Psyllid ID: psy6621
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 195491875 | 869 | GE21469 [Drosophila yakuba] gi|194179852 | 0.616 | 0.094 | 0.646 | 4e-26 | |
| 91078378 | 866 | PREDICTED: similar to Leucyl-tRNA synthe | 0.781 | 0.120 | 0.559 | 4e-26 | |
| 195428976 | 877 | GK16600 [Drosophila willistoni] gi|19415 | 0.759 | 0.115 | 0.535 | 6e-26 | |
| 195587864 | 869 | GD13863 [Drosophila simulans] gi|1941956 | 0.616 | 0.094 | 0.646 | 6e-26 | |
| 194866776 | 870 | GG15248 [Drosophila erecta] gi|190653726 | 0.616 | 0.094 | 0.646 | 6e-26 | |
| 21355409 | 869 | Leucyl-tRNA synthetase [Drosophila melan | 0.616 | 0.094 | 0.646 | 6e-26 | |
| 328702417 | 872 | PREDICTED: probable leucyl-tRNA syntheta | 0.624 | 0.095 | 0.638 | 9e-26 | |
| 195337561 | 869 | GM14681 [Drosophila sechellia] gi|194128 | 0.616 | 0.094 | 0.646 | 9e-26 | |
| 427712401 | 856 | leucyl-tRNA synthetase [Synechococcus sp | 0.616 | 0.095 | 0.646 | 2e-25 | |
| 257060679 | 856 | leucyl-tRNA synthetase [Cyanothece sp. P | 0.616 | 0.095 | 0.658 | 2e-25 |
| >gi|195491875|ref|XP_002093751.1| GE21469 [Drosophila yakuba] gi|194179852|gb|EDW93463.1| GE21469 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Score = 122 bits (307), Expect = 4e-26, Method: Compositional matrix adjust.
Identities = 53/82 (64%), Positives = 62/82 (75%)
Query: 40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
VFQPMGWD+FGLPAENAA+Q G++P WT NI+ MK QLQ GC F+W EL+TC PKY
Sbjct: 102 VFQPMGWDSFGLPAENAANQRGVEPASWTKQNISQMKEQLQRLGCSFDWNHELSTCSPKY 161
Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
YKWTQ LFL L+ GL Y+ E
Sbjct: 162 YKWTQHLFLMLHRHGLAYQNEA 183
|
Source: Drosophila yakuba Species: Drosophila yakuba Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91078378|ref|XP_974191.1| PREDICTED: similar to Leucyl-tRNA synthetase CG7479-PA [Tribolium castaneum] gi|270003885|gb|EFA00333.1| hypothetical protein TcasGA2_TC003172 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195428976|ref|XP_002062540.1| GK16600 [Drosophila willistoni] gi|194158625|gb|EDW73526.1| GK16600 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195587864|ref|XP_002083681.1| GD13863 [Drosophila simulans] gi|194195690|gb|EDX09266.1| GD13863 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|194866776|ref|XP_001971943.1| GG15248 [Drosophila erecta] gi|190653726|gb|EDV50969.1| GG15248 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|21355409|ref|NP_647932.1| Leucyl-tRNA synthetase [Drosophila melanogaster] gi|7292541|gb|AAF47943.1| Leucyl-tRNA synthetase [Drosophila melanogaster] gi|19528361|gb|AAL90295.1| LD44376p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|328702417|ref|XP_003241894.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195337561|ref|XP_002035397.1| GM14681 [Drosophila sechellia] gi|194128490|gb|EDW50533.1| GM14681 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|427712401|ref|YP_007061025.1| leucyl-tRNA synthetase [Synechococcus sp. PCC 6312] gi|427376530|gb|AFY60482.1| leucyl-tRNA synthetase [Synechococcus sp. PCC 6312] | Back alignment and taxonomy information |
|---|
| >gi|257060679|ref|YP_003138567.1| leucyl-tRNA synthetase [Cyanothece sp. PCC 8802] gi|256590845|gb|ACV01732.1| leucyl-tRNA synthetase [Cyanothece sp. PCC 8802] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| FB|FBgn0027085 | 869 | Aats-leu "Leucyl-tRNA syntheta | 0.609 | 0.093 | 0.654 | 2.9e-26 | |
| UNIPROTKB|E1BXI7 | 906 | LARS2 "Uncharacterized protein | 0.624 | 0.091 | 0.578 | 9.3e-24 | |
| UNIPROTKB|I3LLA2 | 203 | LOC100738466 "Uncharacterized | 0.631 | 0.413 | 0.559 | 1.8e-23 | |
| ZFIN|ZDB-GENE-070928-3 | 891 | lars2 "leucyl-tRNA synthetase | 0.616 | 0.092 | 0.573 | 1.9e-23 | |
| TIGR_CMR|ECH_0794 | 829 | ECH_0794 "leucyl-tRNA syntheta | 0.624 | 0.100 | 0.578 | 7.3e-23 | |
| ASPGD|ASPL0000008770 | 990 | AN6526 [Emericella nidulans (t | 0.631 | 0.084 | 0.581 | 1.6e-22 | |
| TIGR_CMR|CHY_0393 | 821 | CHY_0393 "leucyl-tRNA syntheta | 0.609 | 0.098 | 0.573 | 1.9e-22 | |
| TIGR_CMR|GSU_2209 | 824 | GSU_2209 "leucyl-tRNA syntheta | 0.601 | 0.097 | 0.587 | 1.9e-22 | |
| UNIPROTKB|F1MGP9 | 616 | LARS2 "Uncharacterized protein | 0.624 | 0.134 | 0.566 | 2.2e-22 | |
| SGD|S000004374 | 894 | NAM2 "Mitochondrial leucyl-tRN | 0.654 | 0.097 | 0.568 | 2.2e-22 |
| FB|FBgn0027085 Aats-leu "Leucyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 307 (113.1 bits), Expect = 2.9e-26, P = 2.9e-26
Identities = 53/81 (65%), Positives = 62/81 (76%)
Query: 40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
VFQPMGWD+FGLPAENAA+Q G++P WT NIA MK QL+ GC F+W EL+TC PKY
Sbjct: 102 VFQPMGWDSFGLPAENAANQRGVEPASWTEQNIAQMKEQLKRLGCSFDWNHELSTCSPKY 161
Query: 100 YKWTQALFLDLYHAGLVYRKE 120
YKWTQ LFL L+ GL Y+ E
Sbjct: 162 YKWTQHLFLMLHRHGLAYQNE 182
|
|
| UNIPROTKB|E1BXI7 LARS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLA2 LOC100738466 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070928-3 lars2 "leucyl-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0794 ECH_0794 "leucyl-tRNA synthetase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000008770 AN6526 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0393 CHY_0393 "leucyl-tRNA synthetase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2209 GSU_2209 "leucyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MGP9 LARS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004374 NAM2 "Mitochondrial leucyl-tRNA synthetase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| PRK00390 | 805 | PRK00390, leuS, leucyl-tRNA synthetase; Validated | 4e-48 | |
| TIGR00396 | 842 | TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba | 4e-40 | |
| COG0495 | 814 | COG0495, LeuS, Leucyl-tRNA synthetase [Translation | 2e-38 | |
| cd00812 | 314 | cd00812, LeuRS_core, catalytic core domain of leuc | 3e-38 | |
| PLN02563 | 963 | PLN02563, PLN02563, aminoacyl-tRNA ligase | 3e-30 | |
| PRK13208 | 800 | PRK13208, valS, valyl-tRNA synthetase; Reviewed | 1e-17 | |
| cd00817 | 382 | cd00817, ValRS_core, catalytic core domain of valy | 7e-14 | |
| cd00668 | 312 | cd00668, Ile_Leu_Val_MetRS_core, catalytic core do | 2e-13 | |
| COG0525 | 877 | COG0525, ValS, Valyl-tRNA synthetase [Translation, | 2e-13 | |
| TIGR00422 | 861 | TIGR00422, valS, valyl-tRNA synthetase | 6e-11 | |
| COG0143 | 558 | COG0143, MetG, Methionyl-tRNA synthetase [Translat | 4e-06 | |
| cd00814 | 319 | cd00814, MetRS_core, catalytic core domain of meth | 7e-06 | |
| pfam09334 | 388 | pfam09334, tRNA-synt_1g, tRNA synthetases class I | 1e-04 | |
| TIGR00398 | 530 | TIGR00398, metG, methionyl-tRNA synthetase | 1e-04 | |
| pfam00133 | 606 | pfam00133, tRNA-synt_1, tRNA synthetases class I ( | 3e-04 | |
| PRK00133 | 673 | PRK00133, metG, methionyl-tRNA synthetase; Reviewe | 8e-04 | |
| PRK12268 | 556 | PRK12268, PRK12268, methionyl-tRNA synthetase; Rev | 0.001 | |
| PRK11893 | 511 | PRK11893, PRK11893, methionyl-tRNA synthetase; Rev | 0.001 | |
| TIGR00392 | 861 | TIGR00392, ileS, isoleucyl-tRNA synthetase | 0.001 |
| >gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
Score = 164 bits (417), Expect = 4e-48
Identities = 52/82 (63%), Positives = 59/82 (71%)
Query: 40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
V PMGWDAFGLPAENAA + G P EWT NIA MK QL+ G ++W E+ATCDP+Y
Sbjct: 72 VLHPMGWDAFGLPAENAAIKTGTHPAEWTYENIANMKKQLKSLGFSYDWSREIATCDPEY 131
Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
YKWTQ +FL LY GL YRKE
Sbjct: 132 YKWTQWIFLKLYEKGLAYRKES 153
|
Length = 805 |
| >gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family | Back alignment and domain information |
|---|
| >gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) | Back alignment and domain information |
|---|
| >gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) | Back alignment and domain information |
|---|
| >gnl|CDD|234655 PRK00133, metG, methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237029 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| COG0495 | 814 | LeuS Leucyl-tRNA synthetase [Translation, ribosoma | 100.0 | |
| TIGR00396 | 842 | leuS_bact leucyl-tRNA synthetase, eubacterial and | 100.0 | |
| KOG0435|consensus | 876 | 100.0 | ||
| PLN02563 | 963 | aminoacyl-tRNA ligase | 100.0 | |
| PRK00390 | 805 | leuS leucyl-tRNA synthetase; Validated | 100.0 | |
| cd00817 | 382 | ValRS_core catalytic core domain of valyl-tRNA syn | 100.0 | |
| PRK06039 | 975 | ileS isoleucyl-tRNA synthetase; Reviewed | 100.0 | |
| PRK13208 | 800 | valS valyl-tRNA synthetase; Reviewed | 100.0 | |
| TIGR00392 | 861 | ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA | 100.0 | |
| PRK13804 | 961 | ileS isoleucyl-tRNA synthetase; Provisional | 100.0 | |
| PRK05743 | 912 | ileS isoleucyl-tRNA synthetase; Reviewed | 100.0 | |
| PF00133 | 601 | tRNA-synt_1: tRNA synthetases class I (I, L, M and | 100.0 | |
| COG0525 | 877 | ValS Valyl-tRNA synthetase [Translation, ribosomal | 100.0 | |
| PLN02943 | 958 | aminoacyl-tRNA ligase | 100.0 | |
| COG0143 | 558 | MetG Methionyl-tRNA synthetase [Translation, ribos | 100.0 | |
| TIGR00422 | 861 | valS valyl-tRNA synthetase. The valyl-tRNA synthet | 100.0 | |
| PLN02381 | 1066 | valyl-tRNA synthetase | 100.0 | |
| PRK05729 | 874 | valS valyl-tRNA synthetase; Reviewed | 100.0 | |
| cd00812 | 314 | LeuRS_core catalytic core domain of leucyl-tRNA sy | 100.0 | |
| PLN02843 | 974 | isoleucyl-tRNA synthetase | 100.0 | |
| TIGR00395 | 938 | leuS_arch leucyl-tRNA synthetase, archaeal and cyt | 100.0 | |
| PRK14900 | 1052 | valS valyl-tRNA synthetase; Provisional | 100.0 | |
| PTZ00419 | 995 | valyl-tRNA synthetase-like protein; Provisional | 100.0 | |
| PF09334 | 391 | tRNA-synt_1g: tRNA synthetases class I (M); InterP | 100.0 | |
| PLN02224 | 616 | methionine-tRNA ligase | 100.0 | |
| PLN02882 | 1159 | aminoacyl-tRNA ligase | 100.0 | |
| COG0060 | 933 | IleS Isoleucyl-tRNA synthetase [Translation, ribos | 100.0 | |
| PTZ00427 | 1205 | isoleucine-tRNA ligase, putative; Provisional | 100.0 | |
| cd00818 | 338 | IleRS_core catalytic core domain of isoleucyl-tRNA | 100.0 | |
| cd00814 | 319 | MetRS_core catalytic core domain of methioninyl-tR | 100.0 | |
| cd00668 | 312 | Ile_Leu_Val_MetRS_core catalytic core domain of is | 100.0 | |
| PLN02610 | 801 | probable methionyl-tRNA synthetase | 100.0 | |
| PRK12268 | 556 | methionyl-tRNA synthetase; Reviewed | 100.0 | |
| PRK00133 | 673 | metG methionyl-tRNA synthetase; Reviewed | 100.0 | |
| TIGR00398 | 530 | metG methionyl-tRNA synthetase. The methionyl-tRNA | 99.98 | |
| PLN02959 | 1084 | aminoacyl-tRNA ligase | 99.98 | |
| PRK12267 | 648 | methionyl-tRNA synthetase; Reviewed | 99.98 | |
| PRK11893 | 511 | methionyl-tRNA synthetase; Reviewed | 99.97 | |
| PRK12300 | 897 | leuS leucyl-tRNA synthetase; Reviewed | 99.97 | |
| PRK12418 | 384 | cysteinyl-tRNA synthetase; Provisional | 99.96 | |
| PLN02946 | 557 | cysteine-tRNA ligase | 99.96 | |
| PRK00260 | 463 | cysS cysteinyl-tRNA synthetase; Validated | 99.96 | |
| TIGR00435 | 465 | cysS cysteinyl-tRNA synthetase. This model finds t | 99.96 | |
| TIGR03447 | 411 | mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- | 99.96 | |
| PRK14535 | 699 | cysS cysteinyl-tRNA synthetase; Provisional | 99.95 | |
| PRK14536 | 490 | cysS cysteinyl-tRNA synthetase; Provisional | 99.95 | |
| KOG0433|consensus | 937 | 99.95 | ||
| PRK14534 | 481 | cysS cysteinyl-tRNA synthetase; Provisional | 99.95 | |
| PTZ00399 | 651 | cysteinyl-tRNA-synthetase; Provisional | 99.95 | |
| KOG0436|consensus | 578 | 99.95 | ||
| KOG0432|consensus | 995 | 99.94 | ||
| PF01406 | 300 | tRNA-synt_1e: tRNA synthetases class I (C) catalyt | 99.94 | |
| cd00671 | 212 | ArgRS_core catalytic core domain of arginyl-tRNA s | 99.94 | |
| COG0215 | 464 | CysS Cysteinyl-tRNA synthetase [Translation, ribos | 99.92 | |
| cd00672 | 213 | CysRS_core catalytic core domain of cysteinyl tRNA | 99.91 | |
| KOG0434|consensus | 1070 | 99.9 | ||
| PRK01611 | 507 | argS arginyl-tRNA synthetase; Reviewed | 99.89 | |
| KOG2007|consensus | 586 | 99.83 | ||
| cd00674 | 353 | LysRS_core_class_I catalytic core domain of class | 99.76 | |
| cd00802 | 143 | class_I_aaRS_core catalytic core domain of class I | 99.75 | |
| KOG1247|consensus | 567 | 99.73 | ||
| KOG0437|consensus | 1080 | 99.66 | ||
| PRK12451 | 562 | arginyl-tRNA synthetase; Reviewed | 99.61 | |
| PF00750 | 354 | tRNA-synt_1d: tRNA synthetases class I (R); InterP | 99.58 | |
| TIGR00456 | 566 | argS arginyl-tRNA synthetase. This model recognize | 99.55 | |
| COG0018 | 577 | ArgS Arginyl-tRNA synthetase [Translation, ribosom | 99.54 | |
| PRK00750 | 510 | lysK lysyl-tRNA synthetase; Reviewed | 99.53 | |
| PLN02286 | 576 | arginine-tRNA ligase | 99.49 | |
| cd09287 | 240 | GluRS_non_core catalytic core domain of non-discri | 99.49 | |
| PRK04156 | 567 | gltX glutamyl-tRNA synthetase; Provisional | 99.37 | |
| cd00807 | 238 | GlnRS_core catalytic core domain of glutaminyl-tRN | 99.33 | |
| TIGR00463 | 560 | gltX_arch glutamyl-tRNA synthetase, archaeal and e | 99.33 | |
| PLN03233 | 523 | putative glutamate-tRNA ligase; Provisional | 99.31 | |
| COG0008 | 472 | GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr | 99.31 | |
| TIGR03838 | 272 | queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe | 99.31 | |
| TIGR00467 | 515 | lysS_arch lysyl-tRNA synthetase, archaeal and spir | 99.3 | |
| PTZ00402 | 601 | glutamyl-tRNA synthetase; Provisional | 99.29 | |
| PF00749 | 314 | tRNA-synt_1c: tRNA synthetases class I (E and Q), | 99.27 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.26 | |
| TIGR00440 | 522 | glnS glutaminyl-tRNA synthetase. This protein is a | 99.24 | |
| PRK05710 | 299 | glutamyl-Q tRNA(Asp) synthetase; Reviewed | 99.24 | |
| PRK12410 | 433 | glutamylglutaminyl-tRNA synthetase; Provisional | 99.23 | |
| PRK05347 | 554 | glutaminyl-tRNA synthetase; Provisional | 99.22 | |
| PTZ00437 | 574 | glutaminyl-tRNA synthetase; Provisional | 99.22 | |
| PRK12558 | 445 | glutamyl-tRNA synthetase; Provisional | 99.21 | |
| TIGR00464 | 470 | gltX_bact glutamyl-tRNA synthetase, bacterial fami | 99.19 | |
| cd00418 | 230 | GlxRS_core catalytic core domain of glutamyl-tRNA | 99.17 | |
| PRK14703 | 771 | glutaminyl-tRNA synthetase/YqeY domain fusion prot | 99.14 | |
| PRK14895 | 513 | gltX glutamyl-tRNA synthetase; Provisional | 99.12 | |
| PLN02859 | 788 | glutamine-tRNA ligase | 99.12 | |
| PRK01406 | 476 | gltX glutamyl-tRNA synthetase; Reviewed | 99.09 | |
| PLN02627 | 535 | glutamyl-tRNA synthetase | 99.06 | |
| cd00808 | 239 | GluRS_core catalytic core domain of discriminating | 99.04 | |
| KOG1147|consensus | 712 | 98.99 | ||
| KOG1148|consensus | 764 | 98.34 | ||
| KOG1149|consensus | 524 | 98.2 | ||
| KOG4426|consensus | 656 | 98.17 | ||
| PF01921 | 360 | tRNA-synt_1f: tRNA synthetases class I (K); InterP | 98.12 | |
| COG1384 | 521 | LysS Lysyl-tRNA synthetase (class I) [Translation, | 97.93 | |
| KOG1195|consensus | 567 | 97.57 | ||
| cd00806 | 280 | TrpRS_core catalytic core domain of tryptophanyl-t | 95.99 | |
| cd00805 | 269 | TyrRS_core catalytic core domain of tyrosinyl-tRNA | 95.15 | |
| PRK12285 | 368 | tryptophanyl-tRNA synthetase; Reviewed | 95.15 | |
| cd00395 | 273 | Tyr_Trp_RS_core catalytic core domain of tyrosinyl | 94.94 | |
| PRK12284 | 431 | tryptophanyl-tRNA synthetase; Reviewed | 94.37 | |
| PLN02486 | 383 | aminoacyl-tRNA ligase | 94.16 | |
| COG0180 | 314 | TrpS Tryptophanyl-tRNA synthetase [Translation, ri | 93.88 | |
| PRK13354 | 410 | tyrosyl-tRNA synthetase; Provisional | 93.78 | |
| TIGR00233 | 328 | trpS tryptophanyl-tRNA synthetase. This model repr | 93.77 | |
| PLN02886 | 389 | aminoacyl-tRNA ligase | 93.05 | |
| PRK00927 | 333 | tryptophanyl-tRNA synthetase; Reviewed | 92.99 | |
| PRK12556 | 332 | tryptophanyl-tRNA synthetase; Provisional | 92.66 | |
| PRK05912 | 408 | tyrosyl-tRNA synthetase; Validated | 92.29 | |
| PRK08560 | 329 | tyrosyl-tRNA synthetase; Validated | 92.27 | |
| COG0162 | 401 | TyrS Tyrosyl-tRNA synthetase [Translation, ribosom | 91.16 | |
| PTZ00126 | 383 | tyrosyl-tRNA synthetase; Provisional | 91.15 | |
| PRK12282 | 333 | tryptophanyl-tRNA synthetase II; Reviewed | 90.79 | |
| PRK12283 | 398 | tryptophanyl-tRNA synthetase; Reviewed | 90.04 | |
| TIGR00234 | 377 | tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy | 89.54 | |
| PF00579 | 292 | tRNA-synt_1b: tRNA synthetases class I (W and Y); | 86.84 | |
| PTZ00348 | 682 | tyrosyl-tRNA synthetase; Provisional | 82.12 |
| >COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-39 Score=274.58 Aligned_cols=124 Identities=45% Similarity=0.754 Sum_probs=121.4
Q ss_pred CCCCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCChHHHHHHHHHHHHHHHH
Q psy6621 1 MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQ 80 (133)
Q Consensus 1 ~y~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~~~~~~~~~~~~~~~l~ 80 (133)
|| |||||.||+||+|++++.|+++||+||+| |+|++++|||.+|+|+|.+|.+.|.+|..|+..+++.|+++|+
T Consensus 41 mf-PYpSG~LHvGH~r~Yti~Dv~aRykRm~G-----yNVL~PMGwdafGlPae~~A~~~~~~P~~wt~~ni~~~k~qlk 114 (814)
T COG0495 41 MF-PYPSGALHVGHVRNYTIGDVIARYKRMQG-----YNVLHPMGWDAFGLPAENAAIKIGTDPAKWTYYNIAYMKKQLK 114 (814)
T ss_pred CC-CCCCCCcccCccccccHHHHHHHHHHhcC-----CeecccCcccccCchHHHHHHHhCCChHHHHHHHHHHHHHHHH
Confidence 45 48999999999999999999999999999 9999999999999999999999999999999999999999999
Q ss_pred hcCcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621 81 GFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK 130 (133)
Q Consensus 81 ~lgi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~ 130 (133)
+||.++||++++.|++|+|.+++||+|.+|+++|+||+++.+|+|||.++
T Consensus 115 ~lG~siDW~Ref~T~Dp~Yyk~~QW~F~kL~ekGL~y~~~~~VnwcP~d~ 164 (814)
T COG0495 115 SLGFSIDWRREFATCDPEYYKWIQWQFLKLYEKGLAYRKEAPVNWCPVDG 164 (814)
T ss_pred HhCCccccccceecCCccHHHHHHHHHHHHHHCCCEEeccccceeCCCcC
Confidence 99999999999999999999999999999999999999999999999986
|
|
| >TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family | Back alignment and domain information |
|---|
| >KOG0435|consensus | Back alignment and domain information |
|---|
| >PLN02563 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PRK00390 leuS leucyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases | Back alignment and domain information |
|---|
| >PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK13208 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00392 ileS isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK13804 ileS isoleucyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02943 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00422 valS valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02381 valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05729 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >PLN02843 isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family | Back alignment and domain information |
|---|
| >PRK14900 valS valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00419 valyl-tRNA synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN02224 methionine-tRNA ligase | Back alignment and domain information |
|---|
| >PLN02882 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00427 isoleucine-tRNA ligase, putative; Provisional | Back alignment and domain information |
|---|
| >cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases | Back alignment and domain information |
|---|
| >PLN02610 probable methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12268 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK00133 metG methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00398 metG methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02959 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PRK12267 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK11893 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12300 leuS leucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12418 cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02946 cysteine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK00260 cysS cysteinyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00435 cysS cysteinyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase | Back alignment and domain information |
|---|
| >PRK14535 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14536 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0433|consensus | Back alignment and domain information |
|---|
| >PRK14534 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00399 cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0436|consensus | Back alignment and domain information |
|---|
| >KOG0432|consensus | Back alignment and domain information |
|---|
| >PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases | Back alignment and domain information |
|---|
| >COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase | Back alignment and domain information |
|---|
| >KOG0434|consensus | Back alignment and domain information |
|---|
| >PRK01611 argS arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG2007|consensus | Back alignment and domain information |
|---|
| >cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase | Back alignment and domain information |
|---|
| >cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG1247|consensus | Back alignment and domain information |
|---|
| >KOG0437|consensus | Back alignment and domain information |
|---|
| >PRK12451 arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >TIGR00456 argS arginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00750 lysK lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02286 arginine-tRNA ligase | Back alignment and domain information |
|---|
| >cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK04156 gltX glutamyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family | Back alignment and domain information |
|---|
| >PLN03233 putative glutamate-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase | Back alignment and domain information |
|---|
| >TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete | Back alignment and domain information |
|---|
| >PTZ00402 glutamyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >TIGR00440 glnS glutaminyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05347 glutaminyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00437 glutaminyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12558 glutamyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family | Back alignment and domain information |
|---|
| >cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK14895 gltX glutamyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02859 glutamine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK01406 gltX glutamyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02627 glutamyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >KOG1148|consensus | Back alignment and domain information |
|---|
| >KOG1149|consensus | Back alignment and domain information |
|---|
| >KOG4426|consensus | Back alignment and domain information |
|---|
| >PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1195|consensus | Back alignment and domain information |
|---|
| >cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12285 tryptophanyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12284 tryptophanyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02486 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13354 tyrosyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00233 trpS tryptophanyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02886 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PRK00927 tryptophanyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12556 tryptophanyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05912 tyrosyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08560 tyrosyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00126 tyrosyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12282 tryptophanyl-tRNA synthetase II; Reviewed | Back alignment and domain information |
|---|
| >PRK12283 tryptophanyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00234 tyrS tyrosyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PTZ00348 tyrosyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 133 | ||||
| 4aq7_A | 880 | Ternary Complex Of E. Coli Leucyl-Trna Synthetase, | 5e-23 | ||
| 2v0c_A | 878 | Leucyl-Trna Synthetase From Thermus Thermophilus Co | 5e-22 | ||
| 1obh_A | 878 | Leucyl-Trna Synthetase From Thermus Thermophilus Co | 5e-22 | ||
| 3ziu_A | 637 | Crystal Structure Of Mycoplasma Mobile Leucyl-trna | 5e-19 | ||
| 1qu2_A | 917 | Insights Into Editing From An Ile-Trna Synthetase S | 6e-04 |
| >pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 | Back alignment and structure |
|
| >pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 | Back alignment and structure |
| >pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 | Back alignment and structure |
| >pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 | Back alignment and structure |
| >pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin Length = 917 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 2e-49 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 9e-49 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 3e-26 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 1e-24 | |
| 1rqg_A | 722 | Methionyl-tRNA synthetase; translation, dimerizati | 3e-06 | |
| 3h99_A | 560 | Methionyl-tRNA synthetase; rossmann fold, aminoacy | 8e-06 | |
| 3tun_A | 542 | Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta | 5e-04 |
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 | Back alignment and structure |
|---|
Score = 167 bits (426), Expect = 2e-49
Identities = 45/82 (54%), Positives = 56/82 (68%)
Query: 40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
V QP+GWDAFGLPAE AA ++ P WT NIA MK+QL+ G ++W ELATC P+Y
Sbjct: 93 VLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEY 152
Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
Y+W Q F +LY GLVY+K
Sbjct: 153 YRWEQKFFTELYKKGLVYKKTS 174
|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 | Back alignment and structure |
|---|
| >1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722 | Back alignment and structure |
|---|
| >3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560 | Back alignment and structure |
|---|
| >3tun_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, translation, nucleotide binding; HET: C13; 2.55A {Trypanosoma brucei} Length = 542 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 1ffy_A | 917 | Isoleucyl-tRNA synthetase; protein-RNA complex, me | 100.0 | |
| 3u1f_A | 542 | Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta | 100.0 | |
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 100.0 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 100.0 | |
| 1gax_A | 862 | Valrs, valyl-tRNA synthetase; protein-RNA complex, | 100.0 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 100.0 | |
| 1ile_A | 821 | Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s | 100.0 | |
| 1rqg_A | 722 | Methionyl-tRNA synthetase; translation, dimerizati | 100.0 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 100.0 | |
| 2x1l_A | 524 | Methionyl-tRNA synthetase; nucleotide-binding, pro | 100.0 | |
| 2csx_A | 497 | Methionyl-tRNA synthetase; ligase, riken structura | 100.0 | |
| 2d5b_A | 500 | Methionyl-tRNA synthetase; rossmann fold, class 1A | 100.0 | |
| 3h99_A | 560 | Methionyl-tRNA synthetase; rossmann fold, aminoacy | 100.0 | |
| 3kfl_A | 564 | Methionyl-tRNA synthetase; parasite, aminoacyl-tRN | 99.97 | |
| 4dlp_A | 536 | Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA | 99.97 | |
| 3tqo_A | 462 | Cysteinyl-tRNA synthetase; protein synthesis, liga | 99.97 | |
| 3sp1_A | 501 | Cysteinyl-tRNA synthetase; structural genomics, se | 99.97 | |
| 3c8z_A | 414 | Cysteinyl-tRNA synthetase; cysteine ligase, rossma | 99.96 | |
| 1li5_A | 461 | Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys | 99.95 | |
| 2zue_A | 629 | Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase | 99.82 | |
| 1iq0_A | 592 | Arginyl-tRNA synthetase; riken structural genomics | 99.81 | |
| 1irx_A | 523 | Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin | 99.77 | |
| 1f7u_A | 607 | Arginyl-tRNA synthetase; RNA-protein complex, amin | 99.77 | |
| 3fnr_A | 464 | Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX | 99.65 | |
| 1nzj_A | 298 | Hypothetical protein YADB; Zn cluster, glutamyl T- | 99.37 | |
| 3aii_A | 553 | Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta | 99.36 | |
| 1qtq_A | 553 | GLNRS, protein (glutaminyl-tRNA synthetase); gluta | 99.34 | |
| 3al0_C | 592 | Glutamyl-tRNA(Gln) amidotransferase subunit C, GL | 99.31 | |
| 2o5r_A | 481 | Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g | 99.28 | |
| 2hz7_A | 851 | Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c | 99.27 | |
| 4g6z_A | 490 | Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, | 99.25 | |
| 2cfo_A | 492 | Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s | 99.25 | |
| 4gri_A | 512 | Glutamate--tRNA ligase; structural genomics, seatt | 99.21 | |
| 3afh_A | 488 | Glutamyl-tRNA synthetase 2; protein-substrate comp | 99.18 | |
| 1j09_A | 468 | Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r | 99.15 | |
| 2ja2_A | 498 | Glutamyl-tRNA synthetase; non-discriminating gluta | 99.11 | |
| 3tzl_A | 322 | Tryptophanyl-tRNA synthetase; structural genomics, | 95.6 | |
| 2g36_A | 340 | Tryptophanyl-tRNA synthetase; TM0492, structural g | 95.51 | |
| 2cyb_A | 323 | Tyrosyl-tRNA synthetase; rossmann-fold, structural | 95.46 | |
| 3a04_A | 372 | Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR | 95.12 | |
| 2el7_A | 337 | Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth | 95.03 | |
| 1i6k_A | 328 | TRPRS, tryptophanyl-tRNA synthetase; class I tRNA | 94.89 | |
| 2dlc_X | 394 | Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas | 94.81 | |
| 2zp1_A | 314 | Tyrosyl-tRNA synthetase; tRNA synthetases class I, | 94.8 | |
| 1n3l_A | 372 | Tyrosyl-tRNA synthetase; rossmann fold AS catalyti | 94.78 | |
| 3jxe_A | 392 | Tryptophanyl-tRNA synthetase; adenosine triphospha | 94.65 | |
| 2cya_A | 364 | Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st | 94.65 | |
| 3hzr_A | 386 | Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str | 94.35 | |
| 3sz3_A | 341 | Tryptophanyl-tRNA synthetase; structural genomics, | 94.23 | |
| 3prh_A | 388 | Tryptophanyl-tRNA synthetase; TRPRS, protein biosy | 94.11 | |
| 2yy5_A | 348 | Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt | 93.75 | |
| 3foc_A | 451 | Tryptophanyl-tRNA synthetase; structural genomics, | 93.7 | |
| 3vgj_A | 373 | Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; | 93.49 | |
| 2cyc_A | 375 | Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy | 93.45 | |
| 3hv0_A | 393 | Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin | 93.34 | |
| 3i05_A | 395 | Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP | 93.3 | |
| 1yi8_B | 351 | Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. | 93.13 | |
| 3p0j_A | 690 | Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase | 92.98 | |
| 3n9i_A | 346 | Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga | 92.82 | |
| 2j5b_A | 348 | Tyrosyl-tRNA synthetase; ligase, protein biosynthe | 92.3 | |
| 1r6t_A | 477 | Tryptophanyl-tRNA synthetase; class IC tRNA synthe | 92.21 | |
| 2ip1_A | 432 | Tryptophanyl-tRNA synthetase; rossmann fold, struc | 92.11 | |
| 3p0j_A | 690 | Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase | 92.08 | |
| 1y42_X | 392 | Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR | 91.59 | |
| 1jil_A | 420 | Tyrrs, tyrosyl-tRNA synthetase; truncation, based | 91.42 | |
| 3tze_A | 406 | Tryptophanyl-tRNA synthetase; structural genomics, | 88.8 | |
| 2yxn_A | 322 | Tyrosyl-tRNA synthetase; tRNA synthetases class I, | 87.97 | |
| 1h3f_A | 432 | Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy | 86.9 | |
| 1r6u_A | 437 | Tryptophanyl-tRNA synthetase; class IC tRNA synthe | 86.69 | |
| 2ts1_A | 419 | Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 | 86.55 | |
| 2pid_A | 356 | Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase | 85.92 | |
| 2jan_A | 432 | Tyrosyl-tRNA synthetase; protein biosynthesis, ami | 85.28 | |
| 2k53_A | 76 | A3DK08 protein; NESG, CMR9, structural genomics, P | 83.46 |
| >1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-38 Score=272.95 Aligned_cols=123 Identities=20% Similarity=0.327 Sum_probs=119.6
Q ss_pred CCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCCh------------HHHHHH
Q psy6621 3 DCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDP------------REWTVG 70 (133)
Q Consensus 3 ~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~------------~~~~~~ 70 (133)
+|||||.|||||+++++++|+++||+||+| ++|.+++||||||+|||.+|++.|++| ++|+.+
T Consensus 56 pPY~nG~lHiGHa~n~~~~Dii~Ry~rm~G-----~~v~~~~GwD~hGlpiE~~a~k~G~~~~~~~~~~f~~~~~~~~~~ 130 (917)
T 1ffy_A 56 PPYANGNLHMGHALNKILKDFIVRYKTMQG-----FYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEFREKCKEFALE 130 (917)
T ss_dssp CCBSSSCCCHHHHHHHHHHHHHHHHHHTTT-----CBCCCCCEEBCCSHHHHHHHHHHTCCSTTTCHHHHHHHHHHHHHH
T ss_pred CCCCCCcchHHHHHHHHHHHHHHHHHHhCC-----CCCCCcccCchhhHHHHHHHHHcCCCchhCCHHHHHHHHHHHHHH
Confidence 689999999999999999999999999999 999999999999999999999999876 689999
Q ss_pred HHHHHHHHHHhcCcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621 71 NIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK 130 (133)
Q Consensus 71 ~~~~~~~~l~~lgi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~ 130 (133)
+++.|++++++||++.||++++.|++|.|.++++++|.+|+++|+||++.++|+|||.++
T Consensus 131 ~~~~~~~~~~rlG~~~Dwd~~~~T~d~~~~~~v~~~F~~l~~kGliYr~~~~v~wcp~~~ 190 (917)
T 1ffy_A 131 QIELQKKDFRRLGVRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSE 190 (917)
T ss_dssp HHHHHHHHHHTTTCCSCTTSCEETTSHHHHHHHHHHHHHHHHTTCEEEEEEEEEEETTTT
T ss_pred HHHHHHHHHHHhCeEEccCCCeEcCCHHHHHHHHHHHHHHHHcCCeEecccceeccCCCC
Confidence 999999999999999999999999999999999999999999999999999999999986
|
| >3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* | Back alignment and structure |
|---|
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* | Back alignment and structure |
|---|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* | Back alignment and structure |
|---|
| >1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* | Back alignment and structure |
|---|
| >1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* | Back alignment and structure |
|---|
| >2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* | Back alignment and structure |
|---|
| >2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A | Back alignment and structure |
|---|
| >3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A | Back alignment and structure |
|---|
| >3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B | Back alignment and structure |
|---|
| >2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A | Back alignment and structure |
|---|
| >1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 | Back alignment and structure |
|---|
| >1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 | Back alignment and structure |
|---|
| >1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* | Back alignment and structure |
|---|
| >3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* | Back alignment and structure |
|---|
| >3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A | Back alignment and structure |
|---|
| >3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} | Back alignment and structure |
|---|
| >4gri_A Glutamate--tRNA ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, aminoacyl-tRNA synthetase; HET: GLU; 2.60A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B* | Back alignment and structure |
|---|
| >1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A | Back alignment and structure |
|---|
| >2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} PDB: 3pny_A 3pnv_A | Back alignment and structure |
|---|
| >3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* | Back alignment and structure |
|---|
| >2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* | Back alignment and structure |
|---|
| >2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A | Back alignment and structure |
|---|
| >2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* | Back alignment and structure |
|---|
| >1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* | Back alignment and structure |
|---|
| >3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} | Back alignment and structure |
|---|
| >3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* | Back alignment and structure |
|---|
| >3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* | Back alignment and structure |
|---|
| >3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 | Back alignment and structure |
|---|
| >2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} | Back alignment and structure |
|---|
| >1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A | Back alignment and structure |
|---|
| >2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* | Back alignment and structure |
|---|
| >3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* | Back alignment and structure |
|---|
| >1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A | Back alignment and structure |
|---|
| >1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* | Back alignment and structure |
|---|
| >3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* | Back alignment and structure |
|---|
| >1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* | Back alignment and structure |
|---|
| >1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A | Back alignment and structure |
|---|
| >2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A | Back alignment and structure |
|---|
| >2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* | Back alignment and structure |
|---|
| >2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2k53_A A3DK08 protein; NESG, CMR9, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 133 | ||||
| d1h3na3 | 494 | c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas | 3e-18 | |
| d1pfva2 | 350 | c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe | 5e-15 | |
| d1rqga2 | 361 | c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe | 4e-11 | |
| d1ilea3 | 452 | c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe | 7e-10 | |
| d2d5ba2 | 348 | c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR | 2e-09 | |
| d1ivsa4 | 425 | c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase | 2e-09 | |
| d1ffya3 | 450 | c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe | 2e-06 |
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Leucyl-tRNA synthetase (LeuRS) species: Thermus thermophilus [TaxId: 274]
Score = 77.3 bits (189), Expect = 3e-18
Identities = 42/97 (43%), Positives = 60/97 (61%), Gaps = 2/97 (2%)
Query: 39 RVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPK 98
V PMGWDAFGLPAENAA + G+ P++WT NI K L+ G ++W+ E+ TC+P+
Sbjct: 72 EVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPE 131
Query: 99 YYKWTQALFLDLYHAGLVYR--KEVDYSQNLPTKFYH 133
YY+W Q +FL ++ GL YR V++ T +
Sbjct: 132 YYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLAN 168
|
| >d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 | Back information, alignment and structure |
|---|
| >d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 | Back information, alignment and structure |
|---|
| >d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 | Back information, alignment and structure |
|---|
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 | Back information, alignment and structure |
|---|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d1h3na3 | 494 | Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil | 100.0 | |
| d1ffya3 | 450 | Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus | 100.0 | |
| d1ivsa4 | 425 | Valyl-tRNA synthetase (ValRS) {Thermus thermophilu | 100.0 | |
| d1ilea3 | 452 | Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop | 99.98 | |
| d1pfva2 | 350 | Methionyl-tRNA synthetase (MetRS) {Escherichia col | 99.98 | |
| d1rqga2 | 361 | Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys | 99.96 | |
| d2d5ba2 | 348 | Methionyl-tRNA synthetase (MetRS) {Thermus thermop | 99.96 | |
| d1li5a2 | 315 | Cysteinyl-tRNA synthetase (CysRS) {Escherichia col | 99.9 | |
| d1f7ua2 | 348 | Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa | 99.64 | |
| d1irxa2 | 317 | Class I lysyl-tRNA synthetase {Archaeon Pyrococcus | 99.51 | |
| d1iq0a2 | 370 | Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi | 99.49 | |
| d1j09a2 | 305 | Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph | 99.41 | |
| d1gtra2 | 331 | Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co | 99.32 | |
| d1nzja_ | 286 | Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia c | 99.31 | |
| d1j1ua_ | 306 | Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc | 95.61 | |
| d2ts1a_ | 319 | Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearoth | 94.08 | |
| d1r6ta2 | 386 | Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo | 93.29 | |
| d1i6la_ | 326 | Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste | 93.18 | |
| d1h3fa1 | 343 | Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi | 93.06 | |
| d1jila_ | 323 | Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au | 93.01 | |
| d1n3la_ | 339 | Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie | 92.96 |
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Leucyl-tRNA synthetase (LeuRS) species: Thermus thermophilus [TaxId: 274]
Probab=100.00 E-value=6.9e-39 Score=256.94 Aligned_cols=123 Identities=35% Similarity=0.689 Sum_probs=121.2
Q ss_pred CCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCChHHHHHHHHHHHHHHHHhc
Q psy6621 3 DCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGF 82 (133)
Q Consensus 3 ~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~~~~~~~~~~~~~~~l~~l 82 (133)
||||||.||||||++++++|+++||+||+| ++|.+++||||||+|||.+|++.+..|+++++++.+.+++++++|
T Consensus 41 pP~~nG~lHiGH~~~~~~~D~~~R~~rm~G-----~~v~~~~G~D~~G~~~e~~~~k~~~~~~~~~~~~~~~~~~~~~~~ 115 (494)
T d1h3na3 41 FPYPSGDLHMGHLKNYTMGDVLARFRRMQG-----YEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLM 115 (494)
T ss_dssp CCCSSSCCBHHHHHHHHHHHHHHHHHHHTT-----CEEECCCCBCCSSHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred CCCCCCchhhhHHHHHHHHHHHHHHHHccC-----CcccCcCCcCcchHHHHHHHHHhCCChHHHHHHHHHHhHHHHHhc
Confidence 789999999999999999999999999999 999999999999999999999999999999999999999999999
Q ss_pred CcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621 83 GCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK 130 (133)
Q Consensus 83 gi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~ 130 (133)
|++.||++++.|++++|.+.++++|.+|+++|+||++.++|+|||.++
T Consensus 116 g~~~d~~~~~~T~d~~~~~~~~~~f~~l~~~g~iy~~~~~~~~~~~~~ 163 (494)
T d1h3na3 116 GILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQ 163 (494)
T ss_dssp TCCCCGGGCCBTTSHHHHHHHHHHHHHHHHTTCEEEEEEEEEEETTTT
T ss_pred CcccCCCCceecCCccccchHHHHHHHhhhCCcEEeeeEEEEeecCcc
Confidence 999999999999999999999999999999999999999999999886
|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|