Psyllid ID: psy6598


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKTNHRESKNKKPSNRNNIVKQECVQKINSNPTTKLLNNNSIAILDTSGSSNNNEEKYFLMELSIPNAKLEN
ccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccccccccc
ccccccccccccccEccccHHHHHHHHcccccccEcccccccccEccccHHHEHHHHcccccccccccccccEccccHHHHHHHHcccccccEccccccccccccHHHHHEEcccHHHHHHHHHHccccccccccccccEccccHHHHHHHccc
mkpffyfpwdckisfasatnyknhmrihsgekpyvcqvrdCQKRFTEYSSLYKhtlvhsdirpficdrcprsyrqLCTLNvhkktnhresknkkpsnrnniVKQECVQkinsnpttkllnnnsiaildtsgssnnneeKYFLMELSipnaklen
MKPFFYFPWDCKISFASATNYKNHmrihsgekpyvcQVRDCQKRFTEYSSLykhtlvhsdirpFICDRCPRSYRQLCTlnvhkktnhresknkkpsnrnniVKQECVQKinsnpttkllnnnSIAILDTSGSSNNNEEKYFLMelsipnaklen
MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKTNHRESKNKKPSNRNNIVKQECVQKINSNPTTKLLNNNSIAILDTSGSSNNNEEKYFLMELSIPNAKLEN
***FFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVH************************************************************************
MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKTNHRESKNKKPSNRN************SNPT*K****************NNNEEKYFLMELSIPNA****
MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHK*************NRNNIVKQECVQKINSNPTTKLLNNNSIAILDTSGSSNNNEEKYFLMELSIPNAKLEN
*KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKTNHRESKNKKPSNRNNIVKQECVQKINSNPTTKLLNNNSIAILDTSGSSNNNEEKYFLMELSIP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKTNHRESKNKKPSNRNNIVKQECVQKINSNPTTKLLNNNSIAILDTSGSSNNNEEKYFLMELSIPNAKLEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q1LYE3 623 Zinc finger protein 143 O yes N/A 0.571 0.141 0.555 4e-28
A6QQW0 613 Zinc finger protein 143 O yes N/A 0.571 0.143 0.544 3e-27
P52747 638 Zinc finger protein 143 O yes N/A 0.571 0.137 0.544 4e-27
Q5XIU2 638 Zinc finger protein 143 O yes N/A 0.571 0.137 0.544 5e-27
O70230 638 Zinc finger protein 143 O yes N/A 0.571 0.137 0.544 5e-27
Q58DZ6567 Zinc finger protein 143 O yes N/A 0.655 0.178 0.495 1e-26
Q91853565 Zinc finger protein 143 O N/A N/A 0.655 0.178 0.495 2e-26
P36508 570 Zinc finger protein 76 OS no N/A 0.551 0.149 0.556 2e-25
Q8BMU0 568 Zinc finger protein 76 OS no N/A 0.551 0.149 0.556 3e-25
B4F7E9 568 Zinc finger protein 76 OS no N/A 0.694 0.188 0.486 4e-25
>sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/90 (55%), Positives = 70/90 (77%)

Query: 2   KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDI 61
           +P++    +C  +FASATNYKNHMRIH+GEKPYVC V  C KRFTEYSSLYKH +VH+  
Sbjct: 348 RPYYCAEPNCGRAFASATNYKNHMRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTPC 407

Query: 62  RPFICDRCPRSYRQLCTLNVHKKTNHRESK 91
           +P+ C+ C ++Y+Q+ TL +HK+T H +++
Sbjct: 408 KPYNCNHCGKTYKQISTLAMHKRTAHNDTE 437




Transcriptional activator. Activates the gene for selenocysteine tRNA (tRNAsec). Binds to the activator element (AE) motif of the selenocysteine tRNA gene promoter.
Danio rerio (taxid: 7955)
>sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 Back     alignment and function description
>sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 Back     alignment and function description
>sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 Back     alignment and function description
>sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 Back     alignment and function description
>sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 Back     alignment and function description
>sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 Back     alignment and function description
>sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 Back     alignment and function description
>sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
47220583 693 unnamed protein product [Tetraodon nigro 0.558 0.124 0.577 4e-27
74095971 626 selenocysteine tRNA activating factor [T 0.558 0.137 0.577 2e-26
229892179 623 RecName: Full=Zinc finger protein 143; A 0.571 0.141 0.555 2e-26
117167923 623 Znf143 protein [Danio rerio] 0.571 0.141 0.555 3e-26
37595486 623 selenocysteine tRNA activating factor [D 0.571 0.141 0.555 3e-26
348535946 627 PREDICTED: zinc finger protein 143-like 0.571 0.140 0.566 3e-26
41055799 570 zinc finger protein 143 [Danio rerio] gi 0.571 0.154 0.555 5e-26
432860191 627 PREDICTED: zinc finger protein 143-like 0.571 0.140 0.566 7e-26
291237370 626 PREDICTED: zinc finger protein 76 (expre 0.662 0.162 0.519 1e-25
73988469 670 PREDICTED: zinc finger protein 143 isofo 0.571 0.131 0.544 1e-25
>gi|47220583|emb|CAG05609.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 52/90 (57%), Positives = 70/90 (77%)

Query: 2   KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDI 61
           +P++     C  SFASATNYKNHMRIH+GEKPYVC V  CQKRFTEYSSLYKH +VH+  
Sbjct: 394 RPYYCSEPSCGRSFASATNYKNHMRIHTGEKPYVCTVPGCQKRFTEYSSLYKHHVVHTPC 453

Query: 62  RPFICDRCPRSYRQLCTLNVHKKTNHRESK 91
           +P+ C+ C ++Y+Q+ TL +HK+T H +++
Sbjct: 454 KPYNCNHCGKTYKQISTLAMHKRTAHNDTE 483




Source: Tetraodon nigroviridis

Species: Tetraodon nigroviridis

Genus: Tetraodon

Family: Tetraodontidae

Order: Tetraodontiformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|74095971|ref|NP_001027837.1| selenocysteine tRNA activating factor [Takifugu rubripes] gi|37595488|gb|AAQ94618.1| selenocysteine tRNA activating factor [Takifugu rubripes] Back     alignment and taxonomy information
>gi|229892179|sp|Q1LYE3.2|ZN143_DANRE RecName: Full=Zinc finger protein 143; AltName: Full=Selenocysteine tRNA gene transcription-activating factor Back     alignment and taxonomy information
>gi|117167923|gb|AAI24736.1| Znf143 protein [Danio rerio] Back     alignment and taxonomy information
>gi|37595486|gb|AAQ94617.1| selenocysteine tRNA activating factor [Danio rerio] Back     alignment and taxonomy information
>gi|348535946|ref|XP_003455458.1| PREDICTED: zinc finger protein 143-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|41055799|ref|NP_957273.1| zinc finger protein 143 [Danio rerio] gi|33416887|gb|AAH55577.1| Zinc finger protein 143 [Danio rerio] Back     alignment and taxonomy information
>gi|432860191|ref|XP_004069436.1| PREDICTED: zinc finger protein 143-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|291237370|ref|XP_002738611.1| PREDICTED: zinc finger protein 76 (expressed in testis)-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|73988469|ref|XP_542502.2| PREDICTED: zinc finger protein 143 isoform 1 [Canis lupus familiaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
ZFIN|ZDB-GENE-040426-1586 647 znf143b "zinc finger protein 1 0.584 0.139 0.555 1.1e-25
UNIPROTKB|E7EN86 610 ZNF143 "Zinc finger protein 14 0.584 0.147 0.544 5.4e-25
UNIPROTKB|A6QQW0 613 ZNF143 "Zinc finger protein 14 0.584 0.146 0.544 5.5e-25
UNIPROTKB|E7ER34 637 ZNF143 "Zinc finger protein 14 0.584 0.141 0.544 6.1e-25
UNIPROTKB|E1C5B8 637 ZNF143 "Uncharacterized protei 0.584 0.141 0.544 6.1e-25
UNIPROTKB|P52747 638 ZNF143 "Zinc finger protein 14 0.584 0.141 0.544 6.1e-25
MGI|MGI:1277969 638 Zfp143 "zinc finger protein 14 0.584 0.141 0.544 6.1e-25
RGD|1305662 638 Zfp143 "zinc finger protein 14 0.584 0.141 0.544 6.1e-25
UNIPROTKB|Q5XIU2 638 Znf143 "Zinc finger protein 14 0.584 0.141 0.544 6.1e-25
UNIPROTKB|I3LDQ7 644 ZNF143 "Uncharacterized protei 0.584 0.139 0.544 6.3e-25
ZFIN|ZDB-GENE-040426-1586 znf143b "zinc finger protein 143b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 1.1e-25, P = 1.1e-25
 Identities = 50/90 (55%), Positives = 70/90 (77%)

Query:     2 KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDI 61
             +P++    +C  +FASATNYKNHMRIH+GEKPYVC V  C KRFTEYSSLYKH +VH+  
Sbjct:   372 RPYYCAEPNCGRAFASATNYKNHMRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTPC 431

Query:    62 RPFICDRCPRSYRQLCTLNVHKKTNHRESK 91
             +P+ C+ C ++Y+Q+ TL +HK+T H +++
Sbjct:   432 KPYNCNHCGKTYKQISTLAMHKRTAHNDTE 461


GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0005634 "nucleus" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|E7EN86 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQW0 ZNF143 "Zinc finger protein 143" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER34 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5B8 ZNF143 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P52747 ZNF143 "Zinc finger protein 143" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1277969 Zfp143 "zinc finger protein 143" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305662 Zfp143 "zinc finger protein 143" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XIU2 Znf143 "Zinc finger protein 143" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDQ7 ZNF143 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A6QQW0ZN143_BOVINNo assigned EC number0.54440.57140.1435yesN/A
Q1LYE3ZN143_DANRENo assigned EC number0.55550.57140.1412yesN/A
P52747ZN143_HUMANNo assigned EC number0.54440.57140.1379yesN/A
O70230ZN143_MOUSENo assigned EC number0.54440.57140.1379yesN/A
Q5XIU2ZN143_RATNo assigned EC number0.54440.57140.1379yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 33.5 bits (77), Expect = 0.002
 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 20 NYKNHMRIHSGEKPYVCQVRDCQKRFT 46
          N + HMR H+GEKPY C V  C K F+
Sbjct: 1  NLRRHMRTHTGEKPYKCPV--CGKSFS 25


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG2462|consensus279 99.92
KOG2462|consensus279 99.89
KOG3576|consensus267 99.76
KOG3623|consensus1007 99.74
KOG1074|consensus 958 99.58
KOG3623|consensus 1007 99.51
KOG3576|consensus267 99.48
PHA00733128 hypothetical protein 99.4
KOG1074|consensus 958 99.35
KOG3608|consensus467 99.29
KOG3608|consensus467 99.24
PHA0276855 hypothetical protein; Provisional 99.19
PHA0276855 hypothetical protein; Provisional 99.09
PLN03086567 PRLI-interacting factor K; Provisional 99.06
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.03
KOG3993|consensus500 98.9
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.88
PHA00733128 hypothetical protein 98.82
PHA0061644 hypothetical protein 98.76
PLN03086567 PRLI-interacting factor K; Provisional 98.72
PHA0073279 hypothetical protein 98.53
KOG3993|consensus500 98.49
PHA0073279 hypothetical protein 98.46
PHA0061644 hypothetical protein 98.44
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.34
COG5189423 SFP1 Putative transcriptional repressor regulating 98.29
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.25
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.23
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.21
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.11
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.05
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.0
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.9
COG5189423 SFP1 Putative transcriptional repressor regulating 97.86
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.86
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.63
smart0035526 ZnF_C2H2 zinc finger. 97.45
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.37
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.36
smart0035526 ZnF_C2H2 zinc finger. 97.33
PRK04860160 hypothetical protein; Provisional 97.22
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.16
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.07
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.86
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.52
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.28
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.26
COG5048467 FOG: Zn-finger [General function prediction only] 95.96
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.5
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.43
COG5048467 FOG: Zn-finger [General function prediction only] 95.19
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.03
KOG1146|consensus 1406 94.69
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.54
KOG2482|consensus423 94.16
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.06
KOG1146|consensus1406 93.81
KOG2893|consensus 341 93.72
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.59
KOG2231|consensus 669 93.58
COG404965 Uncharacterized protein containing archaeal-type C 93.4
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.37
KOG4173|consensus253 92.93
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.42
KOG2231|consensus 669 92.04
KOG2893|consensus 341 92.01
PRK04860160 hypothetical protein; Provisional 91.03
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.74
KOG4173|consensus253 90.12
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 89.99
KOG2482|consensus423 88.99
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 88.58
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 86.64
KOG2186|consensus 276 85.92
KOG2785|consensus390 85.7
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.13
KOG2785|consensus 390 84.84
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 84.16
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.43
PF1371736 zinc_ribbon_4: zinc-ribbon domain 82.5
COG404965 Uncharacterized protein containing archaeal-type C 82.33
COG1592166 Rubrerythrin [Energy production and conversion] 82.27
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 81.74
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 81.62
PF1371937 zinc_ribbon_5: zinc-ribbon domain 81.58
smart00531147 TFIIE Transcription initiation factor IIE. 81.5
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 81.18
KOG2186|consensus 276 80.95
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 80.56
PRK06266178 transcription initiation factor E subunit alpha; V 80.53
KOG4167|consensus907 80.44
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.34
>KOG2462|consensus Back     alignment and domain information
Probab=99.92  E-value=2.7e-25  Score=152.94  Aligned_cols=105  Identities=25%  Similarity=0.464  Sum_probs=97.1

Q ss_pred             CCeecccccccccccCHHHHHHHHHHhcCCCceeecccccCcccCChhhHHHHhhhhcCCCceeCCCCcccccCchhHHH
Q psy6598           2 KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNV   81 (154)
Q Consensus         2 k~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~   81 (154)
                      +.+.|+  +|||.|.+...|..|+++|+  -+++|.+  |||.|.+...|+.|+|+|+|+|||.|+.|+|.|.-+++|+.
T Consensus       160 ka~~C~--~C~K~YvSmpALkMHirTH~--l~c~C~i--CGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRA  233 (279)
T KOG2462|consen  160 KAFSCK--YCGKVYVSMPALKMHIRTHT--LPCECGI--CGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRA  233 (279)
T ss_pred             ccccCC--CCCceeeehHHHhhHhhccC--CCccccc--ccccccchHHhhcccccccCCCCccCCcccchhcchHHHHH
Confidence            568899  99999999999999999996  6799999  99999999999999999999999999999999999999999


Q ss_pred             HHHhhcCcCCCCCCCCCcchhhhHHhhhhcC
Q psy6598          82 HKKTNHRESKNKKPSNRNNIVKQECVQKINS  112 (154)
Q Consensus        82 H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (154)
                      ||++|...+++.+..+.+.+....-+.++..
T Consensus       234 HmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  234 HMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             HHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            9999999999999999998887766666544



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-10
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-10
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 9e-10
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-09
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 5e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 5e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-05
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 8e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 8e-04
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure

Iteration: 1

Score = 62.0 bits (149), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 2/88 (2%) Query: 2 KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDI 61 +P+ C F+ TN H+RIH+G+KP+ C++ C + F++++ L +H H+ Sbjct: 3 RPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRI--CMRNFSQHTGLNQHIRTHTGE 60 Query: 62 RPFICDRCPRSYRQLCTLNVHKKTNHRE 89 +PF CD C R + L T + H K + R+ Sbjct: 61 KPFACDICGRKFATLHTRDRHTKIHLRQ 88
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
 Score = 81.9 bits (203), Expect = 8e-21
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 2   KPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKH-TLVHSD 60
           KP       C+ S++   N K H+R H+GEKPY+C+   C K F+  S   KH    HS+
Sbjct: 66  KPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSN 125

Query: 61  IRPFICDR--CPRSYRQLCTLNVHKKT 85
            +P++C    C + Y    +L  H KT
Sbjct: 126 EKPYVCKLPGCTKRYTDPSSLRKHVKT 152


>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.91
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.9
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.86
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.86
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.85
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.85
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.84
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.84
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.83
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.77
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.77
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.76
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.74
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.74
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.73
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.73
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.73
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.72
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.72
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.71
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.7
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.7
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.7
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.69
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.68
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.67
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.66
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.65
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.65
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.64
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.64
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.64
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.63
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.62
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.62
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.6
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.6
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.6
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.59
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.57
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.57
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.57
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.55
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.55
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.54
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.54
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.53
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.52
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.48
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.47
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.45
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.45
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.45
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.44
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.44
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.44
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.43
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.43
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.42
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.42
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.42
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.39
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.39
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.36
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.36
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.35
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.34
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.34
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.32
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.3
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.3
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.3
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.29
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.26
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.23
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.22
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.22
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.21
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.21
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.2
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.19
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.18
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.18
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.18
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.15
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.13
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.1
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.03
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.02
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.0
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.0
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.99
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.97
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.96
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.95
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.92
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.9
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.89
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.87
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.85
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.83
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.82
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.81
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.8
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.79
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.78
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.77
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.7
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.7
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.7
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.69
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.68
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.68
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.68
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.68
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.68
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.67
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.65
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.65
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.65
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.64
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.64
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.63
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.63
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.61
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.6
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.02
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.59
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.57
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.98
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.56
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.56
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.56
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.55
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.95
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.5
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.87
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.46
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.46
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.44
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.78
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.33
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.68
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.41
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.98
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.86
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.24
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.03
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.33
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.2
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 93.2
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.77
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.21
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.44
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.27
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 88.96
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.61
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 87.33
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.92
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.06
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 83.69
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 82.11
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 81.64
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 80.46
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 80.2
4i1l_A93 Scurfin, forkhead box protein P3; FOXP3, dimerizat 80.15
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.94  E-value=1.2e-26  Score=148.23  Aligned_cols=88  Identities=28%  Similarity=0.504  Sum_probs=84.5

Q ss_pred             CCCeecccccccccccCHHHHHHHHHHhcCCCceeecccccCcccCChhhHHHHhhhhcCCCceeCCCCcccccCchhHH
Q psy6598           1 MKPFFYFPWDCKISFASATNYKNHMRIHSGEKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLN   80 (154)
Q Consensus         1 ~k~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   80 (154)
                      |++|+|.  .||+.|.....|..|+++|+++++|.|..  |++.|.....|..|+++|++++||.|+.||+.|.....|.
T Consensus        20 ek~y~C~--~C~k~F~~~~~L~~H~~~H~~~k~~~C~~--C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~   95 (133)
T 2lt7_A           20 RVYYICI--VCKRSYVCLTSLRRHFNIHSWEKKYPCRY--CEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMS   95 (133)
T ss_dssp             EEEEEET--TTCCEESCHHHHHHHHHHHHCCSCEECSS--SSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESSHHHHH
T ss_pred             CcCeECC--CCCCCcCCHHHHHHHHHHcCCCCCeeCCc--cCeecccccchhhhccccCCCccccCCCCCCCcCCHHHHH
Confidence            4789999  99999999999999999999999999998  9999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCcCCC
Q psy6598          81 VHKKTNHRESKN   92 (154)
Q Consensus        81 ~H~~~~~~~~~~   92 (154)
                      .|+++||++.+.
T Consensus        96 ~H~~~hh~~~p~  107 (133)
T 2lt7_A           96 SHIKSVHSQDPS  107 (133)
T ss_dssp             HHHHHHTCCCTT
T ss_pred             HHhHHhcCCCCC
Confidence            999999987654



>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>4i1l_A Scurfin, forkhead box protein P3; FOXP3, dimerization, complex ensemble, stability, regulatory activity, acetyation, DNA-binding, metal-binding; 2.10A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d2glia529 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.7 bits (105), Expect = 7e-08
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 31 EKPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKT 85
          +K Y CQ   C K FT  S   +H  +H  +RP+ C  C + ++    L  H K 
Sbjct: 1  DKLYPCQ---CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI 52


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.77
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.77
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.5
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.44
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.42
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.42
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.4
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.36
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.36
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.34
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.33
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.32
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.3
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.29
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.29
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.28
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.28
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.27
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.27
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.26
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.24
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.24
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.24
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.22
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.16
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.14
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.14
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.13
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.13
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.11
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.09
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.79
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.79
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.6
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.53
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.41
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.37
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.36
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.34
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.33
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.31
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.27
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.26
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.23
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.2
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.07
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.06
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.06
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 98.04
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.0
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.96
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.88
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.86
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.84
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.82
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.82
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.82
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.79
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.77
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.73
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.71
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.68
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.61
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.6
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.57
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.52
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.45
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.44
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.4
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.26
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.22
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.11
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.95
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.88
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.71
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 96.57
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.42
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.38
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.14
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.97
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.96
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.91
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.83
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.83
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.81
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 95.68
d1y0jb136 U-shaped transcription factor, different fingers { 95.42
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.22
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.06
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.93
d1y0jb136 U-shaped transcription factor, different fingers { 94.63
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.48
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.03
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.86
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 92.83
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.81
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.62
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.27
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.58
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.47
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.44
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 89.92
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 89.71
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 89.54
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.1
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.9
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.47
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 86.82
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 86.76
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 85.38
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 85.31
d1fu9a_36 U-shaped transcription factor, different fingers { 82.7
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=1.7e-19  Score=95.58  Aligned_cols=51  Identities=33%  Similarity=0.615  Sum_probs=27.4

Q ss_pred             CceeecccccCcccCChhhHHHHhhhhcCCCceeCCCCcccccCchhHHHHHHh
Q psy6598          32 KPYVCQVRDCQKRFTEYSSLYKHTLVHSDIRPFICDRCPRSYRQLCTLNVHKKT   85 (154)
Q Consensus        32 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   85 (154)
                      +||.| .  ||+.|.....|..|+++|++++||.|..||++|...+.|..||++
T Consensus         2 K~y~C-~--Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           2 KLYPC-Q--CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCEEC-T--TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             cCCCC-C--CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            45555 3  555555555555555555555555555555555555555555544



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure