Psyllid ID: psy6621


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFYH
ccccccccEEEccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccc
cccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEc
MYDCTEEELTCLGgvvvkthsgaecrlaginsiikgpvrvfqpmgwdafglpaenaahqhgidprewtvgnIATMKSQLqgfgckfnweselatcdpkyyKWTQALFLDLYHAGlvyrkevdysqnlptkfyh
MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKevdysqnlptkfyh
MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFYH
******EELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYS*********
***CTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFY*
********LTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFYH
*YDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFYH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTKFYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
B7JYA9 856 Leucine--tRNA ligase OS=C yes N/A 0.616 0.095 0.658 3e-27
Q5NMK1 846 Leucine--tRNA ligase OS=Z yes N/A 0.609 0.095 0.666 4e-27
Q7V1I2 858 Leucine--tRNA ligase OS=P yes N/A 0.609 0.094 0.641 5e-27
A3PCW8 856 Leucine--tRNA ligase OS=P yes N/A 0.609 0.094 0.641 1e-26
Q31AX4 856 Leucine--tRNA ligase OS=P yes N/A 0.609 0.094 0.641 1e-26
P73274 869 Leucine--tRNA ligase OS=S N/A N/A 0.616 0.094 0.609 2e-26
B0TBJ3 846 Leucine--tRNA ligase OS=H yes N/A 0.624 0.098 0.614 2e-26
A2BWL7 864 Leucine--tRNA ligase OS=P yes N/A 0.609 0.093 0.617 3e-26
A2BR45 856 Leucine--tRNA ligase OS=P yes N/A 0.609 0.094 0.629 3e-26
B1WSK6 853 Leucine--tRNA ligase OS=C yes N/A 0.616 0.096 0.634 4e-26
>sp|B7JYA9|SYL_CYAP8 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=leuS PE=3 SV=1 Back     alignment and function desciption
 Score =  120 bits (300), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 60/82 (73%)

Query: 39  RVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPK 98
           RV  PMGWDAFGLPAENAA   GI P EWT  N++ MK QLQ  G   +WE E+ATC P+
Sbjct: 72  RVLHPMGWDAFGLPAENAAIDRGIPPAEWTYKNMSQMKQQLQTLGLSIDWEREVATCAPE 131

Query: 99  YYKWTQALFLDLYHAGLVYRKE 120
           YYKWTQ LFL LY AGL Y+KE
Sbjct: 132 YYKWTQWLFLQLYQAGLAYQKE 153





Cyanothece sp. (strain PCC 8801) (taxid: 41431)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 4
>sp|Q5NMK1|SYL_ZYMMO Leucine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q7V1I2|SYL_PROMP Leucine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|A3PCW8|SYL_PROM0 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q31AX4|SYL_PROM9 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|B0TBJ3|SYL_HELMI Leucine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|A2BWL7|SYL_PROM5 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|A2BR45|SYL_PROMS Leucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|B1WSK6|SYL_CYAA5 Leucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=leuS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
195491875 869 GE21469 [Drosophila yakuba] gi|194179852 0.616 0.094 0.646 4e-26
91078378 866 PREDICTED: similar to Leucyl-tRNA synthe 0.781 0.120 0.559 4e-26
195428976 877 GK16600 [Drosophila willistoni] gi|19415 0.759 0.115 0.535 6e-26
195587864 869 GD13863 [Drosophila simulans] gi|1941956 0.616 0.094 0.646 6e-26
194866776 870 GG15248 [Drosophila erecta] gi|190653726 0.616 0.094 0.646 6e-26
21355409 869 Leucyl-tRNA synthetase [Drosophila melan 0.616 0.094 0.646 6e-26
328702417 872 PREDICTED: probable leucyl-tRNA syntheta 0.624 0.095 0.638 9e-26
195337561 869 GM14681 [Drosophila sechellia] gi|194128 0.616 0.094 0.646 9e-26
427712401 856 leucyl-tRNA synthetase [Synechococcus sp 0.616 0.095 0.646 2e-25
257060679 856 leucyl-tRNA synthetase [Cyanothece sp. P 0.616 0.095 0.658 2e-25
>gi|195491875|ref|XP_002093751.1| GE21469 [Drosophila yakuba] gi|194179852|gb|EDW93463.1| GE21469 [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/82 (64%), Positives = 62/82 (75%)

Query: 40  VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
           VFQPMGWD+FGLPAENAA+Q G++P  WT  NI+ MK QLQ  GC F+W  EL+TC PKY
Sbjct: 102 VFQPMGWDSFGLPAENAANQRGVEPASWTKQNISQMKEQLQRLGCSFDWNHELSTCSPKY 161

Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
           YKWTQ LFL L+  GL Y+ E 
Sbjct: 162 YKWTQHLFLMLHRHGLAYQNEA 183




Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91078378|ref|XP_974191.1| PREDICTED: similar to Leucyl-tRNA synthetase CG7479-PA [Tribolium castaneum] gi|270003885|gb|EFA00333.1| hypothetical protein TcasGA2_TC003172 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195428976|ref|XP_002062540.1| GK16600 [Drosophila willistoni] gi|194158625|gb|EDW73526.1| GK16600 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195587864|ref|XP_002083681.1| GD13863 [Drosophila simulans] gi|194195690|gb|EDX09266.1| GD13863 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194866776|ref|XP_001971943.1| GG15248 [Drosophila erecta] gi|190653726|gb|EDV50969.1| GG15248 [Drosophila erecta] Back     alignment and taxonomy information
>gi|21355409|ref|NP_647932.1| Leucyl-tRNA synthetase [Drosophila melanogaster] gi|7292541|gb|AAF47943.1| Leucyl-tRNA synthetase [Drosophila melanogaster] gi|19528361|gb|AAL90295.1| LD44376p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|328702417|ref|XP_003241894.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195337561|ref|XP_002035397.1| GM14681 [Drosophila sechellia] gi|194128490|gb|EDW50533.1| GM14681 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|427712401|ref|YP_007061025.1| leucyl-tRNA synthetase [Synechococcus sp. PCC 6312] gi|427376530|gb|AFY60482.1| leucyl-tRNA synthetase [Synechococcus sp. PCC 6312] Back     alignment and taxonomy information
>gi|257060679|ref|YP_003138567.1| leucyl-tRNA synthetase [Cyanothece sp. PCC 8802] gi|256590845|gb|ACV01732.1| leucyl-tRNA synthetase [Cyanothece sp. PCC 8802] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
FB|FBgn0027085 869 Aats-leu "Leucyl-tRNA syntheta 0.609 0.093 0.654 2.9e-26
UNIPROTKB|E1BXI7 906 LARS2 "Uncharacterized protein 0.624 0.091 0.578 9.3e-24
UNIPROTKB|I3LLA2203 LOC100738466 "Uncharacterized 0.631 0.413 0.559 1.8e-23
ZFIN|ZDB-GENE-070928-3 891 lars2 "leucyl-tRNA synthetase 0.616 0.092 0.573 1.9e-23
TIGR_CMR|ECH_0794 829 ECH_0794 "leucyl-tRNA syntheta 0.624 0.100 0.578 7.3e-23
ASPGD|ASPL0000008770 990 AN6526 [Emericella nidulans (t 0.631 0.084 0.581 1.6e-22
TIGR_CMR|CHY_0393 821 CHY_0393 "leucyl-tRNA syntheta 0.609 0.098 0.573 1.9e-22
TIGR_CMR|GSU_2209 824 GSU_2209 "leucyl-tRNA syntheta 0.601 0.097 0.587 1.9e-22
UNIPROTKB|F1MGP9 616 LARS2 "Uncharacterized protein 0.624 0.134 0.566 2.2e-22
SGD|S000004374 894 NAM2 "Mitochondrial leucyl-tRN 0.654 0.097 0.568 2.2e-22
FB|FBgn0027085 Aats-leu "Leucyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 2.9e-26, P = 2.9e-26
 Identities = 53/81 (65%), Positives = 62/81 (76%)

Query:    40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
             VFQPMGWD+FGLPAENAA+Q G++P  WT  NIA MK QL+  GC F+W  EL+TC PKY
Sbjct:   102 VFQPMGWDSFGLPAENAANQRGVEPASWTEQNIAQMKEQLKRLGCSFDWNHELSTCSPKY 161

Query:   100 YKWTQALFLDLYHAGLVYRKE 120
             YKWTQ LFL L+  GL Y+ E
Sbjct:   162 YKWTQHLFLMLHRHGLAYQNE 182




GO:0006429 "leucyl-tRNA aminoacylation" evidence=ISS;NAS
GO:0004823 "leucine-tRNA ligase activity" evidence=ISS;NAS
GO:0005739 "mitochondrion" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0002161 "aminoacyl-tRNA editing activity" evidence=IEA
UNIPROTKB|E1BXI7 LARS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLA2 LOC100738466 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070928-3 lars2 "leucyl-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0794 ECH_0794 "leucyl-tRNA synthetase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008770 AN6526 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0393 CHY_0393 "leucyl-tRNA synthetase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2209 GSU_2209 "leucyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGP9 LARS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
SGD|S000004374 NAM2 "Mitochondrial leucyl-tRNA synthetase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3M3A3SYL_ANAVT6, ., 1, ., 1, ., 40.59750.61650.0940yesN/A
Q0SV78SYL_CLOPS6, ., 1, ., 1, ., 40.62960.60900.0992yesN/A
Q8XML8SYL_CLOPE6, ., 1, ., 1, ., 40.62960.60900.0992yesN/A
Q0AG57SYL_NITEC6, ., 1, ., 1, ., 40.61250.60150.0921yesN/A
B0TBJ3SYL_HELMI6, ., 1, ., 1, ., 40.61440.62400.0981yesN/A
A1WCP8SYL_ACISJ6, ., 1, ., 1, ., 40.50460.75930.1109yesN/A
Q2G3C3SYL_NOVAD6, ., 1, ., 1, ., 40.62960.60900.0955yesN/A
A6M268SYL_CLOB86, ., 1, ., 1, ., 40.62960.60900.0992yesN/A
Q0TTD0SYL_CLOP16, ., 1, ., 1, ., 40.62960.60900.0992yesN/A
Q2JHX0SYL_SYNJB6, ., 1, ., 1, ., 40.61720.60900.0918yesN/A
A5D416SYL_PELTS6, ., 1, ., 1, ., 40.58530.60900.0979yesN/A
B7JYA9SYL_CYAP86, ., 1, ., 1, ., 40.65850.61650.0957yesN/A
B0C1R1SYL_ACAM16, ., 1, ., 1, ., 40.59750.61650.0959yesN/A
B2J7T9SYL_NOSP76, ., 1, ., 1, ., 40.60970.61650.0941yesN/A
Q31LW9SYL_SYNE76, ., 1, ., 1, ., 40.56090.61650.0947yesN/A
A4XKG9SYL_CALS86, ., 1, ., 1, ., 40.57440.64660.1052yesN/A
Q7V1I2SYL_PROMP6, ., 1, ., 1, ., 40.64190.60900.0944yesN/A
A5GT82SYL_SYNR36, ., 1, ., 1, ., 40.59750.61650.0949yesN/A
B1I5R7SYL_DESAP6, ., 1, ., 1, ., 40.60750.59390.0956yesN/A
Q820M7SYL_NITEU6, ., 1, ., 1, ., 40.61250.60150.0920yesN/A
A2BR45SYL_PROMS6, ., 1, ., 1, ., 40.62960.60900.0946yesN/A
Q5NMK1SYL_ZYMMO6, ., 1, ., 1, ., 40.66660.60900.0957yesN/A
A6WDL7SYL_KINRD6, ., 1, ., 1, ., 40.55550.60900.0947yesN/A
A5CR89SYL_CLAM36, ., 1, ., 1, ., 40.56790.60900.0951yesN/A
B1WSK6SYL_CYAA56, ., 1, ., 1, ., 40.63410.61650.0961yesN/A
Q8DH61SYL_THEEB6, ., 1, ., 1, ., 40.59750.61650.0956yesN/A
A5G068SYL_ACICJ6, ., 1, ., 1, ., 40.59250.60900.0937yesN/A
Q97LB6SYL_CLOAB6, ., 1, ., 1, ., 40.61720.60900.0997yesN/A
B0RDA6SYL_CLAMS6, ., 1, ., 1, ., 40.56790.60900.0950yesN/A
Q2GG41SYL_EHRCR6, ., 1, ., 1, ., 40.57830.62400.1001yesN/A
Q2JV13SYL_SYNJA6, ., 1, ., 1, ., 40.61720.60900.0927yesN/A
B7KCI7SYL_CYAP76, ., 1, ., 1, ., 40.59750.61650.0960yesN/A
A1WYZ7SYL_HALHL6, ., 1, ., 1, ., 40.62020.59390.0966yesN/A
B8HM05SYL_CYAP46, ., 1, ., 1, ., 40.59750.61650.0955yesN/A
A2BWL7SYL_PROM56, ., 1, ., 1, ., 40.61720.60900.0937yesN/A
B1XP90SYL_SYNP26, ., 1, ., 1, ., 40.62190.61650.0962yesN/A
A6TQK3SYL_ALKMQ6, ., 1, ., 1, ., 40.59250.60900.0983yesN/A
Q114V5SYL_TRIEI6, ., 1, ., 1, ., 40.59750.61650.0882yesN/A
Q2RKZ1SYL_MOOTA6, ., 1, ., 1, ., 40.60490.60900.0977yesN/A
A3PCW8SYL_PROM06, ., 1, ., 1, ., 40.64190.60900.0946yesN/A
A7FPP5SYL_CLOB16, ., 1, ., 1, ., 40.61720.60900.0996yesN/A
A5VA89SYL_SPHWW6, ., 1, ., 1, ., 40.61720.60900.0970yesN/A
A8G4T7SYL_PROM26, ., 1, ., 1, ., 40.62960.60900.0946yesN/A
Q0ABN3SYL_ALHEH6, ., 1, ., 1, ., 40.6250.60150.0925yesN/A
Q31AX4SYL_PROM96, ., 1, ., 1, ., 40.64190.60900.0946yesN/A
A5HY79SYL_CLOBH6, ., 1, ., 1, ., 40.61720.60900.0996yesN/A
A7G9T9SYL_CLOBL6, ., 1, ., 1, ., 40.61720.60900.0996yesN/A
Q8YS09SYL_NOSS16, ., 1, ., 1, ., 40.59750.61650.0940yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 4e-48
TIGR00396 842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba 4e-40
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 2e-38
cd00812 314 cd00812, LeuRS_core, catalytic core domain of leuc 3e-38
PLN02563 963 PLN02563, PLN02563, aminoacyl-tRNA ligase 3e-30
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 1e-17
cd00817 382 cd00817, ValRS_core, catalytic core domain of valy 7e-14
cd00668 312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core do 2e-13
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 2e-13
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 6e-11
COG0143 558 COG0143, MetG, Methionyl-tRNA synthetase [Translat 4e-06
cd00814 319 cd00814, MetRS_core, catalytic core domain of meth 7e-06
pfam09334 388 pfam09334, tRNA-synt_1g, tRNA synthetases class I 1e-04
TIGR00398 530 TIGR00398, metG, methionyl-tRNA synthetase 1e-04
pfam00133 606 pfam00133, tRNA-synt_1, tRNA synthetases class I ( 3e-04
PRK00133 673 PRK00133, metG, methionyl-tRNA synthetase; Reviewe 8e-04
PRK12268 556 PRK12268, PRK12268, methionyl-tRNA synthetase; Rev 0.001
PRK11893 511 PRK11893, PRK11893, methionyl-tRNA synthetase; Rev 0.001
TIGR00392 861 TIGR00392, ileS, isoleucyl-tRNA synthetase 0.001
>gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
 Score =  164 bits (417), Expect = 4e-48
 Identities = 52/82 (63%), Positives = 59/82 (71%)

Query: 40  VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
           V  PMGWDAFGLPAENAA + G  P EWT  NIA MK QL+  G  ++W  E+ATCDP+Y
Sbjct: 72  VLHPMGWDAFGLPAENAAIKTGTHPAEWTYENIANMKKQLKSLGFSYDWSREIATCDPEY 131

Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
           YKWTQ +FL LY  GL YRKE 
Sbjct: 132 YKWTQWIFLKLYEKGLAYRKES 153


Length = 805

>gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|234655 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237029 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 100.0
TIGR00396 842 leuS_bact leucyl-tRNA synthetase, eubacterial and 100.0
KOG0435|consensus 876 100.0
PLN02563 963 aminoacyl-tRNA ligase 100.0
PRK00390 805 leuS leucyl-tRNA synthetase; Validated 100.0
cd00817 382 ValRS_core catalytic core domain of valyl-tRNA syn 100.0
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 100.0
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 100.0
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 100.0
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PF00133 601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 100.0
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal 100.0
PLN02943 958 aminoacyl-tRNA ligase 100.0
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribos 100.0
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 100.0
PLN02381 1066 valyl-tRNA synthetase 100.0
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 100.0
cd00812 314 LeuRS_core catalytic core domain of leucyl-tRNA sy 100.0
PLN02843 974 isoleucyl-tRNA synthetase 100.0
TIGR00395 938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 100.0
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 100.0
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 100.0
PF09334 391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 100.0
PLN02224 616 methionine-tRNA ligase 100.0
PLN02882 1159 aminoacyl-tRNA ligase 100.0
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribos 100.0
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 100.0
cd00818 338 IleRS_core catalytic core domain of isoleucyl-tRNA 100.0
cd00814 319 MetRS_core catalytic core domain of methioninyl-tR 100.0
cd00668 312 Ile_Leu_Val_MetRS_core catalytic core domain of is 100.0
PLN02610 801 probable methionyl-tRNA synthetase 100.0
PRK12268 556 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133 673 metG methionyl-tRNA synthetase; Reviewed 100.0
TIGR00398 530 metG methionyl-tRNA synthetase. The methionyl-tRNA 99.98
PLN02959 1084 aminoacyl-tRNA ligase 99.98
PRK12267 648 methionyl-tRNA synthetase; Reviewed 99.98
PRK11893 511 methionyl-tRNA synthetase; Reviewed 99.97
PRK12300 897 leuS leucyl-tRNA synthetase; Reviewed 99.97
PRK12418 384 cysteinyl-tRNA synthetase; Provisional 99.96
PLN02946 557 cysteine-tRNA ligase 99.96
PRK00260 463 cysS cysteinyl-tRNA synthetase; Validated 99.96
TIGR00435 465 cysS cysteinyl-tRNA synthetase. This model finds t 99.96
TIGR03447 411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 99.96
PRK14535 699 cysS cysteinyl-tRNA synthetase; Provisional 99.95
PRK14536 490 cysS cysteinyl-tRNA synthetase; Provisional 99.95
KOG0433|consensus 937 99.95
PRK14534 481 cysS cysteinyl-tRNA synthetase; Provisional 99.95
PTZ00399 651 cysteinyl-tRNA-synthetase; Provisional 99.95
KOG0436|consensus 578 99.95
KOG0432|consensus 995 99.94
PF01406 300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 99.94
cd00671212 ArgRS_core catalytic core domain of arginyl-tRNA s 99.94
COG0215 464 CysS Cysteinyl-tRNA synthetase [Translation, ribos 99.92
cd00672213 CysRS_core catalytic core domain of cysteinyl tRNA 99.91
KOG0434|consensus 1070 99.9
PRK01611 507 argS arginyl-tRNA synthetase; Reviewed 99.89
KOG2007|consensus 586 99.83
cd00674 353 LysRS_core_class_I catalytic core domain of class 99.76
cd00802143 class_I_aaRS_core catalytic core domain of class I 99.75
KOG1247|consensus 567 99.73
KOG0437|consensus 1080 99.66
PRK12451 562 arginyl-tRNA synthetase; Reviewed 99.61
PF00750 354 tRNA-synt_1d: tRNA synthetases class I (R); InterP 99.58
TIGR00456 566 argS arginyl-tRNA synthetase. This model recognize 99.55
COG0018 577 ArgS Arginyl-tRNA synthetase [Translation, ribosom 99.54
PRK00750 510 lysK lysyl-tRNA synthetase; Reviewed 99.53
PLN02286 576 arginine-tRNA ligase 99.49
cd09287 240 GluRS_non_core catalytic core domain of non-discri 99.49
PRK04156 567 gltX glutamyl-tRNA synthetase; Provisional 99.37
cd00807 238 GlnRS_core catalytic core domain of glutaminyl-tRN 99.33
TIGR00463 560 gltX_arch glutamyl-tRNA synthetase, archaeal and e 99.33
PLN03233 523 putative glutamate-tRNA ligase; Provisional 99.31
COG0008 472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr 99.31
TIGR03838 272 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe 99.31
TIGR00467 515 lysS_arch lysyl-tRNA synthetase, archaeal and spir 99.3
PTZ00402 601 glutamyl-tRNA synthetase; Provisional 99.29
PF00749 314 tRNA-synt_1c: tRNA synthetases class I (E and Q), 99.27
PLN02907 722 glutamate-tRNA ligase 99.26
TIGR00440 522 glnS glutaminyl-tRNA synthetase. This protein is a 99.24
PRK05710 299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 99.24
PRK12410 433 glutamylglutaminyl-tRNA synthetase; Provisional 99.23
PRK05347 554 glutaminyl-tRNA synthetase; Provisional 99.22
PTZ00437 574 glutaminyl-tRNA synthetase; Provisional 99.22
PRK12558 445 glutamyl-tRNA synthetase; Provisional 99.21
TIGR00464 470 gltX_bact glutamyl-tRNA synthetase, bacterial fami 99.19
cd00418 230 GlxRS_core catalytic core domain of glutamyl-tRNA 99.17
PRK14703 771 glutaminyl-tRNA synthetase/YqeY domain fusion prot 99.14
PRK14895 513 gltX glutamyl-tRNA synthetase; Provisional 99.12
PLN02859 788 glutamine-tRNA ligase 99.12
PRK01406 476 gltX glutamyl-tRNA synthetase; Reviewed 99.09
PLN02627 535 glutamyl-tRNA synthetase 99.06
cd00808 239 GluRS_core catalytic core domain of discriminating 99.04
KOG1147|consensus 712 98.99
KOG1148|consensus 764 98.34
KOG1149|consensus 524 98.2
KOG4426|consensus 656 98.17
PF01921 360 tRNA-synt_1f: tRNA synthetases class I (K); InterP 98.12
COG1384 521 LysS Lysyl-tRNA synthetase (class I) [Translation, 97.93
KOG1195|consensus 567 97.57
cd00806 280 TrpRS_core catalytic core domain of tryptophanyl-t 95.99
cd00805 269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 95.15
PRK12285 368 tryptophanyl-tRNA synthetase; Reviewed 95.15
cd00395 273 Tyr_Trp_RS_core catalytic core domain of tyrosinyl 94.94
PRK12284 431 tryptophanyl-tRNA synthetase; Reviewed 94.37
PLN02486 383 aminoacyl-tRNA ligase 94.16
COG0180 314 TrpS Tryptophanyl-tRNA synthetase [Translation, ri 93.88
PRK13354 410 tyrosyl-tRNA synthetase; Provisional 93.78
TIGR00233 328 trpS tryptophanyl-tRNA synthetase. This model repr 93.77
PLN02886 389 aminoacyl-tRNA ligase 93.05
PRK00927 333 tryptophanyl-tRNA synthetase; Reviewed 92.99
PRK12556 332 tryptophanyl-tRNA synthetase; Provisional 92.66
PRK05912 408 tyrosyl-tRNA synthetase; Validated 92.29
PRK08560 329 tyrosyl-tRNA synthetase; Validated 92.27
COG0162 401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosom 91.16
PTZ00126 383 tyrosyl-tRNA synthetase; Provisional 91.15
PRK12282 333 tryptophanyl-tRNA synthetase II; Reviewed 90.79
PRK12283 398 tryptophanyl-tRNA synthetase; Reviewed 90.04
TIGR00234 377 tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy 89.54
PF00579 292 tRNA-synt_1b: tRNA synthetases class I (W and Y); 86.84
PTZ00348 682 tyrosyl-tRNA synthetase; Provisional 82.12
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=3.4e-39  Score=274.58  Aligned_cols=124  Identities=45%  Similarity=0.754  Sum_probs=121.4

Q ss_pred             CCCCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCChHHHHHHHHHHHHHHHH
Q psy6621           1 MYDCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQ   80 (133)
Q Consensus         1 ~y~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~~~~~~~~~~~~~~~l~   80 (133)
                      || |||||.||+||+|++++.|+++||+||+|     |+|++++|||.+|+|+|.+|.+.|.+|..|+..+++.|+++|+
T Consensus        41 mf-PYpSG~LHvGH~r~Yti~Dv~aRykRm~G-----yNVL~PMGwdafGlPae~~A~~~~~~P~~wt~~ni~~~k~qlk  114 (814)
T COG0495          41 MF-PYPSGALHVGHVRNYTIGDVIARYKRMQG-----YNVLHPMGWDAFGLPAENAAIKIGTDPAKWTYYNIAYMKKQLK  114 (814)
T ss_pred             CC-CCCCCCcccCccccccHHHHHHHHHHhcC-----CeecccCcccccCchHHHHHHHhCCChHHHHHHHHHHHHHHHH
Confidence            45 48999999999999999999999999999     9999999999999999999999999999999999999999999


Q ss_pred             hcCcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621          81 GFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK  130 (133)
Q Consensus        81 ~lgi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~  130 (133)
                      +||.++||++++.|++|+|.+++||+|.+|+++|+||+++.+|+|||.++
T Consensus       115 ~lG~siDW~Ref~T~Dp~Yyk~~QW~F~kL~ekGL~y~~~~~VnwcP~d~  164 (814)
T COG0495         115 SLGFSIDWRREFATCDPEYYKWIQWQFLKLYEKGLAYRKEAPVNWCPVDG  164 (814)
T ss_pred             HhCCccccccceecCCccHHHHHHHHHHHHHHCCCEEeccccceeCCCcC
Confidence            99999999999999999999999999999999999999999999999986



>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>KOG0435|consensus Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0433|consensus Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>KOG0436|consensus Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>KOG0434|consensus Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2007|consensus Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>KOG1247|consensus Back     alignment and domain information
>KOG0437|consensus Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02286 arginine-tRNA ligase Back     alignment and domain information
>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family Back     alignment and domain information
>PLN03233 putative glutamate-tRNA ligase; Provisional Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete Back     alignment and domain information
>PTZ00402 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>TIGR00440 glnS glutaminyl-tRNA synthetase Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00437 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family Back     alignment and domain information
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information
>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional Back     alignment and domain information
>PRK14895 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02859 glutamine-tRNA ligase Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02627 glutamyl-tRNA synthetase Back     alignment and domain information
>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>KOG1148|consensus Back     alignment and domain information
>KOG1149|consensus Back     alignment and domain information
>KOG4426|consensus Back     alignment and domain information
>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1195|consensus Back     alignment and domain information
>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02486 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase Back     alignment and domain information
>PLN02886 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase Back     alignment and domain information
>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
4aq7_A 880 Ternary Complex Of E. Coli Leucyl-Trna Synthetase, 5e-23
2v0c_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 5e-22
1obh_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 5e-22
3ziu_A 637 Crystal Structure Of Mycoplasma Mobile Leucyl-trna 5e-19
1qu2_A 917 Insights Into Editing From An Ile-Trna Synthetase S 6e-04
>pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 Back     alignment and structure

Iteration: 1

Score = 102 bits (254), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 45/80 (56%), Positives = 56/80 (70%) Query: 40 VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99 V QP+GWDAFGLPAE AA ++ P WT NIA MK+QL+ G ++W ELATC P+Y Sbjct: 93 VLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEY 152 Query: 100 YKWTQALFLDLYHAGLVYRK 119 Y+W Q F +LY GLVY+K Sbjct: 153 YRWEQKFFTELYKKGLVYKK 172
>pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 Back     alignment and structure
>pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 Back     alignment and structure
>pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 Back     alignment and structure
>pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin Length = 917 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 2e-49
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 9e-49
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 3e-26
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 1e-24
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 3e-06
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 8e-06
3tun_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 5e-04
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 Back     alignment and structure
 Score =  167 bits (426), Expect = 2e-49
 Identities = 45/82 (54%), Positives = 56/82 (68%)

Query: 40  VFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPKY 99
           V QP+GWDAFGLPAE AA ++   P  WT  NIA MK+QL+  G  ++W  ELATC P+Y
Sbjct: 93  VLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEY 152

Query: 100 YKWTQALFLDLYHAGLVYRKEV 121
           Y+W Q  F +LY  GLVY+K  
Sbjct: 153 YRWEQKFFTELYKKGLVYKKTS 174


>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722 Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560 Back     alignment and structure
>3tun_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, translation, nucleotide binding; HET: C13; 2.55A {Trypanosoma brucei} Length = 542 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 100.0
3u1f_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 100.0
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 100.0
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 100.0
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 100.0
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 100.0
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 100.0
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 100.0
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 100.0
2x1l_A 524 Methionyl-tRNA synthetase; nucleotide-binding, pro 100.0
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structura 100.0
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A 100.0
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 100.0
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 99.97
4dlp_A 536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 99.97
3tqo_A 462 Cysteinyl-tRNA synthetase; protein synthesis, liga 99.97
3sp1_A 501 Cysteinyl-tRNA synthetase; structural genomics, se 99.97
3c8z_A 414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 99.96
1li5_A 461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 99.95
2zue_A 629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.82
1iq0_A 592 Arginyl-tRNA synthetase; riken structural genomics 99.81
1irx_A 523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 99.77
1f7u_A 607 Arginyl-tRNA synthetase; RNA-protein complex, amin 99.77
3fnr_A 464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 99.65
1nzj_A 298 Hypothetical protein YADB; Zn cluster, glutamyl T- 99.37
3aii_A 553 Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta 99.36
1qtq_A 553 GLNRS, protein (glutaminyl-tRNA synthetase); gluta 99.34
3al0_C 592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL 99.31
2o5r_A 481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g 99.28
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 99.27
4g6z_A 490 Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, 99.25
2cfo_A 492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s 99.25
4gri_A 512 Glutamate--tRNA ligase; structural genomics, seatt 99.21
3afh_A 488 Glutamyl-tRNA synthetase 2; protein-substrate comp 99.18
1j09_A 468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r 99.15
2ja2_A 498 Glutamyl-tRNA synthetase; non-discriminating gluta 99.11
3tzl_A 322 Tryptophanyl-tRNA synthetase; structural genomics, 95.6
2g36_A 340 Tryptophanyl-tRNA synthetase; TM0492, structural g 95.51
2cyb_A 323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 95.46
3a04_A 372 Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR 95.12
2el7_A 337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 95.03
1i6k_A 328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 94.89
2dlc_X 394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 94.81
2zp1_A 314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 94.8
1n3l_A 372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 94.78
3jxe_A 392 Tryptophanyl-tRNA synthetase; adenosine triphospha 94.65
2cya_A 364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 94.65
3hzr_A 386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 94.35
3sz3_A 341 Tryptophanyl-tRNA synthetase; structural genomics, 94.23
3prh_A 388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 94.11
2yy5_A 348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 93.75
3foc_A 451 Tryptophanyl-tRNA synthetase; structural genomics, 93.7
3vgj_A 373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 93.49
2cyc_A 375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 93.45
3hv0_A 393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 93.34
3i05_A 395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 93.3
1yi8_B 351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 93.13
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 92.98
3n9i_A 346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 92.82
2j5b_A 348 Tyrosyl-tRNA synthetase; ligase, protein biosynthe 92.3
1r6t_A 477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 92.21
2ip1_A 432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 92.11
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 92.08
1y42_X 392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 91.59
1jil_A 420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 91.42
3tze_A 406 Tryptophanyl-tRNA synthetase; structural genomics, 88.8
2yxn_A 322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 87.97
1h3f_A 432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 86.9
1r6u_A 437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 86.69
2ts1_A 419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 86.55
2pid_A 356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 85.92
2jan_A 432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 85.28
2k53_A76 A3DK08 protein; NESG, CMR9, structural genomics, P 83.46
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-38  Score=272.95  Aligned_cols=123  Identities=20%  Similarity=0.327  Sum_probs=119.6

Q ss_pred             CCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCCh------------HHHHHH
Q psy6621           3 DCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDP------------REWTVG   70 (133)
Q Consensus         3 ~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~------------~~~~~~   70 (133)
                      +|||||.|||||+++++++|+++||+||+|     ++|.+++||||||+|||.+|++.|++|            ++|+.+
T Consensus        56 pPY~nG~lHiGHa~n~~~~Dii~Ry~rm~G-----~~v~~~~GwD~hGlpiE~~a~k~G~~~~~~~~~~f~~~~~~~~~~  130 (917)
T 1ffy_A           56 PPYANGNLHMGHALNKILKDFIVRYKTMQG-----FYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEFREKCKEFALE  130 (917)
T ss_dssp             CCBSSSCCCHHHHHHHHHHHHHHHHHHTTT-----CBCCCCCEEBCCSHHHHHHHHHHTCCSTTTCHHHHHHHHHHHHHH
T ss_pred             CCCCCCcchHHHHHHHHHHHHHHHHHHhCC-----CCCCCcccCchhhHHHHHHHHHcCCCchhCCHHHHHHHHHHHHHH
Confidence            689999999999999999999999999999     999999999999999999999999876            689999


Q ss_pred             HHHHHHHHHHhcCcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621          71 NIATMKSQLQGFGCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK  130 (133)
Q Consensus        71 ~~~~~~~~l~~lgi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~  130 (133)
                      +++.|++++++||++.||++++.|++|.|.++++++|.+|+++|+||++.++|+|||.++
T Consensus       131 ~~~~~~~~~~rlG~~~Dwd~~~~T~d~~~~~~v~~~F~~l~~kGliYr~~~~v~wcp~~~  190 (917)
T 1ffy_A          131 QIELQKKDFRRLGVRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSE  190 (917)
T ss_dssp             HHHHHHHHHHTTTCCSCTTSCEETTSHHHHHHHHHHHHHHHHTTCEEEEEEEEEEETTTT
T ss_pred             HHHHHHHHHHHhCeEEccCCCeEcCCHHHHHHHHHHHHHHHHcCCeEecccceeccCCCC
Confidence            999999999999999999999999999999999999999999999999999999999986



>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Back     alignment and structure
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} Back     alignment and structure
>4gri_A Glutamate--tRNA ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, aminoacyl-tRNA synthetase; HET: GLU; 2.60A {Borrelia burgdorferi} Back     alignment and structure
>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B* Back     alignment and structure
>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A Back     alignment and structure
>2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} PDB: 3pny_A 3pnv_A Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Back     alignment and structure
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure
>2k53_A A3DK08 protein; NESG, CMR9, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium thermocellum atcc 27405} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 133
d1h3na3 494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 3e-18
d1pfva2 350 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe 5e-15
d1rqga2 361 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe 4e-11
d1ilea3 452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 7e-10
d2d5ba2 348 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR 2e-09
d1ivsa4 425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 2e-09
d1ffya3 450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 2e-06
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Leucyl-tRNA synthetase (LeuRS)
species: Thermus thermophilus [TaxId: 274]
 Score = 77.3 bits (189), Expect = 3e-18
 Identities = 42/97 (43%), Positives = 60/97 (61%), Gaps = 2/97 (2%)

Query: 39  RVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGFGCKFNWESELATCDPK 98
            V  PMGWDAFGLPAENAA + G+ P++WT  NI   K  L+  G  ++W+ E+ TC+P+
Sbjct: 72  EVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPE 131

Query: 99  YYKWTQALFLDLYHAGLVYR--KEVDYSQNLPTKFYH 133
           YY+W Q +FL ++  GL YR    V++     T   +
Sbjct: 132 YYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLAN 168


>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1h3na3 494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 100.0
d1ffya3 450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 100.0
d1ivsa4 425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 100.0
d1ilea3 452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 99.98
d1pfva2 350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 99.98
d1rqga2 361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 99.96
d2d5ba2 348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 99.96
d1li5a2 315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 99.9
d1f7ua2 348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 99.64
d1irxa2 317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 99.51
d1iq0a2 370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 99.49
d1j09a2 305 Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph 99.41
d1gtra2 331 Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co 99.32
d1nzja_ 286 Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia c 99.31
d1j1ua_ 306 Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc 95.61
d2ts1a_ 319 Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearoth 94.08
d1r6ta2 386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 93.29
d1i6la_ 326 Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste 93.18
d1h3fa1 343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 93.06
d1jila_ 323 Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au 93.01
d1n3la_ 339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 92.96
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Leucyl-tRNA synthetase (LeuRS)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=6.9e-39  Score=256.94  Aligned_cols=123  Identities=35%  Similarity=0.689  Sum_probs=121.2

Q ss_pred             CCCCCCcCcchHHHHHHHHHHHHHHHhhcCCCCCCceeeecccCCCCCHHHHHHHHHcCCChHHHHHHHHHHHHHHHHhc
Q psy6621           3 DCTEEELTCLGGVVVKTHSGAECRLAGINSIIKGPVRVFQPMGWDAFGLPAENAAHQHGIDPREWTVGNIATMKSQLQGF   82 (133)
Q Consensus         3 ~~~png~lHlGH~~~~~~~Dil~R~~r~~G~~~~~~~V~~~~G~D~~G~~i~~~a~~~g~~~~~~~~~~~~~~~~~l~~l   82 (133)
                      ||||||.||||||++++++|+++||+||+|     ++|.+++||||||+|||.+|++.+..|+++++++.+.+++++++|
T Consensus        41 pP~~nG~lHiGH~~~~~~~D~~~R~~rm~G-----~~v~~~~G~D~~G~~~e~~~~k~~~~~~~~~~~~~~~~~~~~~~~  115 (494)
T d1h3na3          41 FPYPSGDLHMGHLKNYTMGDVLARFRRMQG-----YEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLM  115 (494)
T ss_dssp             CCCSSSCCBHHHHHHHHHHHHHHHHHHHTT-----CEEECCCCBCCSSHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCchhhhHHHHHHHHHHHHHHHHccC-----CcccCcCCcCcchHHHHHHHHHhCCChHHHHHHHHHHhHHHHHhc
Confidence            789999999999999999999999999999     999999999999999999999999999999999999999999999


Q ss_pred             CcccccCCceecCChhHHHHHHHHHHHHHHCCCeEEeceeeeecCCCC
Q psy6621          83 GCKFNWESELATCDPKYYKWTQALFLDLYHAGLVYRKEVDYSQNLPTK  130 (133)
Q Consensus        83 gi~~d~~~~~~T~~~~~~~~v~~~f~~L~~~G~iy~~~~~v~~~~~~~  130 (133)
                      |++.||++++.|++++|.+.++++|.+|+++|+||++.++|+|||.++
T Consensus       116 g~~~d~~~~~~T~d~~~~~~~~~~f~~l~~~g~iy~~~~~~~~~~~~~  163 (494)
T d1h3na3         116 GILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQ  163 (494)
T ss_dssp             TCCCCGGGCCBTTSHHHHHHHHHHHHHHHHTTCEEEEEEEEEEETTTT
T ss_pred             CcccCCCCceecCCccccchHHHHHHHhhhCCcEEeeeEEEEeecCcc
Confidence            999999999999999999999999999999999999999999999886



>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure