Psyllid ID: psy6638
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| 270009930 | 1348 | hypothetical protein TcasGA2_TC009254 [T | 0.937 | 0.189 | 0.515 | 4e-70 | |
| 189238865 | 1918 | PREDICTED: similar to AGAP007092-PA [Tri | 0.937 | 0.133 | 0.515 | 4e-70 | |
| 242008252 | 1528 | down syndrome cell adhesion molecule, pu | 0.941 | 0.168 | 0.475 | 8e-65 | |
| 357626167 | 1208 | hypothetical protein KGM_10570 [Danaus p | 0.937 | 0.211 | 0.494 | 9e-65 | |
| 328711870 | 1925 | PREDICTED: Down syndrome cell adhesion m | 0.941 | 0.133 | 0.456 | 9e-64 | |
| 328711868 | 1948 | PREDICTED: Down syndrome cell adhesion m | 0.941 | 0.131 | 0.456 | 9e-64 | |
| 170027744 | 1693 | down syndrome cell adhesion molecule [Cu | 0.908 | 0.146 | 0.470 | 1e-58 | |
| 442630978 | 1935 | down syndrome cell adhesion molecule 4, | 0.937 | 0.132 | 0.441 | 2e-58 | |
| 194865958 | 1774 | GG14294 [Drosophila erecta] gi|190653471 | 0.937 | 0.144 | 0.441 | 2e-58 | |
| 195491267 | 1815 | GE20723 [Drosophila yakuba] gi|194179590 | 0.937 | 0.141 | 0.441 | 3e-58 |
| >gi|270009930|gb|EFA06378.1| hypothetical protein TcasGA2_TC009254 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 270 bits (691), Expect = 4e-70, Method: Compositional matrix adjust.
Identities = 134/260 (51%), Positives = 178/260 (68%), Gaps = 4/260 (1%)
Query: 4 RYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIR 63
RY++R Q L +GM+SEL I +RQD+G +C A+N +G+ +M IQL+VQE PE P+N+R
Sbjct: 249 RYSVRAQQLAEGMVSELSIERTIRQDTGIFTCSASNAYGSDDMNIQLIVQEIPEPPRNVR 308
Query: 64 ITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLP 123
+ ++ SRS+ ISWT PY+GN+ IT YI+QYK E WP QP K+ VPGSQ + TLQ L P
Sbjct: 309 VMDQLSRSIGISWTQPYAGNSPITNYIVQYKPGSEAWPNQPAKVTVPGSQITTTLQNLRP 368
Query: 124 ATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPR 183
A Y +R+LAEN LG+S+ +Q STLEE P+GAP ++ ++ TEL++ W+ P R
Sbjct: 369 AQVYHLRILAENRLGLSDPSQVVQVSTLEEVPSGAPVDIRAE--AKSSTELVVTWEPPNR 426
Query: 184 ESWNGVLLGYDVGYQISS--GSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVR 241
E+WNG LLGY VGYQ S S+ SYT KSVE+ Y GE + GL+ YT Y I+V+
Sbjct: 427 ETWNGNLLGYHVGYQEVSTEDSNNVAQSYTFKSVEVRPHYGGEAVLQGLSKYTTYGIIVQ 486
Query: 242 GYNSVGKGPFSEPFIARTNE 261
YNS G GP S+P ART E
Sbjct: 487 AYNSRGSGPASDPVTARTLE 506
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189238865|ref|XP_972891.2| PREDICTED: similar to AGAP007092-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242008252|ref|XP_002424921.1| down syndrome cell adhesion molecule, putative [Pediculus humanus corporis] gi|212508527|gb|EEB12183.1| down syndrome cell adhesion molecule, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|357626167|gb|EHJ76353.1| hypothetical protein KGM_10570 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328711870|ref|XP_003244665.1| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328711868|ref|XP_001951010.2| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170027744|ref|XP_001841757.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] gi|167862327|gb|EDS25710.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|442630978|ref|NP_001261571.1| down syndrome cell adhesion molecule 4, isoform I [Drosophila melanogaster] gi|442630980|ref|NP_001261572.1| down syndrome cell adhesion molecule 4, isoform J [Drosophila melanogaster] gi|440215478|gb|AGB94266.1| down syndrome cell adhesion molecule 4, isoform I [Drosophila melanogaster] gi|440215479|gb|AGB94267.1| down syndrome cell adhesion molecule 4, isoform J [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194865958|ref|XP_001971688.1| GG14294 [Drosophila erecta] gi|190653471|gb|EDV50714.1| GG14294 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195491267|ref|XP_002093489.1| GE20723 [Drosophila yakuba] gi|194179590|gb|EDW93201.1| GE20723 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| FB|FBgn0263219 | 1918 | Dscam4 "Down syndrome cell adh | 0.937 | 0.133 | 0.431 | 6.2e-54 | |
| FB|FBgn0033159 | 2037 | Dscam "Down syndrome cell adhe | 0.934 | 0.125 | 0.388 | 2e-49 | |
| FB|FBgn0261046 | 2046 | Dscam3 "Down syndrome cell adh | 0.534 | 0.071 | 0.346 | 6e-35 | |
| UNIPROTKB|F1NY98 | 1994 | DSCAM "Uncharacterized protein | 0.919 | 0.125 | 0.340 | 4.1e-34 | |
| UNIPROTKB|O60469 | 2012 | DSCAM "Down syndrome cell adhe | 0.919 | 0.124 | 0.325 | 3.7e-33 | |
| MGI|MGI:1196281 | 2013 | Dscam "Down syndrome cell adhe | 0.919 | 0.124 | 0.321 | 1.3e-32 | |
| RGD|619992 | 2013 | Dscam "Down syndrome cell adhe | 0.919 | 0.124 | 0.321 | 1.3e-32 | |
| UNIPROTKB|Q8TD84 | 2053 | DSCAML1 "Down syndrome cell ad | 0.915 | 0.121 | 0.346 | 1.9e-31 | |
| MGI|MGI:2150309 | 2053 | Dscaml1 "Down syndrome cell ad | 0.915 | 0.121 | 0.346 | 1.9e-31 | |
| UNIPROTKB|F1N4K6 | 1886 | DSCAML1 "Uncharacterized prote | 0.915 | 0.132 | 0.346 | 2.2e-31 |
| FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 572 (206.4 bits), Expect = 6.2e-54, P = 6.2e-54
Identities = 116/269 (43%), Positives = 166/269 (61%)
Query: 3 SRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNI 62
SRYTIR+QVL+DGM+SELGI++ RQD+G C A+N G EM+IQL+VQE PE PKN+
Sbjct: 853 SRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNL 912
Query: 63 RITEESSRSLQISWTAPYSGNTAITQYIIQYK------SSEEMWPTQPLKIIVPGSQTSA 116
RI + SRSLQ++W+ P++GN+ I +Y I YK S ++W + + G+QT
Sbjct: 913 RINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDFFSPSDIWQNAE-HLTIAGAQTVI 971
Query: 117 TLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLI 176
+Q L PA Y +R+ AEN LG SE +Q +TLEE P+G P V ++P TE+ +
Sbjct: 972 NIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPK--SSTEIFV 1029
Query: 177 KWKAPPRESWNGVLLGYDVGYQIXXXXXXX----XXXYTLKSVELDNQYEGELRIPGLTP 232
W AP R+ WNG+LLGY VGYQ+ ++ K+VE+ + + GE + L
Sbjct: 1030 TWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNK 1089
Query: 233 YTKYAIVVRGYNSVGKGPFSEPFIARTNE 261
+T+Y ++V+ Y S G GP S+ +T E
Sbjct: 1090 FTQYHVIVQAYTSQGSGPPSKEIAVQTME 1118
|
|
| FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261046 Dscam3 "Down syndrome cell adhesion molecule 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TD84 DSCAML1 "Down syndrome cell adhesion molecule-like protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2150309 Dscaml1 "Down syndrome cell adhesion molecule like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N4K6 DSCAML1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-17 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 1e-15 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-15 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 9e-11 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 4e-08 | |
| cd05735 | 88 | cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma | 6e-08 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 2e-07 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 5e-05 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 5e-05 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 2e-04 | |
| cd05758 | 98 | cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (I | 0.001 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
Score = 74.5 bits (183), Expect = 3e-17
Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 2/95 (2%)
Query: 56 PEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTS 115
P P N+R+T+ +S S+ +SWT P IT Y+++Y+ + PGS+TS
Sbjct: 1 PSPPTNLRVTDVTSTSVTLSWTPPEDDGGPITGYVVEYREKGSGDWKEVEV--TPGSETS 58
Query: 116 ATLQPLLPATQYQVRLLAENPLGMSETGAELQAST 150
TL L P T+Y+ R+ A N G S + +T
Sbjct: 59 YTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93
|
Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93 |
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|143235 cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| KOG4221|consensus | 1381 | 99.97 | ||
| KOG3513|consensus | 1051 | 99.96 | ||
| KOG3513|consensus | 1051 | 99.93 | ||
| KOG4221|consensus | 1381 | 99.93 | ||
| KOG0196|consensus | 996 | 99.9 | ||
| KOG4222|consensus | 1281 | 99.74 | ||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.45 | |
| KOG0196|consensus | 996 | 99.43 | ||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.31 | |
| KOG4258|consensus | 1025 | 99.07 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.96 | |
| KOG4802|consensus | 516 | 98.9 | ||
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 98.88 | |
| KOG4222|consensus | 1281 | 98.84 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.7 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 98.67 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 98.51 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.46 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 98.4 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 98.36 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.36 | |
| KOG4258|consensus | 1025 | 98.34 | ||
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 98.33 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 98.28 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 98.26 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 98.19 | |
| KOG4367|consensus | 699 | 98.17 | ||
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 98.15 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 98.14 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 98.14 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 98.11 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 98.1 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 98.07 | |
| KOG4152|consensus | 830 | 98.06 | ||
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 98.04 | |
| KOG3632|consensus | 1335 | 98.04 | ||
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 98.02 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 98.01 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 97.96 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 97.92 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 97.91 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.89 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 97.89 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 97.88 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 97.88 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 97.87 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 97.87 | |
| KOG4802|consensus | 516 | 97.85 | ||
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 97.85 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 97.84 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 97.84 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 97.82 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 97.81 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 97.8 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 97.78 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 97.77 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 97.77 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 97.77 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 97.77 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 97.76 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 97.72 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 97.7 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 97.7 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 97.68 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 97.67 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 97.67 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 97.67 | |
| KOG4194|consensus | 873 | 97.64 | ||
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 97.64 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 97.64 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 97.63 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 97.63 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 97.63 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 97.62 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 97.62 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 97.62 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 97.61 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 97.61 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 97.6 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 97.6 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 97.55 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 97.55 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 97.55 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 97.55 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 97.53 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 97.5 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 97.49 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 97.48 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 97.46 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 97.45 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 97.45 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 97.43 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 97.4 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 97.32 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 97.3 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 97.29 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 97.19 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 97.12 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 97.11 | |
| KOG4194|consensus | 873 | 97.03 | ||
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 97.02 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 97.01 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 97.01 | |
| KOG4367|consensus | 699 | 96.99 | ||
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 96.94 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 96.92 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 96.9 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 96.89 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 96.89 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 96.88 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 96.85 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 96.83 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 96.82 | |
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 96.81 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 96.8 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 96.78 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 96.78 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 96.77 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 96.75 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 96.73 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 96.72 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 96.68 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 96.68 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 96.67 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 96.66 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 96.65 | |
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 96.65 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 96.62 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 96.59 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 96.56 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 96.53 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 96.5 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 96.45 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 96.44 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 96.42 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 96.39 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 96.36 | |
| PLN02533 | 427 | probable purple acid phosphatase | 96.15 | |
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 96.12 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 96.12 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 96.08 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 96.06 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 96.0 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 95.92 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 95.9 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 95.89 | |
| smart00409 | 86 | IG Immunoglobulin. | 95.89 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 95.89 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 95.78 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 95.75 | |
| KOG4806|consensus | 454 | 95.74 | ||
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 95.69 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 95.63 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 95.62 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 95.53 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 95.51 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 95.33 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 95.26 | |
| KOG3632|consensus | 1335 | 95.14 | ||
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 95.04 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 95.01 | |
| KOG4228|consensus | 1087 | 95.0 | ||
| PHA03376 | 221 | BARF1; Provisional | 94.83 | |
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 94.79 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 94.45 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 94.4 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 94.38 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 94.14 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 93.98 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 93.71 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 93.69 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 93.67 | |
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 93.59 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 93.58 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 93.53 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 93.43 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 93.4 | |
| KOG4152|consensus | 830 | 93.35 | ||
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 93.11 | |
| KOG0613|consensus | 1205 | 92.75 | ||
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 92.3 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 92.27 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 91.97 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 91.94 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 91.87 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 91.3 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 90.74 | |
| PLN02533 | 427 | probable purple acid phosphatase | 90.61 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 90.25 | |
| KOG4806|consensus | 454 | 89.89 | ||
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 89.44 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 89.03 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 88.8 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 87.9 | |
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 87.47 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 86.38 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 86.13 | |
| KOG3515|consensus | 741 | 85.57 | ||
| KOG1948|consensus | 1165 | 85.38 | ||
| PF13754 | 54 | Big_3_4: Bacterial Ig-like domain (group 3) | 85.25 | |
| KOG3515|consensus | 741 | 84.94 | ||
| PHA02982 | 251 | hypothetical protein; Provisional | 84.92 | |
| KOG1378|consensus | 452 | 84.72 | ||
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 84.38 | |
| PF09423 | 453 | PhoD: PhoD-like phosphatase; InterPro: IPR018946 T | 84.24 | |
| KOG1225|consensus | 525 | 83.44 | ||
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 83.42 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 83.41 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 82.99 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 82.96 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 82.82 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 81.58 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 81.14 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 80.61 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 80.45 |
| >KOG4221|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=9.9e-30 Score=213.17 Aligned_cols=231 Identities=26% Similarity=0.416 Sum_probs=202.3
Q ss_pred EEEEEeeeeeCCCEEEEEEEEcCCCCceeEEEEEEecCCCCCcceEEEEeeccEEEEEEeCCCCCCccceEEEEEEEeCC
Q psy6638 18 SELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSE 97 (273)
Q Consensus 18 ~~l~i~~~~~~~~~~y~~~a~n~~g~~~~~~~~~~~~~P~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~y~v~~~~~~ 97 (273)
.+..+.++.+..-|.|+|.|.|..|+..++..+.|..+|..|..+.........+.+.|.+|.-+++++.+|.+.+...+
T Consensus 483 ~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pLkV~t~pEgp~~~~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~~ 562 (1381)
T KOG4221|consen 483 IQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPLKVTTQPEGPVQLQAYATSPTTILVTWEPPPFGNGPITGYKLFYSEDD 562 (1381)
T ss_pred eEEEeeecccceeEEEEEeccCcccCCccCCceEEecCCCCCccccccccCcceEEEEecCCCCCCCCceEEEEEEEcCC
Confidence 67889999999999999999999999999999999999987766777788889999999999888999999999999873
Q ss_pred CCCCCccceEEecCCccEEEecCCCCCCeEEEEEEEeCCCCCCCCCcceEEEecCCCCCCCCeeEEecCCccCCceEEEE
Q psy6638 98 EMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIK 177 (273)
Q Consensus 98 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~y~~~v~a~~~~g~~~~s~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~i~l~ 177 (273)
.. ....+..+.+.++|.+|++.+.|.|+|.|.|..|.|..+..+.+.+..+.|..||.++++.. .++++|.|+
T Consensus 563 ~~-----~~~~~~~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev--~sStsVrVs 635 (1381)
T KOG4221|consen 563 TG-----KELRVENNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEV--VSSTSVRVS 635 (1381)
T ss_pred CC-----ceEEEecCccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEe--cCCCeEEEE
Confidence 21 22355567789999999999999999999999999999999999999999999999999998 899999999
Q ss_pred EeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEEEcCCCCccceEEEEEEEecCCCcCCCCccEEE
Q psy6638 178 WKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIA 257 (273)
Q Consensus 178 W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~g~~~~s~~~~~ 257 (273)
|.+|.....+|.+.+|+|+|+....+.. ............+.+.+|+|++.|.|+|.|.+..|.|++|++..+
T Consensus 636 W~pP~~~t~ng~itgYkIRy~~~~~~~~-------~~~t~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~a 708 (1381)
T KOG4221|consen 636 WLPPPSETQNGQITGYKIRYRKLSREDE-------VNETVVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSA 708 (1381)
T ss_pred ccCCCcccccceEEEEEEEecccCcccc-------cceeecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceec
Confidence 9999998889999999999997654321 111223334678899999999999999999999999999999999
Q ss_pred EcCCC
Q psy6638 258 RTNEG 262 (273)
Q Consensus 258 ~t~~~ 262 (273)
.|+..
T Consensus 709 eT~~~ 713 (1381)
T KOG4221|consen 709 ETPES 713 (1381)
T ss_pred cCccc
Confidence 99754
|
|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >KOG1948|consensus | Back alignment and domain information |
|---|
| >PF13754 Big_3_4: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1378|consensus | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: |
Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 273 | ||||
| 2nzi_A | 305 | Crystal Structure Of Domains A168-A170 From Titin L | 1e-11 | ||
| 1va9_A | 122 | Solution Structure Of The Second Fniii Domain Of Ds | 2e-08 | ||
| 3tes_A | 98 | Crystal Structure Of Tencon Length = 98 | 3e-08 | ||
| 1wf5_A | 121 | Solution Structure Of The First Fn3 Domain Of Sidek | 3e-08 | ||
| 2xyc_A | 291 | Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | 2e-07 | ||
| 2jll_A | 389 | Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | 2e-07 | ||
| 1uey_A | 127 | Solution Structure Of The First Fibronectin Type Ii | 6e-07 | ||
| 3l5h_A | 589 | Crystal Structure Of The Full Ectodomain Of Human G | 8e-07 | ||
| 2edx_A | 134 | Solution Structures Of The Fn3 Domain Of Human Rece | 2e-06 | ||
| 2yux_A | 120 | Solution Structure Of 3rd Fibronectin Type Three Do | 2e-06 | ||
| 1fnf_A | 368 | Fragment Of Human Fibronectin Encompassing Type-Iii | 4e-06 | ||
| 1x5z_A | 115 | Solution Structure Of The Fibronectin Type-Iii Doma | 1e-05 | ||
| 2dlh_A | 121 | Solution Structure Of The Second Fn3 Domain Of Huma | 4e-05 | ||
| 1mfn_A | 184 | Solution Nmr Structure Of Linked Cell Attachment Mo | 7e-05 | ||
| 3teu_A | 98 | Crystal Structure Of Fibcon Length = 98 | 9e-05 | ||
| 1bqu_A | 215 | Cytokyne-Binding Region Of Gp130 Length = 215 | 1e-04 | ||
| 3mtr_A | 215 | Crystal Structure Of The Ig5-Fn1 Tandem Of Human Nc | 2e-04 | ||
| 2dju_A | 106 | Solution Structures Of The Fn3 Domain Of Human Rece | 7e-04 | ||
| 1uen_A | 125 | Solution Structure Of The Third Fibronectin Iii Dom | 9e-04 |
| >pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 | Back alignment and structure |
|
| >pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 | Back alignment and structure |
| >pdb|3TES|A Chain A, Crystal Structure Of Tencon Length = 98 | Back alignment and structure |
| >pdb|1WF5|A Chain A, Solution Structure Of The First Fn3 Domain Of Sidekick-2 Protein Length = 121 | Back alignment and structure |
| >pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | Back alignment and structure |
| >pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | Back alignment and structure |
| >pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 | Back alignment and structure |
| >pdb|3L5H|A Chain A, Crystal Structure Of The Full Ectodomain Of Human Gp130: New Insights Into The Molecular Assembly Of Receptor Complexes Length = 589 | Back alignment and structure |
| >pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 | Back alignment and structure |
| >pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 | Back alignment and structure |
| >pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 | Back alignment and structure |
| >pdb|1X5Z|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Protein Tyrosine Phosphatase, Receptor Type, D Isoform 4 Variant Length = 115 | Back alignment and structure |
| >pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 | Back alignment and structure |
| >pdb|1MFN|A Chain A, Solution Nmr Structure Of Linked Cell Attachment Modules Of Mouse Fibronectin Containing The Rgd And Synergy Regions, 20 Structures Length = 184 | Back alignment and structure |
| >pdb|3TEU|A Chain A, Crystal Structure Of Fibcon Length = 98 | Back alignment and structure |
| >pdb|1BQU|A Chain A, Cytokyne-Binding Region Of Gp130 Length = 215 | Back alignment and structure |
| >pdb|3MTR|A Chain A, Crystal Structure Of The Ig5-Fn1 Tandem Of Human Ncam Length = 215 | Back alignment and structure |
| >pdb|2DJU|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 106 | Back alignment and structure |
| >pdb|1UEN|A Chain A, Solution Structure Of The Third Fibronectin Iii Domain Of Human Kiaa0343 Protein Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-56 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 9e-20 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 1e-54 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 2e-50 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 3e-35 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 2e-29 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 4e-05 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 1e-45 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-17 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 9e-43 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 4e-42 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 2e-16 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 2e-05 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 4e-41 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 5e-18 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 3e-17 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 2e-40 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 1e-28 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 6e-26 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 2e-38 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 5e-22 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 7e-20 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 2e-07 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 3e-38 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 3e-09 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-37 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 1e-15 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-13 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 5e-36 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 5e-18 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-34 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 2e-11 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 1e-33 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 1e-27 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 2e-10 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 3e-32 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 6e-31 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 3e-30 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 4e-32 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 5e-29 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 7e-29 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 8e-32 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 2e-27 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 3e-09 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-30 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 3e-16 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-06 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 5e-30 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 5e-30 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 2e-23 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-14 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 8e-30 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 2e-29 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 5e-15 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 4e-29 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 3e-04 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 2e-28 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 2e-18 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-28 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 8e-14 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 6e-28 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 1e-12 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 1e-27 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 4e-14 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 1e-27 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 1e-16 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-27 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-12 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 3e-27 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 8e-15 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 3e-26 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 3e-18 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 4e-26 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 2e-05 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 7e-26 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 3e-14 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 7e-05 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 2e-25 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 2e-15 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 5e-08 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 2e-25 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 4e-10 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 6e-25 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 6e-09 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 1e-24 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 8e-04 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 3e-24 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 2e-18 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 3e-24 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 6e-15 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 1e-23 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 3e-23 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 3e-15 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 4e-23 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 1e-16 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-23 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 8e-09 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 9e-23 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 9e-16 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 2e-22 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 4e-06 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 5e-22 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 3e-04 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-22 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-13 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 8e-22 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-20 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-21 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-18 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-18 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-11 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-08 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 1e-20 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 4e-08 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 2e-20 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 1e-07 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 3e-20 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 1e-10 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 4e-20 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-20 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-05 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 6e-20 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 7e-07 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 7e-20 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 5e-19 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 1e-19 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 1e-19 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 2e-18 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 2e-19 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 1e-05 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 2e-19 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 2e-05 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 3e-19 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 7e-07 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 6e-19 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 8e-08 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 6e-19 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 7e-07 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 8e-19 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 2e-16 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-18 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-05 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-18 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 3e-17 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 3e-18 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 2e-06 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 3e-18 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 1e-05 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 3e-18 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 2e-04 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-18 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-12 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 5e-18 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 9e-07 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 5e-18 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-18 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-17 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 5e-18 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 6e-05 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 6e-18 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 6e-16 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 7e-18 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 8e-18 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 5e-15 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 9e-18 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 9e-16 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 1e-17 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 1e-16 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 1e-17 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 2e-08 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 1e-17 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-17 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-16 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 2e-17 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 3e-05 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 3e-17 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 2e-05 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 3e-17 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 6e-17 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 2e-06 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 7e-17 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 8e-17 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 5e-09 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 9e-17 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 4e-07 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 1e-16 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 2e-04 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 1e-16 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 4e-16 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 5e-16 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 2e-04 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 6e-16 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 8e-13 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 8e-16 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 2e-09 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 8e-16 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-12 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 3e-15 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 8e-08 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 4e-15 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 6e-06 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-15 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 9e-14 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 9e-15 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 2e-14 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-14 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 3e-14 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 5e-14 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 2e-05 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 6e-14 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 6e-14 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 2e-04 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 8e-14 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 1e-13 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 2e-13 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 4e-07 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 1e-05 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 3e-13 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 8e-08 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-12 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-10 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 6e-04 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 9e-12 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 3e-10 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-07 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 1e-06 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 1e-11 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 3e-11 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 2e-09 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 2e-07 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 3e-11 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 1e-05 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 3e-11 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 4e-11 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 4e-10 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 4e-11 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 1e-08 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 3e-07 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 6e-11 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 1e-10 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 2e-06 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 2e-10 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 5e-10 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 3e-06 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 5e-10 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 8e-08 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 9e-10 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 3e-09 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 8e-08 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 1e-09 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 4e-07 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 1e-09 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 3e-09 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 5e-09 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 3e-05 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 5e-09 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 1e-06 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 1e-08 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 1e-08 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 1e-08 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 1e-08 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 3e-06 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 1e-08 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 3e-08 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 4e-06 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 4e-08 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 5e-08 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 5e-08 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 5e-08 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 6e-08 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 3e-05 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 6e-04 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 6e-08 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 7e-08 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 1e-07 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 1e-07 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 2e-06 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 9e-06 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 1e-07 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 1e-04 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 1e-07 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 2e-07 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 2e-07 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 2e-07 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 4e-04 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 2e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 3e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 3e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 4e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-04 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 2e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-07 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 3e-07 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 4e-07 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 4e-07 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 4e-07 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 5e-07 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 6e-07 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 6e-07 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 7e-07 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 7e-07 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 8e-07 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 1e-04 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 9e-04 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 8e-07 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 9e-07 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 2e-06 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 7e-05 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 1e-06 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 3e-05 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 1e-06 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 1e-06 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 3e-06 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 1e-06 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 2e-04 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 2e-06 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-06 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 2e-06 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 2e-06 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 2e-06 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 3e-05 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 1e-04 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 2e-06 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 3e-06 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 3e-06 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 7e-05 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 3e-06 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 3e-06 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 7e-06 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 3e-06 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 4e-04 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 3e-06 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 1e-05 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 4e-06 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 4e-06 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 4e-06 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 2e-05 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 5e-06 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 5e-06 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 6e-06 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 6e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 6e-06 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 6e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-06 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 7e-06 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 7e-06 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 3e-05 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 8e-06 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 9e-06 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 1e-05 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 1e-05 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 3e-05 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 1e-05 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 1e-05 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 1e-05 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 1e-05 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 2e-05 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 8e-04 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 1e-05 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 1e-05 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 2e-05 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 6e-05 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 2e-05 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 2e-05 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 2e-05 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 2e-05 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 7e-04 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 2e-05 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 2e-05 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 2e-05 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 3e-05 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 1e-04 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-05 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-04 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 8e-04 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 3e-05 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 5e-05 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 3e-05 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 5e-04 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 4e-05 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 1e-04 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-05 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 8e-05 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 4e-05 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 3e-04 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 4e-05 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 9e-05 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 5e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-04 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 1e-04 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 1e-04 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 1e-04 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 1e-04 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 2e-04 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 2e-04 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 2e-04 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 2e-04 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 2e-04 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 2e-04 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 3e-04 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 3e-04 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 3e-04 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 3e-04 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 3e-04 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 4e-04 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 4e-04 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 5e-04 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 5e-04 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 6e-04 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 7e-04 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 7e-04 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 7e-04 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 8e-04 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 8e-04 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 9e-04 |
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
Score = 185 bits (470), Expect = 2e-56
Identities = 49/258 (18%), Positives = 85/258 (32%), Gaps = 16/258 (6%)
Query: 3 SRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNI 62
++ T + G L IA D G +C ATN+ GT L + + P +P +
Sbjct: 143 AKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGV 202
Query: 63 RITEESSRSLQISWTAP-YSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPL 121
+I E S + ++S+ P G I Y + K E+ + G QT L L
Sbjct: 203 KIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVK---EVASEIWKIVRSHGVQTMVVLNNL 259
Query: 122 LPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAP 181
P T Y++R+ A N G + TL P +
Sbjct: 260 EPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQP---SSGKSFKLSIT-- 314
Query: 182 PRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVR 241
++ +L Y V Y+ ++ + + + L Y + +
Sbjct: 315 KQDDGGAPILEYIVKYRSKDKED------QWLEKKVQGN-KDHIILEHLQWTMGYEVQIT 367
Query: 242 GYNSVGKGPFSEPFIART 259
N +G + +
Sbjct: 368 AANRLGYSEPTVYEFSMP 385
|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Length = 229 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 100.0 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 100.0 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.97 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.97 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.97 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.97 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.96 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.96 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.96 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.96 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.95 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.95 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.95 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.95 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.95 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.95 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.94 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.94 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.94 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.94 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 99.94 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.93 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 99.93 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.93 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.93 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.93 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.93 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.92 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.92 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.92 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.91 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.91 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 99.91 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 99.9 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.89 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.89 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.88 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.88 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.87 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.87 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.87 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.86 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.86 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.86 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.85 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.84 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.84 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.83 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.83 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.82 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.81 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.8 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.8 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.79 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.79 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 99.79 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.79 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.78 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.78 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.78 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.77 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.77 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.77 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 99.76 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.76 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.75 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.75 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.74 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.74 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.74 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.74 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.74 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.74 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.73 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.73 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.72 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.72 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.72 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.71 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.71 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.7 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.7 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.7 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.7 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.69 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.69 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.69 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.69 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.69 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.69 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.68 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.68 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.68 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.68 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.68 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.67 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.67 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.67 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.66 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.66 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.66 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.66 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.66 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.66 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.66 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.65 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.65 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.64 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.64 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.64 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.63 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.63 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.63 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.63 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.63 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.62 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.62 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.62 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.61 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.61 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.61 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.61 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.6 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.6 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.6 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.59 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.59 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.59 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.59 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.59 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.59 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.59 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.58 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.58 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.58 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.58 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.58 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.58 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.58 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.58 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.58 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.57 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.57 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.57 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.57 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.57 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.56 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.56 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.56 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.56 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.56 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.55 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.55 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.55 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.54 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.54 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.54 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.54 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.54 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.53 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.53 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.53 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.52 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.52 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.52 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.51 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.51 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.51 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.51 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.5 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.5 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.5 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.5 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.5 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 99.5 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.5 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.49 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.49 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.49 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.48 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.48 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.48 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.47 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.47 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.46 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.46 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.46 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.46 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.46 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.45 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.45 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.44 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.44 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.44 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.44 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.44 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.44 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.44 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.44 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.43 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.43 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.43 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.43 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.43 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.42 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.42 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.42 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.42 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.4 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.4 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.4 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 99.4 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.4 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.39 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.39 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.39 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.39 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.38 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 99.37 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.36 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.36 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.35 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.35 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.35 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.34 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.33 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.32 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 99.32 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.31 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.31 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.3 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.29 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.28 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.27 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.26 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.25 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.24 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.22 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.22 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.21 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.21 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.21 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.21 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.2 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.2 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.19 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 99.19 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 99.19 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 99.15 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 99.15 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.13 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.12 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.11 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 99.11 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.11 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.11 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 99.06 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.05 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 99.04 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 99.01 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.96 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 98.94 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 98.91 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.91 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 98.88 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.84 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 98.84 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 98.81 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 98.79 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 98.73 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 98.71 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 98.71 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 98.71 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 98.65 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 98.65 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 98.63 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 98.62 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.58 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.51 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 98.5 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 98.48 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 98.43 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 98.42 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 98.4 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 98.38 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 98.37 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 98.35 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.33 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 98.3 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 98.28 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 98.28 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 98.27 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 98.25 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 98.25 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 98.23 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 98.22 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 98.21 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 98.2 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 98.18 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 98.18 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 98.17 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 98.17 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 98.15 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 98.14 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 98.13 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 98.11 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 98.11 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 98.11 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 98.11 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 98.11 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 98.1 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 98.1 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 98.08 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 98.07 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 98.07 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 98.05 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 98.03 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 98.03 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 98.03 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 98.02 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 98.0 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 98.0 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 98.0 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 97.99 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 97.99 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 97.98 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 97.98 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 97.97 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 97.97 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 97.97 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 97.97 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 97.96 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 97.96 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 97.96 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 97.93 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 97.92 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 97.91 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 97.9 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 97.9 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 97.89 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 97.89 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 97.88 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 97.88 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 97.87 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 97.87 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 97.86 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 97.86 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 97.85 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 97.84 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 97.84 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 97.83 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 97.83 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 97.83 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 97.83 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 97.82 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 97.81 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 97.81 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 97.8 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 97.78 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 97.78 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 97.78 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 97.78 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 97.77 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 97.76 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 97.76 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 97.75 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 97.75 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 97.75 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 97.74 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 97.74 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 97.73 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 97.73 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 97.73 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 97.73 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 97.73 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 97.72 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 97.72 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 97.72 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 97.71 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 97.71 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 97.71 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 97.71 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 97.71 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 97.7 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 97.7 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 97.69 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 97.69 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 97.69 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 97.68 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 97.68 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 97.68 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 97.68 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 97.67 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 97.65 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 97.64 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 97.64 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 97.64 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 97.63 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 97.63 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 97.61 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 97.61 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 97.61 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 97.61 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 97.61 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 97.59 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 97.58 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 97.58 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 97.58 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 97.58 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 97.58 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 97.57 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 97.52 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 97.51 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 97.5 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 97.5 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 97.49 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 97.48 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 97.48 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 97.47 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 97.47 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 97.46 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 97.46 | |
| 1zox_A | 113 | CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I | 97.44 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 97.43 | |
| 4hwu_A | 95 | Fibroblast growth factor receptor 2; FGFR2, KGFR, | 97.42 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 97.41 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 97.41 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 97.41 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 97.4 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 97.4 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 97.39 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 97.39 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 97.38 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 97.38 | |
| 2qsq_A | 111 | Carcinoembryonic antigen-related cell adhesion MO; | 97.37 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 97.36 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 97.36 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 97.34 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.33 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 97.33 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 97.33 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 97.33 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 97.33 | |
| 2nms_A | 124 | CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 | 97.33 | |
| 3rrq_A | 129 | Protein PD-1, programmed cell death protein 1; pro | 97.33 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 97.32 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 97.32 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 97.32 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 97.31 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 97.31 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 97.31 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 97.3 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 97.3 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 97.3 | |
| 3q0h_A | 117 | T cell immunoreceptor with IG and ITIM domains; im | 97.29 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 97.29 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 97.27 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 97.27 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 97.26 | |
| 3khq_A | 133 | B-cell antigen receptor complex-associated protei | 97.26 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 97.26 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 97.24 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 97.24 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 97.24 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 97.23 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 97.22 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 97.21 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 97.21 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 97.2 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 97.16 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 97.16 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 97.15 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 97.14 | |
| 4gos_A | 125 | V-SET domain-containing T-cell activation inhibit; | 97.14 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 97.13 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 97.12 | |
| 2q87_A | 110 | CMRF35-H antigen; all-beta, immunoglobulin, IG-sup | 97.12 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 97.11 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 97.11 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 97.11 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 97.11 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 97.1 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 97.1 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 97.09 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 97.06 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 97.05 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 97.04 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 97.04 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 97.04 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 97.03 | |
| 3udw_C | 118 | Poliovirus receptor; PVR tigit IGSF signal transdu | 97.01 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 96.99 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 96.99 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.99 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 96.99 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 96.98 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 96.96 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 96.95 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 96.92 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 96.92 |
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-30 Score=208.28 Aligned_cols=234 Identities=21% Similarity=0.273 Sum_probs=185.6
Q ss_pred ecCCcEEEEEEeeeeeCCCEEEEEEEEcCCCCceeEEEEEEecCCCCCcceEEEEeeccEEEEEEeCCCC-CCccceEEE
Q psy6638 12 LEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYS-GNTAITQYI 90 (273)
Q Consensus 12 ~~~~~~~~l~i~~~~~~~~~~y~~~a~n~~g~~~~~~~~~~~~~P~~p~~~~~~~~~~~~~~l~W~~~~~-~~~~~~~y~ 90 (273)
..++....|.|.++.+.|.|.|+|.|.|..|.....+.+.+..+|.+|..+.+.......+.|.|.++.. ++.++..|.
T Consensus 152 ~~~~~~~~L~i~~~~~~d~G~Y~C~a~N~~G~~~~~~~l~v~~~P~~P~~~~~~~~~~~~~~l~w~~p~~~~g~pi~~y~ 231 (389)
T 2jll_A 152 YSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQ 231 (389)
T ss_dssp EECSSCEEEEECCCSTTSSEEEEEEEEETTEEEEEEEEEEECCCCCCCEEEEEEEECSSCEEEEEECCSCCTTSCEEEEE
T ss_pred eccCCEEEEEECCCChhhCEEEEEEEEcCCCcEEEEEEEEecCCCCCCcceEEeeccCCEEEEEEeCCCCCCCcceEEEE
Confidence 3455667899999999999999999999999988888888889999998888888888999999997753 445788999
Q ss_pred EEEEeCCC-CCCCccceEEecCCccEEEecCCCCCCeEEEEEEEeCCCCCCCCCcceEEEecCCCCCCCCeeEEecCCcc
Q psy6638 91 IQYKSSEE-MWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVV 169 (273)
Q Consensus 91 v~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~y~~~v~a~~~~g~~~~s~~~~~~~~~~~p~~~p~~~~~~~~~~ 169 (273)
++|+..+. .|. ..........+.|.+|.+++.|.|+|.|.|..|.+.++....+.+....|+.+|. +.... .
T Consensus 232 v~~~~~~~~~~~----~~~~~~~~~~~~i~~l~~~~~y~~~v~A~N~~G~~~~s~~~~~~t~~~~~p~~p~-~~~~~--~ 304 (389)
T 2jll_A 232 VDVKEVASEIWK----IVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPS-IHGQP--S 304 (389)
T ss_dssp EEEEETTCSCCE----EEECSTTCSEEEECSCCTTCEEEEEEEEEESSCBCCCCCCEEEECCCCCCCCCCC-EEEEE--E
T ss_pred EEEEECCCcccE----EeeccCCcceEEECCccCCCEEEEEEEEEcCCccCCCCcceEEEecCCCCCCCCc-ccccc--C
Confidence 99998654 443 2233345578999999999999999999999999998888888887776766774 55555 6
Q ss_pred CCceEEEEEeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEEEcCCCCccceEEEEEEEecCCCcC
Q psy6638 170 DPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKG 249 (273)
Q Consensus 170 ~~~~i~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~g~~ 249 (273)
+.+++.|+|+++.+ .++.+.+|.|+|+..+...+ ............++|.+|.+++.|.|+|+|.|..|.|
T Consensus 305 ~~~~v~l~W~~p~~--~~~~i~~Y~v~~~~~~~~~~-------~~~~~~~~~~~~~~i~~L~~~t~Y~~~V~A~n~~G~s 375 (389)
T 2jll_A 305 SGKSFKLSITKQDD--GGAPILEYIVKYRSKDKEDQ-------WLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYS 375 (389)
T ss_dssp TTTEEEEEECCCCC--CSSCCCEEEEEEEC-----C-------CBCCEECTTCCEEEECSCCTTCEEEEEEEEEC-CCBC
T ss_pred cCCEEEEEEECCCC--CCCcccEEEEEEEeCCCCcc-------eeEeeccCCcceEEeCCcCCCCEEEEEEEEEcCCcCC
Confidence 88999999999865 47789999999998544321 1111123345789999999999999999999999999
Q ss_pred CCCccEEEEcCCC
Q psy6638 250 PFSEPFIARTNEG 262 (273)
Q Consensus 250 ~~s~~~~~~t~~~ 262 (273)
++|. +.++|.+.
T Consensus 376 ~~s~-~~~~T~~~ 387 (389)
T 2jll_A 376 EPTV-YEFSMPPK 387 (389)
T ss_dssp CCEE-EEEECCCC
T ss_pred Ccee-eEecCCCC
Confidence 9885 57777654
|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A | Back alignment and structure |
|---|
| >1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 273 | ||||
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 3e-18 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 3e-06 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 4e-17 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 7e-17 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-13 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 9e-17 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-14 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 4e-16 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 4e-12 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 6e-16 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-11 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-09 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-15 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 9e-06 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-14 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-14 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 1e-08 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 2e-14 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 9e-11 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-13 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 3e-12 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 1e-13 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-05 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 3e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 4e-13 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-04 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 6e-13 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-06 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 1e-12 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 8e-08 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-12 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 7e-11 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 1e-12 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-12 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 0.001 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-12 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 4e-12 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 7e-12 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 2e-05 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-11 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 2e-04 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-11 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-04 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 3e-11 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 4e-11 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 4e-11 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 5e-04 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-11 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 5e-11 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 2e-06 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 5e-11 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 6e-11 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-10 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 8e-08 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 2e-10 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-10 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 3e-10 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 3e-10 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 1e-07 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 4e-10 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 7e-06 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 5e-10 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 5e-10 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 6e-10 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 5e-06 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 7e-10 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 6e-05 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 9e-10 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 9e-10 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 1e-09 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 1e-09 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 0.001 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-09 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-04 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-09 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 4e-07 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 2e-09 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 4e-08 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 3e-09 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 3e-09 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 4e-09 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-09 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 8e-09 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 9e-09 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 1e-04 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 2e-08 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 2e-08 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 1e-04 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 6e-08 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 0.002 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 8e-08 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 0.001 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 1e-07 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 1e-07 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 4e-04 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 1e-07 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 2e-07 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 0.001 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 2e-07 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 5e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 7e-07 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 7e-07 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 1e-06 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 1e-06 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 1e-06 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 2e-06 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 2e-06 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-06 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.004 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-06 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 2e-06 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 3e-06 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-06 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 8e-06 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 8e-06 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 1e-05 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 2e-05 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 0.004 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 2e-05 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 3e-05 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 5e-05 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 6e-05 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 6e-05 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 6e-05 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 7e-05 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 1e-04 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 2e-04 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 2e-04 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 2e-04 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 5e-04 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 6e-04 | |
| d1erna2 | 105 | b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor | 6e-04 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 6e-04 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 8e-04 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 9e-04 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 9e-04 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 0.001 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 0.001 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 0.001 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 0.004 |
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Sidekick 2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.0 bits (186), Expect = 3e-18
Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 4/109 (3%)
Query: 47 TIQLLVQETPEAPKN--IRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQP 104
+ L V++ P AP++ ++ R++ ++WT P+ GN+ + +YI++ + W
Sbjct: 2 SAHLRVRQLPHAPEHPVATLSTVERRAINLTWTKPFDGNSPLIRYILEMSENNAPWTVLL 61
Query: 105 LKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEE 153
V TS T++ L+PA YQ RL A N +G + + + +L E
Sbjct: 62 --ASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDTERVSLPE 108
|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.76 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.76 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.76 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.74 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.73 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.73 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.72 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.71 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.7 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.69 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.69 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.69 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.69 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.69 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.67 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.67 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.67 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.67 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.66 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.66 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.65 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.64 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.64 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.63 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.63 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.62 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.62 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.62 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.62 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.61 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.61 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.61 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.6 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.6 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.6 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.59 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.59 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.58 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.58 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.57 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.57 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.57 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.57 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.57 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.56 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.56 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.56 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.56 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.56 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.55 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.55 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.54 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.53 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.53 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.53 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.52 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.52 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.51 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.51 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.51 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.51 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.5 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.5 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.5 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.5 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.49 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.49 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.49 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.49 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.48 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.48 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.48 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.48 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.48 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.47 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.47 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.46 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.46 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.46 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.46 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.46 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.46 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.45 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.45 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.45 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.45 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.44 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.44 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.43 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.43 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.42 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.42 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.41 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.4 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.4 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.39 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.39 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.39 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.38 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.37 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.37 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.35 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.34 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.33 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.33 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.32 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.32 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.32 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.32 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.31 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.31 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.31 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.3 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.3 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.29 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.29 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.27 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.26 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 99.26 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.26 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.25 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.25 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.24 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.22 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.22 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.21 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.2 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 99.15 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 99.14 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.12 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 99.09 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.07 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 99.06 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 99.04 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.03 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.96 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.85 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 98.53 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.51 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 98.25 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 98.21 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 98.13 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 98.1 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 98.04 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 98.04 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 97.95 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 97.94 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 97.93 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 97.92 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 97.92 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 97.9 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 97.9 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 97.87 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 97.8 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 97.78 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 97.77 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.74 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 97.73 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 97.72 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 97.71 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 97.7 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 97.69 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 97.63 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 97.62 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 97.62 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 97.58 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 97.56 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.5 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 97.5 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 97.38 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 97.38 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 97.25 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 97.23 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 97.23 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 97.21 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 97.21 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 97.2 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 97.2 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 97.17 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 97.13 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 97.1 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 97.1 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 97.08 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 97.03 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 97.02 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 97.0 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 96.99 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 96.97 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 96.97 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 96.96 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 96.94 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 96.9 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 96.87 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 96.84 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 96.83 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 96.8 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.8 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 96.78 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 96.78 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 96.77 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 96.76 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 96.58 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 96.43 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 96.27 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 96.22 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 96.13 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 96.1 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 96.09 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 96.06 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 95.94 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 95.75 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 95.65 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 95.36 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 95.09 | |
| d1hnfa1 | 101 | CD2, first domain {Human (Homo sapiens) [TaxId: 96 | 94.95 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 94.9 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 94.56 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 94.52 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 94.31 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 94.16 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 93.96 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 93.63 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 93.58 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 93.29 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 93.24 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 93.21 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 93.14 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 92.99 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 92.84 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 92.71 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 92.68 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 92.53 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 92.49 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 92.38 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 92.23 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 92.23 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 92.14 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 92.08 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 92.05 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 91.99 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 91.9 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 91.68 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 91.35 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 91.0 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 90.95 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 90.93 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 90.71 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 90.7 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 90.63 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 90.61 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 90.55 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 90.52 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 90.4 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 90.38 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 90.23 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 90.12 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 90.01 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 89.96 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 89.95 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 89.6 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 89.5 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 89.49 | |
| d1axib1 | 99 | Growth hormone receptor {Human (Homo sapiens) [Tax | 89.47 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 89.45 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 89.42 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 89.41 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 89.36 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 89.21 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 89.11 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 89.1 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 89.07 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 88.96 | |
| d1yjdc1 | 118 | CD28 {Human (Homo sapiens) [TaxId: 9606]} | 88.95 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 88.88 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 88.83 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 88.76 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 88.66 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 88.64 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 88.34 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 88.14 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 88.11 | |
| d2b5ic2 | 96 | Cytokine receptor common gamma chain {Human (Homo | 87.84 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 87.31 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 86.95 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 86.81 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 86.8 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 86.56 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 86.5 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 86.38 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 86.35 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 85.9 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 85.82 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 85.58 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 85.5 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 85.31 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 84.89 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 84.58 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 84.05 | |
| d1etzb1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 83.13 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 83.09 | |
| d1mqkh_ | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 83.09 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 83.05 | |
| d1axib1 | 99 | Growth hormone receptor {Human (Homo sapiens) [Tax | 82.5 | |
| d1oari_ | 103 | Immunoglobulin heavy chain variable domain, VH {Ra | 82.36 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 82.36 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 82.36 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 82.24 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 81.84 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 81.79 | |
| d2gysa3 | 99 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 81.78 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 81.7 | |
| d1jnhb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 81.39 | |
| d1ol0a_ | 121 | Immunoglobulin heavy chain variable domain, VH {En | 81.2 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 81.16 | |
| d1tjgh1 | 132 | Immunoglobulin heavy chain variable domain, VH {En | 81.12 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 81.02 | |
| d1dfbh1 | 126 | Immunoglobulin heavy chain variable domain, VH {Hu | 80.85 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 80.75 | |
| d1ai1h1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 80.52 | |
| d2cdeb1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 80.49 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 80.34 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 80.16 | |
| d2fbjh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 80.09 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 80.08 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 80.06 |
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Neogenin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80 E-value=1.7e-19 Score=118.03 Aligned_cols=112 Identities=26% Similarity=0.404 Sum_probs=90.7
Q ss_pred eEEEecCCCCCCCCeeEEecCCccCCceEEEEEeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEE
Q psy6638 146 LQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGEL 225 (273)
Q Consensus 146 ~~~~~~~~~p~~~p~~~~~~~~~~~~~~i~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 225 (273)
+.++|..++|..+|.++++.. .+.+++.|+|++|.....+|.+.+|.|+|+..+... .............+
T Consensus 2 v~v~T~~~~P~~~P~~v~~~~--~~~~si~v~W~~p~~~~~ng~i~~Y~v~y~~~~~~~-------~~~~~~~~~~~~~~ 72 (119)
T d1x5ha1 2 VAVRTLSDVPSAAPQNLSLEV--RNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKS-------DVTETLVSGTQLSQ 72 (119)
T ss_dssp CCCCCCCSSCCCCCEEEEEEC--CSSSEEEEEEECCCTTTCCSCEEEEBCEEEETTEEE-------EEECCBCCTTCCEE
T ss_pred EEEEcCCCCCCCCCcCeEEEE--ecCcEEEEEEEcccccCCCCCEEEEEEEEeeccccc-------ceeeeecCCCccEE
Confidence 345677778888899999988 899999999999876556889999999998875421 11122234456789
Q ss_pred EcCCCCccceEEEEEEEecCCCcCCCCccEEEEcCCCCCcc
Q psy6638 226 RIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLF 266 (273)
Q Consensus 226 ~i~~L~p~~~Y~~~v~a~n~~g~~~~s~~~~~~t~~~~P~~ 266 (273)
.|.+|+|++.|.|+|+|+|..|.|++|+.+.++|.++.|..
T Consensus 73 ~i~~L~p~t~Y~~~V~A~n~~G~G~~S~~~~~~T~~~~~~~ 113 (119)
T d1x5ha1 73 LIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDE 113 (119)
T ss_dssp EEECCCSSCEEEEECEEEETTEEEEECCCEEEECCSSCCCC
T ss_pred EeCCCCCCCEEEEEEEEEcCCcCCCCCCCEEEEeCCCCCCC
Confidence 99999999999999999999999999999999998766543
|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|