: 2235 QWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCL 2294

Query: 1201 RALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENA 1260
            RALGYDLPMVEEGQPDPEFEAILD+VDPNRDG+VSLQEY+AFMISKETENVQS EEIENA
Sbjct: 2295 RALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENA 2354

Query: 1261 FHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQ 1320
            F AI A+DRPYVTKEELY NLTK+MADYCV+RMKP+ +P++ + I  ALDYI+FTRTLFQ
Sbjct: 2355 FRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQ 2414

Query: 1321 N 1321
            N
Sbjct: 2415 N 2415
Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. Essential for larval survival and development. Stabilizes cell to cell interactions that are critical for the maintenance of cell shape and subcellular organization within embryonic tissues. Lva and spectrin may form a Golgi-based scaffold that mediates interaction of Golgi bodies with microtubules and facilitates Golgi-derived membrane secretion required for the formation of furrows during cellularization.
Drosophila melanogaster (taxid: 7227)
>sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 Back     alignment and function description
>sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 Back     alignment and function description
>sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 Back     alignment and function description
>sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 Back     alignment and function description
>sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=2 SV=3 Back     alignment and function description
>sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 Back     alignment and function description
>sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 Back     alignment and function description
>sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 Back     alignment and function description
>sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1321
242019111 2414 Spectrin alpha chain, putative [Pediculu 0.996 0.545 0.896 0.0
383848574 2418 PREDICTED: spectrin alpha chain-like iso 0.996 0.544 0.896 0.0
340711445 2433 PREDICTED: spectrin alpha chain-like [Bo 0.999 0.542 0.887 0.0
328777212 2433 PREDICTED: spectrin alpha chain-like [Ap 0.999 0.542 0.886 0.0
383848576 2433 PREDICTED: spectrin alpha chain-like iso 0.999 0.542 0.886 0.0
322803122 2418 hypothetical protein SINV_80128 [Solenop 0.996 0.544 0.893 0.0
307169178 2418 Spectrin alpha chain [Camponotus florida 0.996 0.544 0.891 0.0
380030028 2433 PREDICTED: LOW QUALITY PROTEIN: spectrin 0.999 0.542 0.885 0.0
307208055 2433 Spectrin alpha chain [Harpegnathos salta 0.999 0.542 0.880 0.0
189234352 2446 PREDICTED: similar to spectrin [Triboliu 0.997 0.538 0.884 0.0
>gi|242019111|ref|XP_002430009.1| Spectrin alpha chain, putative [Pediculus humanus corporis] gi|212515067|gb|EEB17271.1| Spectrin alpha chain, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 2452 bits (6355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1183/1320 (89%), Positives = 1264/1320 (95%)

Query: 2    HAQVQDVGEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQ 61
            +A+V+DVGEDLEQVEV+QKKFDDFQSDLKANEVRLAEMNEIA+QLMS+GQTEAA+KIQTQ
Sbjct: 1095 YAEVEDVGEDLEQVEVLQKKFDDFQSDLKANEVRLAEMNEIAVQLMSIGQTEAAVKIQTQ 1154

Query: 62   LQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLRS 121
            +QDLN KW SLQQLT+ERA QLGSAHEVQRFHRDVDETKDWIQEKD+ALNN+DLGKDLRS
Sbjct: 1155 IQDLNHKWASLQQLTSERAAQLGSAHEVQRFHRDVDETKDWIQEKDQALNNDDLGKDLRS 1214

Query: 122  VQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTAK 181
            VQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHP+TA+QT+AKQ+EINEEWTQLTAK
Sbjct: 1215 VQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPDTADQTFAKQREINEEWTQLTAK 1274

Query: 182  ANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTE 241
            AN+RKEKLLDSYDLQRFLSDYRDLMSWI SMMGLVSS+ELANDVTGAEALLERHQEHRTE
Sbjct: 1275 ANSRKEKLLDSYDLQRFLSDYRDLMSWITSMMGLVSSEELANDVTGAEALLERHQEHRTE 1334

Query: 242  IDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLEL 301
            IDAR GTFQAF+LFGQQLLQ+GHYASVEIQ+KL ++ EAR++LEKAW+ARR+QLDQ LEL
Sbjct: 1335 IDARAGTFQAFELFGQQLLQAGHYASVEIQEKLESMREARQELEKAWVARRVQLDQNLEL 1394

Query: 302  QLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTL 361
            QLFYRDCEQAENWMSAREAFL +EEVDSK DNVEALIKKHEDFDKAINAHEEKI ALQTL
Sbjct: 1395 QLFYRDCEQAENWMSAREAFLASEEVDSKGDNVEALIKKHEDFDKAINAHEEKIAALQTL 1454

Query: 362  ADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWI 421
            ADQL+AA+HYA+  ID+KRKQVLDRWR LKEALIEKRSRLGESQTLQQFSRDADEMENWI
Sbjct: 1455 ADQLMAANHYASNDIDEKRKQVLDRWRHLKEALIEKRSRLGESQTLQQFSRDADEMENWI 1514

Query: 422  AEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEE 481
            AEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMG NLIDK QC GSE+
Sbjct: 1515 AEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGTNLIDKHQCAGSED 1574

Query: 482  AVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSG 541
            AVQAR+ASI +QWEFLTQKTTEK+LKLKEANKQRTY+AAVKDLDFWLGEVESLLTSEDSG
Sbjct: 1575 AVQARIASITEQWEFLTQKTTEKTLKLKEANKQRTYVAAVKDLDFWLGEVESLLTSEDSG 1634

Query: 542  KDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERYE 601
            KDLASVQNL+KKHQLVEADI AH+DRIKDMN QADSLI+S QFD +SIQE+RQSINERYE
Sbjct: 1635 KDLASVQNLMKKHQLVEADISAHEDRIKDMNKQADSLIESQQFDTASIQERRQSINERYE 1694

Query: 602  RIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHK 661
            R+ NLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHK
Sbjct: 1695 RVHNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHK 1754

Query: 662  RLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLD 721
            RLEAELASH+PAIQ VQE GEKLMDVSNLGVPEIEQRLK LNQAW+ELKQLAA RGQKLD
Sbjct: 1755 RLEAELASHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKQLAATRGQKLD 1814

Query: 722  ESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCA 781
            ESLTYQ FLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDF+ H++RCA
Sbjct: 1815 ESLTYQQFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFAAHKERCA 1874

Query: 782  DICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKADV 841
            DIC+AG++LIE +NHH+DSI QRCQQLQ KLD+L  LA  RK KLMDNSAYLQFMWKADV
Sbjct: 1875 DICNAGSQLIEGENHHSDSIIQRCQQLQNKLDHLSNLAAHRKAKLMDNSAYLQFMWKADV 1934

Query: 842  VESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASN 901
            VESWIADKETHV+SEE+GRDLSTVQTLLTKQETFDAGLHAFEHEGIQNIT LKDQL+A+ 
Sbjct: 1935 VESWIADKETHVRSEEFGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITALKDQLIAAQ 1994

Query: 902  HDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWF 961
            HDQ+PAI+KRHG+VIARWQKLL DS+ARKQRLLRMQ+QFRQIE+LYLTFAKKAS+FNSWF
Sbjct: 1995 HDQSPAILKRHGNVIARWQKLLADSDARKQRLLRMQDQFRQIEELYLTFAKKASAFNSWF 2054

Query: 962  ENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPY 1021
            ENAEEDLTDPVRCNSIEEIRALR+AHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPY
Sbjct: 2055 ENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPY 2114

Query: 1022 TWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTS 1081
            TWFTMEALEDTWRNL+KIIKERD ELAKEA RQ+END LRKEFAKHANAFHQWLTETRTS
Sbjct: 2115 TWFTMEALEDTWRNLKKIIKERDTELAKEAQRQEENDKLRKEFAKHANAFHQWLTETRTS 2174

Query: 1082 MMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQ 1141
            MMEG+GSL+QQLEA K KA EVR+R+SDLK+IEDLGA+LEEHLILDNRYTEHSTVGLAQQ
Sbjct: 2175 MMEGSGSLDQQLEATKSKATEVRARKSDLKRIEDLGALLEEHLILDNRYTEHSTVGLAQQ 2234

Query: 1142 WDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLR 1201
            WDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSG+LN  EFKSCLR
Sbjct: 2235 WDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGRLNHQEFKSCLR 2294

Query: 1202 ALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAF 1261
            ALGYDLPM+EEGQPDPEFE ILD+VD NRDG VSL+EYM FMI KETENVQSS+EIENAF
Sbjct: 2295 ALGYDLPMMEEGQPDPEFEDILDVVDRNRDGFVSLKEYMTFMIRKETENVQSSDEIENAF 2354

Query: 1262 HAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN 1321
             AI A+DRPYVTK+ELYANLTKEMADYCV+RMKPYVDPKTER IPGALDYIEFTRTLFQN
Sbjct: 2355 RAITAADRPYVTKDELYANLTKEMADYCVDRMKPYVDPKTERPIPGALDYIEFTRTLFQN 2414

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383848574|ref|XP_003699924.1| PREDICTED: spectrin alpha chain-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340711445|ref|XP_003394286.1| PREDICTED: spectrin alpha chain-like [Bombus terrestris] gi|350416216|ref|XP_003490877.1| PREDICTED: spectrin alpha chain-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328777212|ref|XP_623691.2| PREDICTED: spectrin alpha chain-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383848576|ref|XP_003699925.1| PREDICTED: spectrin alpha chain-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|322803122|gb|EFZ23210.1| hypothetical protein SINV_80128 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307169178|gb|EFN61994.1| Spectrin alpha chain [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380030028|ref|XP_003698661.1| PREDICTED: LOW QUALITY PROTEIN: spectrin alpha chain-like [Apis florea] Back     alignment and taxonomy information
>gi|307208055|gb|EFN85586.1| Spectrin alpha chain [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189234352|ref|XP_973750.2| PREDICTED: similar to spectrin [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1321
FB|FBgn02507892415 alpha-Spec "alpha Spectrin" [D 0.999 0.546 0.828 0.0
UNIPROTKB|F1NHT42445 SPTAN1 "Spectrin alpha chain, 0.994 0.537 0.670 0.0
UNIPROTKB|F1NHT32465 SPTAN1 "Spectrin alpha chain, 0.994 0.533 0.670 0.0
UNIPROTKB|Q138132472 SPTAN1 "Spectrin alpha chain, 0.994 0.531 0.668 0.0
UNIPROTKB|F1RR782452 SPTAN1 "Uncharacterized protei 0.994 0.535 0.667 0.0
UNIPROTKB|E1BFB02472 SPTAN1 "Uncharacterized protei 0.995 0.531 0.669 0.0
UNIPROTKB|F1NIU02470 SPTAN1 "Spectrin alpha chain, 0.953 0.509 0.693 0.0
WB|WBGene000049512432 spc-1 [Caenorhabditis elegans 0.996 0.541 0.664 0.0
RGD|6217142472 Sptan1 "spectrin, alpha, non-e 0.995 0.531 0.666 0.0
MGI|MGI:983862472 Sptan1 "spectrin alpha, non-er 0.995 0.531 0.666 0.0
FB|FBgn0250789 alpha-Spec "alpha Spectrin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 5680 (2004.5 bits), Expect = 0., P = 0.
 Identities = 1094/1321 (82%), Positives = 1200/1321 (90%)

Query:     2 HAQVQDV-GEDLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQT 60
             HAQ+ DV GEDLE+VEV+QKKFDDF  DLKANEVRLA MNEIA+QL SLGQTEAALKIQT
Sbjct:  1095 HAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQT 1154

Query:    61 QLQDLNQKWTSLQQLTAERATQLGSAHEVQRFHRDVDETKDWIQEKDEALNNNDLGKDLR 120
             Q+QDLN+KW +LQ LTAE+A+QLGSAHEVQRFHRD+DETKDWI EK  ALNN+DLGKDLR
Sbjct:  1155 QMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLR 1214

Query:   121 SVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKEINEEWTQLTA 180
             SVQ LQRKHEG+ERDLAAL DKIRQLDETANRLMQ+HP+TAEQTYAKQKEINE W Q+  
Sbjct:  1215 SVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIIT 1274

Query:   181 KANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRT 240
             K+  RKEKLLDSYDLQRFLSDYRDL++WINSMM LV+SDELANDVTGAEAL+ERHQEHRT
Sbjct:  1275 KSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQEHRT 1334

Query:   241 EIDARTGTFQAFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLE 300
             EIDAR GTF AF+ FG +LLQ+ HYAS EI++K+ +LA+AREDLEKAW  RR+QL+Q L+
Sbjct:  1335 EIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLD 1394

Query:   301 LQLFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQT 360
             LQL+ RDCE AE+WMSAREAFLNA++  +   NVEALIKKHEDFDKAIN HE+KI ALQT
Sbjct:  1395 LQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQT 1454

Query:   361 LADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENW 420
             +ADQLIA +HYA+  +D+KRKQVL+RWR LKE LIEKRSRLG+ QTLQQFSRDADE+ENW
Sbjct:  1455 VADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENW 1514

Query:   421 IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSE 480
             IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMG NLIDK+QC GSE
Sbjct:  1515 IAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSE 1574

Query:   481 EAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDS 540
             +AVQ RL  IADQWE+LT KTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLT+EDS
Sbjct:  1575 DAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDS 1634

Query:   541 GKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINERY 600
             GKDLASVQNL+KKHQLVEADI AH+DRIKDMN QADSL++SGQFD + IQEKRQSINERY
Sbjct:  1635 GKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERY 1694

Query:   601 ERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH 660
             ERI NLAAHRQARLNEA TLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH
Sbjct:  1695 ERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH 1754

Query:   661 KRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKL 720
             KRLEAEL SH+PAIQ VQE GEKLMDVSNLGVPEIEQRLK LNQAW+ELK LAA RGQKL
Sbjct:  1755 KRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQKL 1814

Query:   721 DESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRC 780
             DESLTYQ FLA+VEEEEAWI+EKQQLLSVEDYGD+MAAVQGLLKKHDAFETDF+ H+DRC
Sbjct:  1815 DESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRC 1874

Query:   781 ADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKAD 840
             + IC  G++L+EAKNHH +SI QRCQQL+LKLDNL ALA +RK  L+DNSAYLQFMWKAD
Sbjct:  1875 SLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKAD 1934

Query:   841 VVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVAS 900
             VVESWI DKE +V+S+E+GRDLSTVQTLLTKQETFDAGL+AFE EGI NIT LKDQL+ +
Sbjct:  1935 VVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINA 1994

Query:   901 NHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSW 960
             +H Q+PAI+KRHGDVIARWQKL   SN RK RLL MQEQFRQIE+LYLTFAKKAS+FNSW
Sbjct:  1995 SHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSW 2054

Query:   961 FENAEEDLTDPVRCNSIEEIRALREXXXXXXXXXXXXXXDFEALAALDQQIKSFNVGPNP 1020
             FENAEEDLTDPVRCNSIEEIRALR+              DF+ALAALDQ+IKSFNVGPNP
Sbjct:  2055 FENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNP 2114

Query:  1021 YTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRT 1080
             YTWFTMEALE+TWRNLQKII+ERD ELAKEA RQ+END LRKEFAKHAN FHQWLTETRT
Sbjct:  2115 YTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRT 2174

Query:  1081 SMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQ 1140
             SMMEG+GSLEQQLEA++ KA EVR+RR DLKKIE+LGA+LEEHLILDNRYTEHSTVGLAQ
Sbjct:  2175 SMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQ 2234

Query:  1141 QWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCL 1200
             QWDQLDQL MRMQHNLEQQIQARN SGVSED+LKEFSMMFKHFDKDKSGKLN  EFKSCL
Sbjct:  2235 QWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCL 2294

Query:  1201 RALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENA 1260
             RALGYDLPMVEEGQPDPEFEAILD+VDPNRDG+VSLQEY+AFMISKETENVQS EEIENA
Sbjct:  2295 RALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENA 2354

Query:  1261 FHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQ 1320
             F AI A+DRPYVTKEELY NLTK+MADYCV+RMKP+ +P++ + I  ALDYI+FTRTLFQ
Sbjct:  2355 FRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQ 2414

Query:  1321 N 1321
             N
Sbjct:  2415 N 2415
GO:0007308 "oocyte construction" evidence=IMP
GO:0002168 "instar larval development" evidence=NAS
GO:0007294 "germarium-derived oocyte fate determination" evidence=IMP;TAS
GO:0008302 "female germline ring canal formation, actin assembly" evidence=TAS
GO:0045169 "fusome" evidence=IDA
GO:0030727 "germarium-derived female germ-line cyst formation" evidence=IMP
GO:0045170 "spectrosome" evidence=IDA;TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0007417 "central nervous system development" evidence=IMP
GO:0048134 "germ-line cyst formation" evidence=TAS
GO:0045478 "fusome organization" evidence=TAS
GO:0008360 "regulation of cell shape" evidence=NAS
GO:0016337 "cell-cell adhesion" evidence=NAS
GO:0008091 "spectrin" evidence=ISS;NAS
GO:0003779 "actin binding" evidence=ISS;IDA;NAS
GO:0005516 "calmodulin binding" evidence=NAS
GO:0030707 "ovarian follicle cell development" evidence=TAS
GO:0005938 "cell cortex" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0008017 "microtubule binding" evidence=IDA
GO:0007009 "plasma membrane organization" evidence=TAS
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0030721 "spectrosome organization" evidence=TAS
GO:0007274 "neuromuscular synaptic transmission" evidence=IMP
GO:0007010 "cytoskeleton organization" evidence=ISS
GO:0005856 "cytoskeleton" evidence=ISS
GO:0005509 "calcium ion binding" evidence=ISS
GO:0050807 "regulation of synapse organization" evidence=IMP
GO:0007026 "negative regulation of microtubule depolymerization" evidence=IMP
GO:0042062 "long-term strengthening of neuromuscular junction" evidence=IMP
GO:0016199 "axon midline choice point recognition" evidence=IGI
GO:0048790 "maintenance of presynaptic active zone structure" evidence=IDA
GO:0005811 "lipid particle" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0016323 "basolateral plasma membrane" evidence=IDA
UNIPROTKB|F1NHT4 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHT3 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q13813 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR78 SPTAN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFB0 SPTAN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIU0 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00004951 spc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|621714 Sptan1 "spectrin, alpha, non-erythrocytic 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:98386 Sptan1 "spectrin alpha, non-erythrocytic 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P13395SPTCA_DROMENo assigned EC number0.83800.99920.5465yesN/A
P16546SPTN1_MOUSENo assigned EC number0.67940.99540.5319yesN/A
P16086SPTN1_RATNo assigned EC number0.67940.99540.5319yesN/A
P07751SPTN1_CHICKNo assigned EC number0.67690.99540.5308yesN/A
Q13813SPTN1_HUMANNo assigned EC number0.68160.99540.5319yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1321
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 1e-42
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 2e-39
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 8e-38
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 2e-37
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 4e-36
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 9e-35
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 6e-33
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 6e-30
pfam0872669 pfam08726, efhand_Ca_insen, Ca2+ insensitive EF ha 4e-25
pfam00435105 pfam00435, Spectrin, Spectrin repeat 3e-23
smart00150101 smart00150, SPEC, Spectrin repeats 2e-22
pfam00435105 pfam00435, Spectrin, Spectrin repeat 2e-21
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 2e-20
smart00150101 smart00150, SPEC, Spectrin repeats 4e-20
smart00150101 smart00150, SPEC, Spectrin repeats 9e-19
pfam00435105 pfam00435, Spectrin, Spectrin repeat 2e-18
smart00150101 smart00150, SPEC, Spectrin repeats 4e-18
pfam00435105 pfam00435, Spectrin, Spectrin repeat 5e-18
smart00150101 smart00150, SPEC, Spectrin repeats 2e-17
pfam00435105 pfam00435, Spectrin, Spectrin repeat 4e-17
smart00150101 smart00150, SPEC, Spectrin repeats 5e-17
pfam00435105 pfam00435, Spectrin, Spectrin repeat 1e-15
pfam00435105 pfam00435, Spectrin, Spectrin repeat 8e-15
pfam00435105 pfam00435, Spectrin, Spectrin repeat 2e-14
smart00150101 smart00150, SPEC, Spectrin repeats 2e-14
smart00150101 smart00150, SPEC, Spectrin repeats 7e-14
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 7e-13
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-12
smart00150101 smart00150, SPEC, Spectrin repeats 9e-11
pfam00435105 pfam00435, Spectrin, Spectrin repeat 4e-10
pfam00435105 pfam00435, Spectrin, Spectrin repeat 2e-08
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-07
pfam00435105 pfam00435, Spectrin, Spectrin repeat 5e-07
smart00150101 smart00150, SPEC, Spectrin repeats 2e-06
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 8e-06
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 3e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 1e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 4e-04
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 4e-04
pfam0003629 pfam00036, efhand, EF hand 6e-04
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 8e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 0.004
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information 
 Score =  154 bits (391), Expect = 1e-42
 Identities = 89/206 (43%), Positives = 138/206 (66%), Gaps = 1/206 (0%)

Query: 520 AVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLI 579
              +L+ WL E E LL+S D G DL SV+ L+KKH+ +EA++ AH++R++ +N   + LI
Sbjct: 8   DADELEAWLSEKEELLSSTDYGDDLESVEALLKKHEALEAELAAHEERVEALNELGEQLI 67

Query: 580 DSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKL 639
           + G  DA  IQE+ + +N+R+E ++ LA  R+ RL EA  L QFFRD  D E W++EK+ 
Sbjct: 68  EEGHPDAEEIQERLEELNQRWEELRELAEERRQRLEEALDLQQFFRDADDLEQWLEEKEA 127

Query: 640 LVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGV-PEIEQR 698
            + S+D G+DL  V+ L KKHK LE EL +H+P ++++ E  E+L++  +     EIE++
Sbjct: 128 ALASEDLGKDLESVEELLKKHKELEEELEAHEPRLKSLNELAEELLEEGHPDADEEIEEK 187

Query: 699 LKLLNQAWSELKQLAANRGQKLDESL 724
           L+ LN+ W EL +LA  R +KL+E+L
Sbjct: 188 LEELNERWEELLELAEERQKKLEEAL 213

Length = 213
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|219990 pfam08726, efhand_Ca_insen, Ca2+ insensitive EF hand Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1321
KOG0040|consensus2399 100.0
KOG0517|consensus 2473 100.0
KOG0517|consensus 2473 100.0
KOG0040|consensus 2399 100.0
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.83
cd00176213 SPEC Spectrin repeats, found in several proteins i 99.76
KOG0027|consensus151 99.75
cd00176213 SPEC Spectrin repeats, found in several proteins i 99.75
KOG4286|consensus 966 99.72
KOG0035|consensus890 99.71
KOG0028|consensus172 99.67
KOG4286|consensus 966 99.63
KOG0030|consensus152 99.59
KOG0031|consensus171 99.59
PTZ00183158 centrin; Provisional 99.54
PTZ00184149 calmodulin; Provisional 99.53
KOG0034|consensus187 99.4
KOG0037|consensus221 99.37
KOG0044|consensus193 99.28
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 99.22
smart00150101 SPEC Spectrin repeats. 99.08
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 99.08
smart00150101 SPEC Spectrin repeats. 99.07
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 99.06
KOG0036|consensus 463 99.02
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 99.02
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.9
KOG4223|consensus325 98.9
PLN02964 644 phosphatidylserine decarboxylase 98.87
KOG0037|consensus221 98.85
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.77
KOG0044|consensus193 98.77
KOG4223|consensus325 98.74
KOG0038|consensus189 98.71
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.67
KOG0027|consensus151 98.6
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.6
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.6
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.55
KOG0377|consensus631 98.5
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.48
PTZ00183158 centrin; Provisional 98.43
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.4
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 98.4
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.38
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.38
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.36
PTZ00184149 calmodulin; Provisional 98.35
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.35
KOG4240|consensus1025 98.35
PRK048631486 mukB cell division protein MukB; Provisional 98.33
KOG0994|consensus1758 98.33
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.33
KOG0994|consensus1758 98.32
KOG2643|consensus 489 98.32
KOG0041|consensus244 98.3
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.29
KOG4240|consensus1025 98.27
KOG0161|consensus1930 98.27
KOG0028|consensus172 98.24
KOG4674|consensus 1822 98.19
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.17
cd0005267 EH Eps15 homology domain; found in proteins implic 98.17
PF1465866 EF-hand_9: EF-hand domain 98.13
KOG0034|consensus187 98.13
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.11
KOG4251|consensus362 98.1
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.06
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.02
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.02
KOG0031|consensus171 98.01
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.96
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.83
KOG2562|consensus493 97.83
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.82
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.8
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.79
PRK04778569 septation ring formation regulator EzrA; Provision 97.78
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.75
PRK048631486 mukB cell division protein MukB; Provisional 97.74
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.73
cd0005267 EH Eps15 homology domain; found in proteins implic 97.73
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.69
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.57
PRK02224880 chromosome segregation protein; Provisional 97.53
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.51
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.48
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 97.45
KOG0036|consensus 463 97.43
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.39
PRK04778569 septation ring formation regulator EzrA; Provision 97.39
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.31
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.26
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.26
KOG0161|consensus1930 97.23
KOG0030|consensus152 97.18
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.18
PLN02964 644 phosphatidylserine decarboxylase 97.17
KOG0035|consensus890 97.16
KOG4674|consensus 1822 97.15
KOG0038|consensus189 96.98
cd0503088 calgranulins Calgranulins: S-100 domain found in p 96.98
KOG0377|consensus631 96.81
KOG0041|consensus244 96.81
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.74
KOG0751|consensus 694 96.71
PRK03918880 chromosome segregation protein; Provisional 96.69
PRK03918880 chromosome segregation protein; Provisional 96.68
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.6
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.59
KOG2562|consensus 493 96.58
PF08580683 KAR9: Yeast cortical protein KAR9; InterPro: IPR01 96.53
KOG2643|consensus 489 96.51
KOG4251|consensus362 96.5
KOG4666|consensus412 96.49
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.49
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.41
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.41
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.38
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.36
KOG0169|consensus 746 96.29
KOG0751|consensus 694 96.26
KOG0046|consensus 627 96.25
PF135141111 AAA_27: AAA domain 96.11
PF1465866 EF-hand_9: EF-hand domain 96.05
KOG4065|consensus144 95.9
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.87
PF08580683 KAR9: Yeast cortical protein KAR9; InterPro: IPR01 95.82
PRK02224880 chromosome segregation protein; Provisional 95.71
PF10174775 Cast: RIM-binding protein of the cytomatrix active 95.27
KOG4666|consensus412 95.2
COG5069612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 95.18
KOG0996|consensus1293 95.17
KOG1029|consensus 1118 94.47
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 94.24
KOG4065|consensus144 94.23
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 93.67
KOG0971|consensus1243 93.45
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 93.1
KOG1955|consensus 737 92.79
PF14643473 DUF4455: Domain of unknown function (DUF4455) 92.57
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.41
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 92.02
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.55
KOG0046|consensus 627 91.42
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 91.21
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 90.7
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 90.06
PF14643473 DUF4455: Domain of unknown function (DUF4455) 89.7
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 89.55
COG11961163 Smc Chromosome segregation ATPases [Cell division 89.13
PLN02952 599 phosphoinositide phospholipase C 88.28
PF135141111 AAA_27: AAA domain 88.17
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 87.58
KOG4673|consensus961 84.61
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 84.44
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 84.23
COG11961163 Smc Chromosome segregation ATPases [Cell division 83.87
KOG0933|consensus1174 83.19
KOG1265|consensus 1189 83.11
KOG0971|consensus1243 83.02
KOG0976|consensus1265 82.9
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 82.09
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 82.0
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 80.95
PRK01156895 chromosome segregation protein; Provisional 80.77
>KOG0040|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-115  Score=993.69  Aligned_cols=1304  Identities=71%  Similarity=1.081  Sum_probs=1264.0

Q ss_pred             CHHHHHHHHHhhHhHHHHHhhhHHHHHHHHHHHHHHHhcCCchHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Q psy6493          11 DLEQVEVMQKKFDDFQSDLKANEVRLAEMNEIAMQLMSLGQTEAALKIQTQLQDLNQKWTSLQQLTAERATQLGSAHEVQ   90 (1321)
Q Consensus        11 d~~~~~~~~~~~~~l~~el~~~~~~v~~l~~~~~~l~~~~~~~~~~~i~~~l~~l~~~w~~l~~~~~~r~~~L~~~l~~~   90 (1321)
                      +++.|..++.++..|..++.+..+++..++..|+.|...|..+....|+..   ++.+|..|.....++...|.++..++
T Consensus      1095 dle~V~~lqkKfddf~~dlkane~rLre~n~vAd~l~~~g~t~~~~~irqq---ln~rw~~Lqr~~~E~~q~lgsahevq 1171 (2399)
T KOG0040|consen 1095 DLEQVEVLQKKFDDFQKDLKANEVRLRDINKVADDLTSEGQTEEAAQIRQQ---LNARWRSLQRLAEERRQLLGSAHEVQ 1171 (2399)
T ss_pred             cHHHHHHHHHHHHHhhhhhccChHHHHHHHHHHHhccccccCHHHHHHHHH---HHHHHHHHHHHHHHHHHHHhhHHHHH
Confidence            899999999999999999999999999999999999988755555477777   99999999999999999999999999


Q ss_pred             HHHHhHHHHHHHHHHHHhhcCCCCCCCChHHHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHHHHHhCCCcHHHHHHHHHH
Q psy6493          91 RFHRDVDETKDWIQEKDEALNNNDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPETAEQTYAKQKE  170 (1321)
Q Consensus        91 ~f~~~~~~~~~wl~~~e~~l~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~v~~l~~~~~~L~~~~~~~~~~l~~~~~~  170 (1321)
                      .|+....+...|+.++-..|+..++|.++.++...+.+|+.+.+++.+....|..|...+..|.+++|+.+..++.+-.+
T Consensus      1172 ~fhrd~detk~~i~ek~~al~~~d~g~dl~svQalqrkheg~erdla~L~Dkvt~l~e~a~rLtqshp~~aeq~q~qk~e 1251 (2399)
T KOG0040|consen 1172 RFHRDADETKEWIEEKCQALNADDPGSDLRSVQALQRKHEGFERDLAALGDKVTSLGETAERLSQSHPDAAEDLQRKQME 1251 (2399)
T ss_pred             HHHHhhHHHHHHHHHHHHhhccccccchHHHHHHHHHHhccchhchHHHhhHHHHHHHHHHHhhhcCCchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhhhccCCcccCCHHHHHHHHHHHHHHHHHHhhccchHH
Q psy6493         171 INEEWTQLTAKANTRKEKLLDSYDLQRFLSDYRDLMSWINSMMGLVSSDELANDVTGAEALLERHQEHRTEIDARTGTFQ  250 (1321)
Q Consensus       171 l~~~w~~l~~~~~~r~~~L~~~~~~~~f~~~~~~l~~wl~~~e~~l~~~~~~~~~~~~~~~l~~~~~l~~el~~~~~~~~  250 (1321)
                      ++..|.+|......|...|-..+.++.|.++..++..|+..+...+.+.+.+.|+...+..++.|+....+++.+.+.++
T Consensus      1252 lne~w~dl~s~~~~Rkekl~ds~d~~rfLs~~rdl~~wi~sm~~lvss~ela~d~tg~eAllerhqe~rte~daRa~tfq 1331 (2399)
T KOG0040|consen 1252 LNEAWEDLQGRAKDRKEKLLDSYDLQRFLSDYRDLMNWINSIGGLVSSQELANDVTGAEALLERHQEHRTEIDARAGTFQ 1331 (2399)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcchhhhHHHhhhhhhHHHHHHHHHHhhhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhhhccCCCCCC
Q psy6493         251 AFDLFGQQLLQSGHYASVEIQDKLGNLAEAREDLEKAWIARRMQLDQCLELQLFYRDCEQAENWMSAREAFLNAEEVDSK  330 (1321)
Q Consensus       251 ~l~~~g~~l~~~~~~~~~~i~~~l~~l~~~~~~l~~~~~~r~~~L~~~~~~~~f~~~~~~l~~wl~~~e~~l~~~~~~~~  330 (1321)
                      .+.+.|+.++++++.+++.+...+..+.-....+...|..|...|+++++++-|..+|.....|+..-+..+ ..+.+ +
T Consensus      1332 A~eqf~~~ll~~~h~As~eie~kl~~~~l~r~~le~awv~rr~~ldq~lelqLf~~dceq~e~~maare~~l-~dD~~-s 1409 (2399)
T KOG0040|consen 1332 AFEQFGNELLDSGHYASPEIEKKLQAVKLERDDLEKAWVKRRKILDQCLELQLFQRDCEQAESWMSAREAFL-ADDKS-S 1409 (2399)
T ss_pred             HHHHHHHHHHhccCcCCHHHHHHHHHHHhhccchHHHHHHHHHHHHhhhhHHHHHhhhHHHHHHHHHHHHhh-ccccc-c
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999 65656 8


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHH
Q psy6493         331 TDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQF  410 (1321)
Q Consensus       331 ~~~~~~~l~~~~~l~~~l~~~~~~~~~l~~~~~~L~~~~~~~~~~i~~~~~~l~~r~~~l~~~~~~r~~~L~~~~~~~~f  410 (1321)
                      .+.+...+++|+.|-..+..+...+..+.-.+.+|+..++++.+.+..+...+-+||..+...+.+.+..|..+..+++|
T Consensus      1410 ~D~veAl~kk~edfdkAi~~qeqkit~l~~~a~~lia~~hya~e~i~~~R~~vlDrwr~lk~~Li~krtklg~~qTlqqf 1489 (2399)
T KOG0040|consen 1410 LDSVEALIKKHEDFDKAINAQEEKIAALQHFAESLIADNHYAKEEIATRRQQVLDRWRALKAQLIEKRSKLGDSQTLQQF 1489 (2399)
T ss_pred             cchHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhHHHHHHHHHHHHHhhhhcccCCchhHHHHHHHHHHHHHHHHhcHHHHHHHHHHhHHhHhccCCCCCHHHHHHHHHHH
Q psy6493         411 SRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASI  490 (1321)
Q Consensus       411 ~~~~~~l~~Wl~~~~~~~~~~~~~d~~~l~~~l~~~~~~~~el~~~~~~~~~l~~~~~~l~~~~~~~~~~~~i~~~l~~l  490 (1321)
                      ..++.++..|+.+++..++++++.||.+++...++|+.|..+|..+...+..++..|..+++. .|.+....+...+..+
T Consensus      1490 ~rd~deiE~wi~Ek~~~a~eesykD~tniq~k~qk~qaf~~el~~~sd~i~~vi~~gN~lie~-~c~g~e~a~~~~l~~l 1568 (2399)
T KOG0040|consen 1490 SRDADEIENWISEKLQTACDESYKDPTNIQSKHQKHQAFEAELHANSDRIHGVINMGNSLIER-SCDGNEDAVKARLEQL 1568 (2399)
T ss_pred             HhhHHHHHHHHHHHHHHhhhhcccCcHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccchh-hhcccHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999998 7778899999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6493         491 ADQWEFLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKD  570 (1321)
Q Consensus       491 ~~~w~~l~~~~~~r~~~L~~~~~~~~~~~~~~~l~~WL~~~e~~L~~~~~~~d~~~~~~~l~~~~~l~~ei~~~~~~v~~  570 (1321)
                      ...|+.+.....++..+|..+...+.|...+.++.-|+.+++..+.+.+.+.+++++...|++|+.+..++.++...+..
T Consensus      1569 ~d~w~~l~~~t~ek~~klKea~kq~~f~t~Ikd~~fwl~eve~ll~~ed~~kdLasv~nlLkkhqlle~di~a~ed~~kd 1648 (2399)
T KOG0040|consen 1569 ADQWDHLVEKTTEKSKKLKEANKQQRFNTAIKDLEFWLSEVETLLASEDYGKDLASVGNLLKKHQLLEADIVAHEDRLKD 1648 (2399)
T ss_pred             HHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhhhhhcCCcCCCCH
Q psy6493         571 MNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDL  650 (1321)
Q Consensus       571 l~~~~~~L~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~r~~~Le~~~~~~~f~~~~~~~~~Wl~~~~~~l~~~~~~~~~  650 (1321)
                      ++..+..++.++.++...+.++...++++|..++..+..|+..|..+..+++|++++.+...||.++...+++.++|.++
T Consensus      1649 ~n~qadSll~s~~f~~~~i~dkr~~i~~r~~~V~~laa~~r~kl~ea~~L~qff~d~~Deeswikek~l~V~sedygrdl 1728 (2399)
T KOG0040|consen 1649 LNTQADSLLESGQFDTDQIVEKRDNINKRFLNVKELAAARRAKLNEALALHQFFRDIDDEESWIKEKKLLVSSDDYGRDL 1728 (2399)
T ss_pred             hhHHHHHHHhhcccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccchhhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhHHHHHHHHhchHHHHHHHHHHHHhhhcCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6493         651 TGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFL  730 (1321)
Q Consensus       651 ~~~~~~~~~~~~l~~ei~~~~~~~~~~~~~~~~L~~~~~~~~~~i~~~l~~l~~~w~~l~~~~~~r~~~L~~~~~~~~f~  730 (1321)
                      ..++...++|+.+..++..|+|.+..|...|+.|...+..+...|..++..+...|..|......|..+|...+.++.|.
T Consensus      1729 ~gVqnl~kkhkrle~el~~hepaiQ~v~~~~ekl~d~a~vg~~ei~~rl~~~~~~w~~lk~la~~r~~~l~es~~~Q~f~ 1808 (2399)
T KOG0040|consen 1729 TGVQNLRKKHKRLEAELAAHEPAIQNVLDMGEKLKDKAAVGVEEIQQRLAQFVEHWEELKELAAARGQKLEESLEYQQFL 1808 (2399)
T ss_pred             hhhHHHHHHhchhhhhhhhccHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHH
Confidence            99999999999999999999999999999999999777778888999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhhhHhhhhcCCCchHHHHHHHHHHH
Q psy6493         731 AKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQL  810 (1321)
Q Consensus       731 ~~~~el~~wl~~~e~~l~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~~~~l~~  810 (1321)
                      ...++.+.|+.+....+...++|.++..++.++.+|.+|..+...++..|..+...|..++.......+.|..++..++.
T Consensus      1809 ~~~eeeEaWinek~~l~~~~d~gd~laaiq~Ll~kh~a~e~d~~~hK~rV~~~~~~g~dll~~~~h~~~~I~sk~~~l~~ 1888 (2399)
T KOG0040|consen 1809 ANVEEEEAWINEKQQLLVSEDYGDTLAAVQGLLKKHEAFETDFTVHKDRVQDVCAQGEDLINKVNHHEEQISSKCEQLNE 1888 (2399)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhHhHHHHHHHHHhcCchHHHHHHHHHHHHHHHHhchHHHHHHhhhhhhHHHHHHHHHhh
Confidence            99999999999999999888999999999999999999999999999999999999999999977777789999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhcccccCCCHHHHHHHHHhHHHHHHhhhhhhhhhHHHH
Q psy6493         811 KLDNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNI  890 (1321)
Q Consensus       811 ~~~~l~~~~~~r~~~Le~~~~~~~~~~~~~~l~~wl~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  890 (1321)
                      +-..+...+..|..++.....+.+|.-.+.-+.+|+...+..+.+..+|.++.+.+.++.+..+|-..+..+.++.+..+
T Consensus      1889 k~~~l~~~~~~~k~kl~dn~a~~qf~wk~dVveswi~~ke~~~k~e~~G~dl~~~q~ll~kQ~T~dasl~aF~QE~~~~i 1968 (2399)
T KOG0040|consen 1889 KLPSLEKAAAARKAQLEDNSAFLQFNWKADVVESWIADKENSLKTDDFGRDLSSVQTLLTKQETFDAGLQAFQQEGIPNI 1968 (2399)
T ss_pred             cchhHHHHHHhHHHhhhhhHHHHHhhhhhhhhHHhhhhHHHHHHhhhhhhhHHhhhhHhhHHHHHHhhhhhhHHHhHhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhHHHhhHHhhhhhcCC
Q psy6493         891 TTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTD  970 (1321)
Q Consensus       891 ~~~~~~l~~~~~~~~~~i~~~~~~l~~~w~~l~~~~~~r~~~L~~~~~~~~~~~~l~~~f~~~~~~~~~wl~~~e~~l~~  970 (1321)
                      ..+-+.|+...+..+++|..+-..+-.+|..+......++++|-++...++.++++..-|...+..+..|...++..+..
T Consensus      1969 telkdql~~a~hnQSdAi~kr~l~l~~rw~~l~~~s~~~~kkLLe~Q~~fkk~ee~~l~faKkaSafNwwfenaEE~l~~ 2048 (2399)
T KOG0040|consen 1969 TALKDQLISAQHNQSKAIEKRHAALIKRWQQLLAASAARRQKLLEMQSQFRKIEDLFLTFAKKASAFNSWFENAEEDLTD 2048 (2399)
T ss_pred             HHHHHHHHHHHhcccHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHhhHhcccc
Confidence            99999999988888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcCCCCHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCCCcchhhcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6493         971 PVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKE 1050 (1321)
Q Consensus       971 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~L~~~~~~~~~~~~~~~~~l~~~w~~l~~~~~~r~~~L~~~ 1050 (1321)
                      |..+...+++..+...|..|...+...+..+..+..+...+.+.+.+++|+++.++..|..+|..|...+.+|.+.|..+
T Consensus      2049 ~~~~ns~~Ei~~l~~~h~~f~~sls~a~~df~~l~~ld~~iks~~v~~~pytw~t~e~Le~tw~~L~~iI~eR~~el~~E 2128 (2399)
T KOG0040|consen 2049 PVRCNSLEEIRALRDAHEDFQASLSSAQADFKQLAELDQQIKSFNVGSNPYTWFTMEALEETWRNLQQIISERERELDKE 2128 (2399)
T ss_pred             cccccchHHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHhcCCCCCCceeehHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            98899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhcc-cccHHHHHHHHHHHHHHHHhhhhhHHHHHHhhHHHHHhhccccc
Q psy6493        1051 ATRQDENDALRKEFAKHANAFHQWLTETRTSMMEG-TGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNR 1129 (1321)
Q Consensus      1051 ~~~~~~~~~~~~~f~~~~~~l~~wl~~~~~~~~~~-~~~l~~ql~~~~~l~~ei~~~~~~~~~~~~~~~~l~~~~~~~~~ 1129 (1321)
                      .+|+..|+.+|++|++.++.+..||.+++..+..+ ++++++|++.++.+..+|+.+...+..|+++|..|..+.|.+|.
T Consensus      2129 ~~Rq~~N~klc~efa~~a~tfh~wi~etr~el~~~~sgtLE~Qleal~~k~~evqa~rg~l~~ie~~g~lmE~~lIldnk 2208 (2399)
T KOG0040|consen 2129 ISRQEENDKLCEEFACTANTFHQWIVETRKELEDGESGTLEDQLEALKRKIKEVQAMRGQLQKIEKLGALMESRLILDNK 2208 (2399)
T ss_pred             HHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhhccc
Confidence            99999999999999999999999999999998887 99999999999999999999999999999999999999999999


Q ss_pred             CCchhHhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhcCCCHHHHHHHHHhhhhccccCcCCCChHHHHHHHHHcCCCCCc
Q psy6493        1130 YTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPM 1209 (1321)
Q Consensus      1130 ~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~~~~g~i~~~e~~~~l~~~~~~~~~ 1209 (1321)
                      ||++|+.++...|+.+..++++|..++|.+|.+++..|+|++++.+|.-+|.+||.+.+|.++..+|..||+++||++|.
T Consensus      2209 yt~~st~GlaqqwdQl~qL~~rMqhnlEQqIqarn~~GVtEe~L~EFs~~fkhFDkek~G~Ldhq~F~sCLrslgY~lpm 2288 (2399)
T KOG0040|consen 2209 YTEHSTVGLAQQWDQLDQLMMRMQHNLEQQIQARNHNGVTEEQLKEFSMMFKHFDKEKNGRLDHQHFKSCLRSLGYDLPM 2288 (2399)
T ss_pred             ccccCchHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCHHHHHHHHHHHHHhchhhccCCcHHHHHHHHHhcCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCchHHHHHHHhcCCCCCccccHHHHHHHHhhhhhcccCCHHHHHHHHHHHccCCCCCcCHHHHHhhCCHhhHHHH
Q psy6493        1210 VEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIAASDRPYVTKEELYANLTKEMADYC 1289 (1321)
Q Consensus      1210 ~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~~~~~~~~F~~~D~~~~G~I~~~el~~~l~~~~~~~~ 1289 (1321)
                      ++++.+++.+..++..+|++.+|+|+..+|+.||....+.+..+.+.|..+|+.+|. |.+||+..++...|+++++++|
T Consensus      2289 vEe~~~~p~fe~~ld~vDP~r~G~Vsl~dY~afmi~~ETeNI~s~~eIE~AfraL~a-~~~yvtke~~~~~ltreqaefc 2367 (2399)
T KOG0040|consen 2289 VEEGEPEPEFEEILDLVDPNRDGYVSLQDYMAFMISKETENILSSEEIEDAFRALDA-GKPYVTKEELYQNLTREQAEFC 2367 (2399)
T ss_pred             cccCCCChhHHHHHHhcCCCCcCcccHHHHHHHHHhcccccccchHHHHHHHHHhhc-CCccccHHHHHhcCCHHHHHHH
Confidence            988889999999999999999999999999999999888888888999999999997 9999999999999999999999


Q ss_pred             HHcCCCCCCCCCCCCCCCCcchHHHHHhhhcC
Q psy6493        1290 VERMKPYVDPKTERGIPGALDYIEFTRTLFQN 1321 (1321)
Q Consensus      1290 ~~~~~~~~d~~~~d~~~g~i~~~eF~~~~~~~ 1321 (1321)
                      +..|..++++.+|.+..+.++|.+|++.+|.|
T Consensus      2368 ~s~m~~~~e~~~~~s~q~~l~y~dfv~sl~~~ 2399 (2399)
T KOG0040|consen 2368 MSKMKPYAETSSGRSDQVALDYKDFVNSLFVN 2399 (2399)
T ss_pred             HHHhhhhcccccCCCccccccHHHHHHHHhcC
Confidence            99999999985466667899999999999865

>KOG0517|consensus Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>smart00150 SPEC Spectrin repeats Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>smart00150 SPEC Spectrin repeats Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF14643 DUF4455: Domain of unknown function (DUF4455) Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF14643 DUF4455: Domain of unknown function (DUF4455) Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1321
1u4q_A322 Crystal Structure Of Repeats 15, 16 And 17 Of Chick 1e-118
1u4q_A322 Crystal Structure Of Repeats 15, 16 And 17 Of Chick 6e-37
3fb2_A218 Crystal Structure Of The Human Brain Alpha Spectrin 1e-81
3fb2_A218 Crystal Structure Of The Human Brain Alpha Spectrin 4e-21
3fb2_A218 Crystal Structure Of The Human Brain Alpha Spectrin 2e-10
1u5p_A216 Crystal Structure Of Repeats 15 And 16 Of Chicken B 6e-80
1u5p_A216 Crystal Structure Of Repeats 15 And 16 Of Chicken B 8e-27
1u5p_A216 Crystal Structure Of Repeats 15 And 16 Of Chicken B 3e-23
1cun_A213 Crystal Structure Of Repeats 16 And 17 Of Chicken B 8e-76
1cun_A213 Crystal Structure Of Repeats 16 And 17 Of Chicken B 6e-18
1cun_A213 Crystal Structure Of Repeats 16 And 17 Of Chicken B 2e-06
1sjj_A863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 4e-66
2spc_A107 Crystal Structure Of The Repetitive Segments Of Spe 7e-39
2spc_A107 Crystal Structure Of The Repetitive Segments Of Spe 2e-05
1aj3_A110 Solution Structure Of The Spectrin Repeat, Nmr, 20 4e-38
1aj3_A110 Solution Structure Of The Spectrin Repeat, Nmr, 20 2e-09
1aj3_A110 Solution Structure Of The Spectrin Repeat, Nmr, 20 1e-06
3edv_A323 Crystal Structure Of Repeats 14-16 Of Beta2-Spectri 2e-36
3edv_A323 Crystal Structure Of Repeats 14-16 Of Beta2-Spectri 3e-15
3edv_A323 Crystal Structure Of Repeats 14-16 Of Beta2-Spectri 6e-13
3edv_A323 Crystal Structure Of Repeats 14-16 Of Beta2-Spectri 2e-11
3edv_A323 Crystal Structure Of Repeats 14-16 Of Beta2-Spectri 3e-05
1hci_A476 Crystal Structure Of The Rod Domain Of Alpha-Actini 1e-31
3f31_A149 Crystal Structure Of The N-Terminal Region Of Alpha 8e-25
3f31_A149 Crystal Structure Of The N-Terminal Region Of Alpha 3e-12
3f31_A149 Crystal Structure Of The N-Terminal Region Of Alpha 1e-09
3lbx_B185 Crystal Structure Of The Erythrocyte Spectrin Tetra 7e-24
3lbx_B185 Crystal Structure Of The Erythrocyte Spectrin Tetra 1e-08
3lbx_B185 Crystal Structure Of The Erythrocyte Spectrin Tetra 5e-08
1quu_A250 Crystal Structure Of Two Central Spectrin-Like Repe 5e-19
3kbu_A326 Crystal Structure Of The Ankyrin Binding Domain Of 3e-18
3kbu_A326 Crystal Structure Of The Ankyrin Binding Domain Of 1e-12
3kbt_A326 Crystal Structure Of The Ankyrin Binding Domain Of 7e-18
3kbt_A326 Crystal Structure Of The Ankyrin Binding Domain Of 2e-12
3lbx_A161 Crystal Structure Of The Erythrocyte Spectrin Tetra 3e-15
3lbx_A161 Crystal Structure Of The Erythrocyte Spectrin Tetra 1e-05
1owa_A156 Solution Structural Studies On Human Erythrocyte Al 3e-15
1owa_A156 Solution Structural Studies On Human Erythrocyte Al 1e-05
1s35_A214 Crystal Structure Of Repeats 8 And 9 Of Human Eryth 1e-14
3f57_A225 Crystal Structure Of Human Erythroid Beta Spectrin 6e-14
3f57_A225 Crystal Structure Of Human Erythroid Beta Spectrin 9e-09
3edu_A218 Crystal Structure Of The Ankyrin-Binding Domain Of 1e-13
3edu_A218 Crystal Structure Of The Ankyrin-Binding Domain Of 1e-08
1wlx_A129 Solution Structure Of The Third Spectrin Repeat Of 2e-10
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 2e-08
1g8x_A1010 Structure Of A Genetically Engineered Molecular Mot 4e-08
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 8e-08
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 9e-08
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 1e-07
1h8b_A75 Ef-Hands 3,4 From Alpha-Actinin Z-Repeat 7 From Tit 1e-07
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 2e-07
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 2e-07
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 3e-07
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 3e-07
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 3e-07
2ycu_A995 Crystal Structure Of Human Non Muscle Myosin 2c In 3e-07
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 4e-07
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 4e-07
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 5e-07
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 5e-07
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 5e-07
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 5e-07
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 5e-07
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 5e-07
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 6e-07
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 6e-07
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 6e-07
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 6e-07
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 6e-07
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 7e-07
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 7e-07
2ygg_B150 Complex Of Cambr And Cam Length = 150 7e-07
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 7e-07
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 7e-07
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 7e-07
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 7e-07
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 8e-07
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 8e-07
1up5_B148 Chicken Calmodulin Length = 148 8e-07
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 9e-07
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 9e-07
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 1e-06
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 1e-06
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 1e-06
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 1e-06
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 1e-06
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 2e-06
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 2e-06
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 3e-06
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 3e-06
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 3e-06
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 3e-06
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 3e-06
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 4e-06
2iak_A224 Crystal Structure Of A Protease Resistant Fragment 5e-06
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 5e-06
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 6e-06
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-05
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 1e-05
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 1e-05
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-05
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-05
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-05
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-05
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 2e-05
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 2e-05
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 2e-05
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 2e-05
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 3e-05
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 9e-05
2lv7_A100 Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D 2e-04
1avs_A90 X-Ray Crystallographic Study Of Calcium-Saturated N 3e-04
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 3e-04
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 3e-04
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 4e-04
3pdy_A210 Structure Of The Third And Fourth Spectrin Repeats 5e-04
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 5e-04
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-04
3l19_A214 Crystal Structure Of Calcium Binding Domain Of Cpcd 5e-04
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 9e-04
>pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  424 bits (1091), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/321 (63%), Positives = 260/321 (80%)
Query: 511 ANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKD 570
           ANKQ+ +   +KD DFWL EVE+LL SED GKDLASV NL+KKHQL+EADI AH+DR+KD
Sbjct: 2   ANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKD 61
Query: 571 MNGQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADE 630
           +N QADSL+ S  FD S +++KR++IN R++RIK++AA R+A+LNE++ LHQFFRD+ DE
Sbjct: 62  LNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDE 121
Query: 631 ESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNL 690
           ESWIKEKKLLV S+DYGRDLTGVQNL+KKHKRLEAELA+H+PAIQ V +TG+KL D + +
Sbjct: 122 ESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTI 181
Query: 691 GVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVE 750
           G  EI+QRL      W ELKQLAA RGQ+L+ESL YQ F+A VEEEEAWI+EK  L++ E
Sbjct: 182 GKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASE 241
Query: 751 DYGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQL 810
           DYGDT+AA+QGLLKKH+AFETDF+VH+DR  D+C+ G  LI+  NHH ++IT + + L+ 
Sbjct: 242 DYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKG 301
Query: 811 KLDNLMALATKRKTKLMDNSA 831
           K+ +L   A +RK KL +NSA
Sbjct: 302 KVSDLEKAAAQRKAKLDENSA 322
>pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 Back     alignment and structure
>pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 Back     alignment and structure
>pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 Back     alignment and structure
>pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 Back     alignment and structure
>pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 Back     alignment and structure
>pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 Back     alignment and structure
>pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 Back     alignment and structure
>pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 Back     alignment and structure
>pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 Back     alignment and structure
>pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 Back     alignment and structure
>pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 Back     alignment and structure
>pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 Back     alignment and structure
>pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 Back     alignment and structure
>pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 Back     alignment and structure
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 Back     alignment and structure
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 Back     alignment and structure
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 Back     alignment and structure
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 Back     alignment and structure
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 Back     alignment and structure
>pdb|1HCI|A Chain A, Crystal Structure Of The Rod Domain Of Alpha-Actinin Length = 476 Back     alignment and structure
>pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 Back     alignment and structure
>pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 Back     alignment and structure
>pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 Back     alignment and structure
>pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 185 Back     alignment and structure
>pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 185 Back     alignment and structure
>pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 185 Back     alignment and structure
>pdb|1QUU|A Chain A, Crystal Structure Of Two Central Spectrin-Like Repeats From Alpha-Actinin Length = 250 Back     alignment and structure
>pdb|3KBU|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank), Emts Derivative Length = 326 Back     alignment and structure
>pdb|3KBU|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank), Emts Derivative Length = 326 Back     alignment and structure
>pdb|3KBT|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank) Length = 326 Back     alignment and structure
>pdb|3KBT|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank) Length = 326 Back     alignment and structure
>pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 Back     alignment and structure
>pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 Back     alignment and structure
>pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 Back     alignment and structure
>pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 Back     alignment and structure
>pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 And 9 Of Human Erythroid Spectrin Length = 214 Back     alignment and structure
>pdb|3F57|A Chain A, Crystal Structure Of Human Erythroid Beta Spectrin Repeats 14 And 15 (Ankyrin Binding Domain) Length = 225 Back     alignment and structure
>pdb|3F57|A Chain A, Crystal Structure Of Human Erythroid Beta Spectrin Repeats 14 And 15 (Ankyrin Binding Domain) Length = 225 Back     alignment and structure
>pdb|3EDU|A Chain A, Crystal Structure Of The Ankyrin-Binding Domain Of Human Erythroid Spectrin Length = 218 Back     alignment and structure
>pdb|3EDU|A Chain A, Crystal Structure Of The Ankyrin-Binding Domain Of Human Erythroid Spectrin Length = 218 Back     alignment and structure
>pdb|1WLX|A Chain A, Solution Structure Of The Third Spectrin Repeat Of Alpha- Actinin-4 Length = 129 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2IAK|A Chain A, Crystal Structure Of A Protease Resistant Fragment Of The Plakin Domain Of Bullous Pemphigoid Antigen1 (Bpag1) Length = 224 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 Back     alignment and structure
>pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|3PDY|A Chain A, Structure Of The Third And Fourth Spectrin Repeats Of The Plakin Domain Of Plectin Length = 210 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1321
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 1e-112
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 1e-33
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 7e-30
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 4e-29
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 7e-74
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 4e-58
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 7e-56
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 2e-54
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 4e-54
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 5e-50
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 3e-45
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 1e-28
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 2e-26
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 8e-09
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 5e-56
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 6e-33
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 7e-32
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 1e-30
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 2e-29
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 5e-14
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 8e-55
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-54
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 7e-54
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 5e-52
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-49
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-39
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 5e-38
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 8e-31
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-23
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 1e-54
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 3e-52
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 4e-50
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 8e-50
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 1e-47
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 2e-46
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 3e-43
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 3e-22
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 3e-52
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 9e-43
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 3e-34
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 1e-32
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 3e-32
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 1e-31
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 3e-31
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 1e-25
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 5e-18
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 2e-49
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 5e-40
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 3e-38
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 7e-34
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 1e-32
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 3e-32
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 8e-32
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 1e-29
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 4e-19
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 4e-06
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 1e-47
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 5e-39
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 3e-35
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 3e-34
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 1e-31
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 2e-31
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 4e-30
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 3e-28
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 3e-19
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 2e-08
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 2e-07
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 7e-45
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 7e-40
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 3e-36
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 2e-34
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 2e-33
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 1e-25
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 4e-25
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 9e-45
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 5e-34
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-31
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 9e-29
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-28
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 3e-27
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-26
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-22
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 8e-16
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 3e-44
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 6e-36
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 6e-28
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 6e-27
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 5e-26
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 1e-25
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 2e-25
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 2e-22
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 3e-12
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-44
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 7e-42
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-34
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-32
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-31
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-29
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-27
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-26
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-06
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 3e-40
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 6e-35
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 4e-29
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 2e-25
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 3e-25
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 6e-25
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 9e-25
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 7e-24
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 1e-11
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 4e-39
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 2e-28
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 7e-28
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 1e-27
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 3e-27
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 6e-26
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 5e-24
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 1e-21
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 6e-16
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 4e-39
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 6e-38
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 9e-29
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 2e-26
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 1e-25
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 4e-24
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 7e-24
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 1e-21
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 1e-19
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 1e-15
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 8e-05
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-37
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 3e-36
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 4e-35
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 5e-32
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-30
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-30
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-28
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-27
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-19
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 2e-30
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 1e-21
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 2e-19
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 4e-19
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 4e-18
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 1e-15
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 1e-13
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 3e-13
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 1e-07
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 1e-26
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 2e-26
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 6e-25
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 4e-21
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 4e-19
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 5e-18
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 1e-15
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 2e-13
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 3e-07
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 4e-25
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 2e-24
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 6e-24
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 1e-20
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 2e-20
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 4e-18
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 2e-16
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 2e-12
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 9e-07
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 1e-22
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 5e-22
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 8e-17
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 7e-15
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 5e-12
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 2e-08
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 2e-08
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-13
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 8e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-12
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-12
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 4e-12
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 7e-12
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-12
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 5e-08
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 7e-09
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 1e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-12
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-11
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-11
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-07
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-11
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 7e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-11
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 4e-07
3fwb_A161 Cell division control protein 31; gene gating, com 3e-11
3fwb_A161 Cell division control protein 31; gene gating, com 2e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-11
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 4e-11
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-06
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 5e-11
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 5e-11
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-07
1y1x_A191 Leishmania major homolog of programmed cell death 9e-11
1y1x_A191 Leishmania major homolog of programmed cell death 5e-09
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 2e-10
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-10
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-10
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-10
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 6e-07
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-10
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 4e-08
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-10
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 8e-06
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 3e-10
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-10
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-10
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 6e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 4e-10
1exr_A148 Calmodulin; high resolution, disorder, metal trans 6e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 5e-10
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 6e-10
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 7e-07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 9e-10
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 9e-10
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 1e-09
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-09
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-09
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 9e-07
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 1e-09
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-07
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-09
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-09
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 8e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-09
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-06
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-09
1avs_A90 Troponin C; muscle contraction, calcium-activated, 2e-09
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-09
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-08
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-09
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-09
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-09
2hps_A186 Coelenterazine-binding protein with bound coelent; 4e-09
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-09
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 4e-09
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 7e-09
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-08
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 9e-05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-08
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-07
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 1e-08
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 1e-08
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-08
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-05
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 6e-08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 2e-08
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 2e-08
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 3e-08
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 3e-08
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-07
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-08
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-07
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 5e-08
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 5e-08
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 6e-08
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 5e-07
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 8e-08
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 9e-08
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 3e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-06
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-07
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 5e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-07
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-07
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 9e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-07
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-07
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-06
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-07
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-07
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-07
1c07_A95 Protein (epidermal growth factor receptor pathway 3e-07
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 4e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-05
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 5e-07
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 5e-07
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 6e-07
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 6e-07
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 6e-07
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 6e-07
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 7e-07
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 4e-05
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 7e-07
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 9e-07
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-06
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-06
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 3e-06
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 9e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 3e-06
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 9e-06
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 3e-06
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 1e-05
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 4e-06
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 8e-06
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 3e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 2e-04
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 6e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 8e-05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-04
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 1e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-04
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 2e-04
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 2e-04
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 2e-04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 3e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 3e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 3e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 6e-04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 7e-04
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
 Score =  372 bits (956), Expect = e-112
 Identities = 166/656 (25%), Positives = 307/656 (46%), Gaps = 39/656 (5%)

Query: 692  VPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVED 751
            V           +A +   ++        +     + +     +   WI      L    
Sbjct: 218  VSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRA 277

Query: 752  YGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAK------NHHADSITQRC 805
              +TM A+Q  L+    +       + +           ++ K           S  +  
Sbjct: 278  PENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMV 337

Query: 806  QQLQLKLDNLMALATKRKTKLMD--------NSAYLQFMWKADVVESWIADKETHVKSEE 857
              +      L       +  L++        +    +F  KA + ESW   KE  ++ ++
Sbjct: 338  SDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKD 397

Query: 858  Y-GRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVI 916
            Y    LS ++ LL K E F++ L A + + ++ I  +  +L   ++  +P++  R   + 
Sbjct: 398  YETATLSEIKALLKKHEAFESDLAAHQ-DRVEQIAAIAQELNELDYYDSPSVNARCQKIC 456

Query: 917  ARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNSWFENAEEDLTDPVRCNS 976
             +W  L   +  R++ L R ++    I+ LYL +AK+A+ FN+W E A EDL D    ++
Sbjct: 457  DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT 516

Query: 977  IEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSF-------NVGPNPYTWFTMEAL 1029
            IEEI+ L  AH QF+A+L  A  + +A+  +  ++            G NPYT  T + +
Sbjct: 517  IEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI 576

Query: 1030 EDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETR----TSMMEG 1085
               W ++++++  RD  L +E  RQ +N+ LRK+F   AN    W+           +E 
Sbjct: 577  NGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM 636

Query: 1086 TGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQL 1145
             G+LE QL  +++    + + +  + ++E     ++E LI DN++T ++   +   W+QL
Sbjct: 637  HGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQL 696

Query: 1146 DQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGY 1205
                 R  + +E QI  R+  G+S++ + EF   F HFD+ K+G ++  +F++CL ++GY
Sbjct: 697  LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRACLISMGY 756

Query: 1206 DLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIENAFHAIA 1265
            ++        + EF  I+ +VDPNR G V+ Q ++ FM S+ET +  +++++  +F  +A
Sbjct: 757  NM-------GEAEFARIMSIVDPNRMGVVTFQAFIDFM-SRETADTDTADQVMASFKILA 808

Query: 1266 ASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN 1321
              D+ Y+T +EL   L  + A+YC+ RM PY        +PGALDY+ F+  L+  
Sbjct: 809  G-DKNYITVDELRRELPPDQAEYCIARMAPYNGR---DAVPGALDYMSFSTALYGE 860
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1321
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 100.0
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 100.0
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 100.0
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 100.0
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 100.0
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 100.0
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 100.0
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 100.0
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 99.98
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 99.96
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 99.92
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 99.92
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 99.92
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 99.91
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 99.91
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.9
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.9
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.89
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.88
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 99.88
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 99.88
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 99.88
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 99.85
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 99.84
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 99.84
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 99.83
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.77
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.77
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.76
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.75
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.75
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.74
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 99.73
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.73
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.72
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.71
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.68
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.67
3fwb_A161 Cell division control protein 31; gene gating, com 99.67
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.67
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.67
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.66
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.66
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.66
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 99.66
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.65
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.65
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.65
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.65
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.64
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.64
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 99.64
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.64
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.63
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.63
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.63
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 99.63
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.62
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.62
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.61
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.61
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.6
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 99.6
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.6
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.59
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 99.59
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.59
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.59
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.58
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.58
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.58
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.58
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.57
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.57
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.56
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.56
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.56
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.56
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.55
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.55
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.54
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.54
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.53
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.53
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.52
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.52
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.52
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.52
1y1x_A191 Leishmania major homolog of programmed cell death 99.51
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.51
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.51
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.5
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.5
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.5
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.49
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.49
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.49
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.47
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.46
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.46
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.45
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.45
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.45
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.44
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.44
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.44
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.43
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.43
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.42
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.41
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.41
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.41
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.41
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.41
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.4
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.4
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.39
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.39
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.38
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 99.36
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.34
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.34
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.33
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.31
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 99.27
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 99.27
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.26
3uun_A119 Dystrophin; triple helical, cell structure and sta 99.25
3uun_A119 Dystrophin; triple helical, cell structure and sta 99.23
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 99.19
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.17
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.17
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.17
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 99.14
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.14
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.13
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.13
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.12
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 99.11
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.11
1y1x_A191 Leishmania major homolog of programmed cell death 99.1
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.1
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 99.1
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.07
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.07
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.03
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.02
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.01
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.99
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.98
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 98.98
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.98
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.98
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.98
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.98
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.97
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.95
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 98.94
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.92
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.92
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.92
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.92
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.91
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.9
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.89
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.86
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.84
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.83
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.83
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.82
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.82
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.82
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.8
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.8
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.8
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.8
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.8
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.79
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.78
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.77
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.77
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.77
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.75
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.74
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.74
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.73
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.72
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.71
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.71
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.71
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.7
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.7
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.69
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.69
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.69
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.69
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.68
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.67
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.67
1c07_A95 Protein (epidermal growth factor receptor pathway 98.67
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.66
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.66
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.66
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.65
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.65
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.65
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.64
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.64
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.64
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.64
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.64
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.63
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.63
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.63
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.63
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.63
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.62
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.62
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.62
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.62
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.62
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.62
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.61
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.61
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.61
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.61
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.6
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.6
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.59
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.59
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.58
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.58
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.58
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.57
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.57
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.57
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.57
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.57
3fwb_A161 Cell division control protein 31; gene gating, com 98.57
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 98.56
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.55
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.55
3li6_A66 Calcium-binding protein; calcium signaling protein 98.55
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.54
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.53
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.53
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.52
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.52
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.52
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.51
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.5
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.5
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.49
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.49
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.49
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.49
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.48
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.47
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.47
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.46
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.45
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.45
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.44
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.43
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.42
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.42
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.42
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.41
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.41
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.41
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.39
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.38
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.38
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.36
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.36
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.35
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.34
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.34
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.33
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.33
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.32
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.32
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.31
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.31
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.3
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.29
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.27
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.27
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.25
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.25
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.24
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.24
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.24
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.23
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.22
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.21
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.21
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.21
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.19
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.17
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.16
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.15
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.14
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.13
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.11
1c07_A95 Protein (epidermal growth factor receptor pathway 98.11
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.09
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.07
3li6_A66 Calcium-binding protein; calcium signaling protein 98.06
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.05
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.05
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.03
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.03
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.0
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 97.99
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.99
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.99
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 97.98
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.98
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.96
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.96
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.93
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.93
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.92
2jq6_A139 EH domain-containing protein 1; metal binding prot 97.9
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.85
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 97.84
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 97.84
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 97.81
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.81
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.81
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.8
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.79
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.77
1avs_A90 Troponin C; muscle contraction, calcium-activated, 97.76
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 97.75
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.75
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 97.73
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.71
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.71
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 97.67
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 97.67
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.62
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.61
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.6
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.56
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.52
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.49
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.47
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.3
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.23
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.17
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.09
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.96
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.73
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.67
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.81
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.6
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.32
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 90.57
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 90.23
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 86.81
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 86.18
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 82.06
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
Probab=100.00  E-value=1.6e-48  Score=500.30  Aligned_cols=580  Identities=28%  Similarity=0.522  Sum_probs=506.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHHHHHHHHHh-hHH---HHHHH-HHhhhHhhhhc-CCCchH
Q psy6493         727 QHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSV-HRD---RCADI-CSAGNKLIEAK-NHHADS  800 (1321)
Q Consensus       727 ~~f~~~~~el~~wl~~~e~~l~~~~~~~~~~~~~~~l~~~~~~~~~l~~-~~~---~v~~l-~~~~~~L~~~~-~~~~~~  800 (1321)
                      .+|...+.++..||.++...|.+.++|.++..++.++.+|..|+..... ...   .+..+ ...+..+...+ ++-.+.
T Consensus       253 ~~y~~~~~el~~Wi~~~~~~l~~~~~~~~l~~v~~~l~~~~~~~~~~k~~~~~e~~~le~~~~~l~~~l~~~~~~~~~~~  332 (863)
T 1sjj_A          253 EDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPS  332 (863)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGSSCCCCCSSHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHTTTHHHHHTTTTSSCCCCCS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhccCcCCCHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Confidence            6799999999999999999999989999999999999999999986532 111   11111 11122222211 111222


Q ss_pred             HHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhcccccCC-CHHHHHHHH
Q psy6493         801 ITQRCQQLQLKLDNLMALAT----------KRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGR-DLSTVQTLL  869 (1321)
Q Consensus       801 i~~~~~~l~~~~~~l~~~~~----------~r~~~Le~~~~~~~~~~~~~~l~~wl~~~e~~l~~~~~~~-~~~~~~~~~  869 (1321)
                      ....+..++.+|..|.....          .|+.+|+.  .+.+|...+.++..||..++..+.+.+++. ++.+++.++
T Consensus       333 ~~~~~~~i~~~w~~L~~~~~~r~~~l~~~~~R~~~Le~--l~~~F~~~~~~~~~Wl~~~e~~l~~~~~g~~dl~~v~~ll  410 (863)
T 1sjj_A          333 EGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDH--LAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALL  410 (863)
T ss_dssp             TTSCGGGHHHHHHHHHHHHTTTHHHHHHHHEEHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHSCTTTSSCHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHhhcccccCCCHHHHHHHH
Confidence            23345556666666666544          55666664  358999999999999999999999888887 999999999


Q ss_pred             HhHHHHHHhhhhhhhhhHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q psy6493         870 TKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLT  949 (1321)
Q Consensus       870 ~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~i~~~~~~l~~~w~~l~~~~~~r~~~L~~~~~~~~~~~~l~~~  949 (1321)
                      ++|+.|..++.. +..++..+...|+.|+..++++++.|..+++.|+.+|+.|...+..|+..|+.++...+.+++++.+
T Consensus       411 ~kh~~f~~el~~-~~~~v~~l~~~~~~L~~~~~~~~~~I~~~~~~l~~~W~~L~~~~~~R~~~L~~~l~~~q~~~~l~~~  489 (863)
T 1sjj_A          411 KKHEAFESDLAA-HQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLE  489 (863)
T ss_dssp             HHHHHHHHHHTT-HHHHHHHHHHHHHHHHHTCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH-HHHHHHHHHHHHHHHHhCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999 6899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHhhHHhhhhhcCCCcCCCCHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhc-------CCCCCcch
Q psy6493         950 FAKKASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSF-------NVGPNPYT 1022 (1321)
Q Consensus       950 f~~~~~~~~~wl~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~L~~~-------~~~~~~~~ 1022 (1321)
                      |...++.+..||..++..|..+..+.+++.++.++.+|+.|..++..++..+..+..++..+...       +..+++++
T Consensus       490 f~~~a~~~~~Wl~~~e~~l~~~~~g~dl~~ve~ll~kh~~~~~~l~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~  569 (863)
T 1sjj_A          490 YAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYT  569 (863)
T ss_dssp             HHHHTTTTHHHHHHHHHHHHCCCCCSSSGGGHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTTCCCCSCCSSS
T ss_pred             HHHHHHHHHHHHHHHHHHhcchHhhccHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCC
Confidence            99999999999999999999988889999999999999999999999999999999999988763       33467888


Q ss_pred             hhcHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhcc----cccHHHHHHHHHH
Q psy6493        1023 WFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEG----TGSLEQQLEAIKR 1098 (1321)
Q Consensus      1023 ~~~~~~l~~~w~~l~~~~~~r~~~L~~~~~~~~~~~~~~~~f~~~~~~l~~wl~~~~~~~~~~----~~~l~~ql~~~~~ 1098 (1321)
                      ..++..|..+|..|+..+..|...|++++++++.++.++++|...++.+..||.+.+..+...    ++++++++..++.
T Consensus       570 ~~~~~~L~~rw~~L~~~~~~R~~~L~~~l~~~~~~~~l~~~F~~~a~~~~~Wi~e~e~~l~~~~~~~~~~le~~l~~~~~  649 (863)
T 1sjj_A          570 TITPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQ  649 (863)
T ss_dssp             SCCHHHHHHHHHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTCTTTSSHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHHHH
Confidence            889999999999999999999999999999999999999999999999999999999888742    5789999999999


Q ss_pred             HHHHHHhhhhhHHHHHHhhHHHHHhhcccccCCchhHhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhcCCCHHHHHHHHH
Q psy6493        1099 KAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSM 1178 (1321)
Q Consensus      1099 l~~ei~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1178 (1321)
                      +..++......++.+..+++.+.++...+++++.+++.++...|..+...+.......+..+..+...++++..+..+..
T Consensus       650 ~~~el~~~~~~i~~l~~l~~~L~~~~~~~~~~~~~s~e~l~i~~~eF~~~~~~~~~~~e~~~l~~~~~~l~~~~~~~~~~  729 (863)
T 1sjj_A          650 YEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRA  729 (863)
T ss_dssp             HHHHHHTTGGGHHHHHHHHHHHHTTTCCCCTTCSSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCSSHHHHHHHHH
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHhcCCCCCcccccHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhccCCCHHHHHHHHH
Confidence            99999999999999999999999998888999999999999999999999999988899888899999999999999999


Q ss_pred             hhhhccccCcCCCChHHHHHHHHHcCCCCCcccCCCCchHHHHHHHhcCCCCCccccHHHHHHHHhhhhhcccCCHHHHH
Q psy6493        1179 MFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETENVQSSEEIE 1258 (1321)
Q Consensus      1179 ~F~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~~~~~~ 1258 (1321)
                      +|..||.|++|.|+..||..+|..+|..+       +...+..+|..+|.+++|.|+|++|+.++.... ....+.+.+.
T Consensus       730 ~F~~~D~d~~G~I~~~El~~~l~~~g~~~-------~~~~~~~~~~~~D~d~dG~I~~~EF~~~~~~~~-~~~~~~~~l~  801 (863)
T 1sjj_A          730 SFNHFDRKKTGMMDCEDFRACLISMGYNM-------GEAEFARIMSIVDPNRMGVVTFQAFIDFMSRET-ADTDTADQVM  801 (863)
T ss_dssp             HHTTTCSSSSSEEESTTHHHHHHHHTCCC-------CTHHHHHHHHHHCTTSCSEEETTHHHHTHHHHS-TTCSSSHHHH
T ss_pred             HHHHHCCCCCCCcCHHHHHHHHHHcCCCC-------CHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHHh-cCCCCHHHHH
Confidence            99999999999999999999999999988       789999999999999999999999999986653 2345667899


Q ss_pred             HHHHHHccCCCCCcCHHHHHhhCCHhhHHHHHHcCCCCCCCCCCCCCCCCcchHHHHHhhhcC
Q psy6493        1259 NAFHAIAASDRPYVTKEELYANLTKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLFQN 1321 (1321)
Q Consensus      1259 ~~F~~~D~~~~G~I~~~el~~~l~~~~~~~~~~~~~~~~d~~~~d~~~g~i~~~eF~~~~~~~ 1321 (1321)
                      .+|+.| .||+|+|+.+||+.+|++.+++.++..+....|++++|   |.|+|++|+.+|+++
T Consensus       802 ~aF~~~-~d~~G~Is~~El~~~l~~~~~~~l~~~~d~~~~~~~~d---g~I~~~eF~~~~~~~  860 (863)
T 1sjj_A          802 ASFKIL-AGDKNYITVDELRRELPPDQAEYCIARMAPYNGRDAVP---GALDYMSFSTALYGE  860 (863)
T ss_dssp             HHHHGG-GTSSSEEEHHHHHHHSCHHHHHHHHHHSEECCSSCCCT---TEEESHHHHHHHSCC
T ss_pred             HHHHHH-hCCCCcCcHHHHHHHCCHHHHHHHHHHcchhcCCCCCC---CceeHHHHHHHHhcC
Confidence            999999 79999999999999999888888887554332222134   999999999999864
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1321
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 6e-22
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 1e-18
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 4e-18
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 4e-17
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 1e-16
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 5e-16
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 4e-13
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 5e-13
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 4e-08
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 1e-21
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 8e-17
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 5e-16
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 7e-16
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 2e-15
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 8e-15
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 1e-12
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 1e-12
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 7e-08
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 2e-21
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 6e-20
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 3e-18
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 9e-18
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 9e-17
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 2e-16
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 5e-14
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 1e-12
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 2e-07
d1h8ba_73 a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) 4e-21
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 1e-20
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 1e-19
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 6e-19
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 2e-16
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 4e-16
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 5e-16
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 2e-12
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 5e-11
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 8e-08
d1hcia1125 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sap 5e-19
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 7e-19
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 1e-18
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 2e-17
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 1e-16
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 7e-16
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 5e-15
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 2e-14
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 6e-11
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 4e-08
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 2e-18
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 4e-17
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 3e-16
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 3e-16
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 5e-15
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 1e-14
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 2e-12
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 1e-10
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 1e-17
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 3e-16
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 2e-15
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 4e-15
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 1e-13
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 5e-13
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 2e-12
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 1e-11
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 5e-05
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 2e-14
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 4e-13
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 9e-13
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 1e-11
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 7e-11
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 1e-10
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 4e-09
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 7e-09
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 1e-08
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 2e-07
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 4e-14
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 5e-13
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 1e-11
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 3e-11
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 1e-10
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 8e-10
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 1e-09
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 1e-08
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 4e-05
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 8e-13
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 3e-11
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 1e-10
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 1e-09
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 2e-09
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 2e-09
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 4e-08
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 9e-08
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 2e-07
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 8e-05
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 9e-10
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-09
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 2e-09
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 3e-09
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 4e-09
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 9e-09
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-08
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 3e-08
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-08
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 7e-08
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 9e-08
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 1e-07
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 1e-07
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.004
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 1e-07
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 1e-07
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-07
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-07
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-07
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-07
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 6e-07
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-05
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 8e-07
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 9e-07
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 9e-07
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 1e-06
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 1e-06
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 5e-06
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 9e-06
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-05
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-05
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-05
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 3e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 0.002
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 6e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 6e-05
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 7e-05
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 7e-05
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 6e-04
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 8e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 9e-05
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-04
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 1e-04
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.004
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 3e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-04
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 4e-04
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 5e-04
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 5e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 5e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 6e-04
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-04
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 7e-04
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 9e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.001
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 0.001
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.001
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 0.001
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 0.002
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 0.002
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.002
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 0.004
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure

class: All alpha proteins
fold: Spectrin repeat-like
superfamily: Spectrin repeat
family: Spectrin repeat
domain: Spectrin alpha chain
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score = 89.6 bits (222), Expect = 6e-22
 Identities = 40/103 (38%), Positives = 59/103 (57%)

Query: 622 QFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETG 681
           QF  ++ +EE+WI EK  LV S+DYG  L  +Q L KKH+  E +   H+  + +V   G
Sbjct: 1   QFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANG 60

Query: 682 EKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESL 724
           E L+  +N  V  I  ++K L    S+L++ AA R  KLDE+ 
Sbjct: 61  EDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENS 103
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1321
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.72
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.71
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.68
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.67
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.64
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.64
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.64
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.62
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.61
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.6
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.6
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.59
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.56
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.56
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.53
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.51
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.49
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.49
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.48
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.43
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.43
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.41
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.41
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.41
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 99.4
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.4
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.39
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 99.35
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.34
d1cuna2104 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.33
d1s35a2105 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.32
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.31
d1cuna2104 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.31
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.31
d1s35a2105 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.3
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.29
d1u5pa2101 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.29
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.28
d1u5pa2101 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.26
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.25
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.25
d1quua1124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.24
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.24
d1s35a1106 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.23
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.23
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.21
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.21
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.21
d1quua1124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1quua2124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.16
d1s35a1106 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.16
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 99.13
d1hcia4114 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.12
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 99.1
d1quua2124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1hcia4114 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.06
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.05
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.03
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.03
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.02
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.01
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.0
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.98
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.97
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.97
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.96
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.95
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.92
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.92
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.92
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.9
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.82
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.82
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.82
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.79
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.73
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.69
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.69
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.68
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.67
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.66
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.66
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.64
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.62
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.62
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.62
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.61
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.6
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.6
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.59
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.56
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.55
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.53
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.53
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.52
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.5
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.5
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.47
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.47
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.47
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.43
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.42
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.39
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.38
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.37
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.33
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.33
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.33
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.32
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.3
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.29
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.27
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.27
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.27
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.27
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.26
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.25
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.25
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.24
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.24
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.24
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.23
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.21
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.21
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.2
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.16
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.15
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.14
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.13
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.13
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.09
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.06
d1hcia1125 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.01
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.0
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.95
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 97.95
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.95
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.94
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.9
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 97.89
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.79
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.75
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 97.74
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.72
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 97.72
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.67
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.6
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.59
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.56
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.51
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.5
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.5
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.35
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.34
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.33
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.12
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.02
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 96.61
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 96.35
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.02
d1hcia1125 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 95.87
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 95.77
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 95.7
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.99
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 90.35
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 89.59
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.3
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 85.52
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]

Probab=99.72  E-value=1.2e-17  Score=160.13  Aligned_cols=138  Identities=26%  Similarity=0.492  Sum_probs=120.3

Q ss_pred             CCCHHHHHHHHHhhhhccccCcCCCChHHHHHHHHHcCCCCCcccCCCCchHHHHHHHhcCCCCCccccHHHHHHHHhhh
Q psy6493        1167 GVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISK 1246 (1321)
Q Consensus      1167 ~~~~~~~~~~~~~F~~~D~~~~g~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~ 1246 (1321)
                      +||++++.+++.+|..+|++++|.|+..+|..++...|..+       +...+..++..+|.+++|.|+|.+|+.++...
T Consensus         2 ~lt~~e~~~l~~~F~~~D~~~~G~Is~~e~~~~l~~~~~~~-------~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~   74 (146)
T d1exra_           2 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNP-------TEAELQDMINEVDADGNGTIDFPEFLSLMARK   74 (146)
T ss_dssp             CCCHHHHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHTCCC-------CHHHHHHHHHHHCTTCSSSEEHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCC-------CHHHHHHHHHhcCCCCCCcccHHHHHHHHHHH
Confidence            58899999999999999999999999999999999999988       88899999999999999999999999988654


Q ss_pred             hhcccCCHHHHHHHHHHHccCCCCCcCHHHHHhhC-------CHhhHHHHHHcCCCCCCCCCCCCCCCCcchHHHHHhhh
Q psy6493        1247 ETENVQSSEEIENAFHAIAASDRPYVTKEELYANL-------TKEMADYCVERMKPYVDPKTERGIPGALDYIEFTRTLF 1319 (1321)
Q Consensus      1247 ~~~~~~~~~~~~~~F~~~D~~~~G~I~~~el~~~l-------~~~~~~~~~~~~~~~~d~~~~d~~~g~i~~~eF~~~~~ 1319 (1321)
                      .. .....+.++.+|+.||.|++|+|+.+||...+       ++.++..    +++.+|.| +|   |.|+|++|+++|+
T Consensus        75 ~~-~~~~~~~~~~~F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~----i~~~~D~d-~d---G~i~~~eF~~~l~  145 (146)
T d1exra_          75 MK-EQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDE----MIREADID-GD---GHINYEEFVRMMV  145 (146)
T ss_dssp             HH-HHHHHHHHHHHHHHHSTTCSSCBCHHHHHHHHHHTTCCCCHHHHHH----HHHHHCSS-SS---SSBCHHHHHHHHH
T ss_pred             hh-ccChHHHHHHHHHHhCCCCCCcCCHHHHHHHHHHHhhcCCHHHHHH----HHHHhCCC-CC---CeEeHHHHHHHhc
Confidence            32 23345789999999999999999999999965       4444554    44478999 88   9999999999987


Q ss_pred             c
Q psy6493        1320 Q 1320 (1321)
Q Consensus      1320 ~ 1320 (1321)
                      +
T Consensus       146 s  146 (146)
T d1exra_         146 S  146 (146)
T ss_dssp             C
T ss_pred             C
Confidence            4
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure