Psyllid ID: psy6638


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MFSRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCACNT
cccEEEEEEEEEccccEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEEEcccccccEEEEEEcccEEEEEEEccccccccccEEEEEEEEccccccccEEEEEEcccEEEEEEccccccEEEEEEEEEEcccccccccccEEEEccccccccccccEEEccccccccEEEEEEEccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEccccccccEEEEEEEEcccccccccccEEEEccccccccccccccc
ccccccEEEEEEEcccccEEEEEcccccccEEEEEEEEEcccccccccEEEEEccccccccEEEEEccccEEEEEEcccccccccEEEEEEEEEccccccccEEEEEEEcccccEEEEEccccccEEEEEEEEEEcccccccccEEEEEccccccccccccEEEEEEEEcccEEEEEEcccccccccccEEEEEEEEEEccccccccEEEEEEEEEEcccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccccc
MFSRYTIREQVLEDGMISELGIANvlrqdsgtlsclatnyhgtAEMTIQLLVqetpeapkniriteessrslqiswtapysgntAITQYIIQYKsseemwptqplkiivpgsqtsatlqpllpatQYQVRLLaenplgmsetgAELQAStleeapngaprevtsdpgvvdptellikwkappreswngVLLGYDVGyqissgsslalssytlksveldnqyegelripgltpytkYAIVVRGynsvgkgpfsepfiartnegDFLFLFCACNT
mfsrytirEQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRIteessrslqiswtapysgntAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLeeapngaprevtsdpgvvdPTELLikwkappresWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYegelripgltpyTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCACNT
MFSRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQIssgsslalssYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCACNT
*****TIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQ******************LQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLA***********************************VDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCAC**
*FSRYTI*E*******ISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLG***********************************LLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFL*CA***
MFSRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCACNT
***RYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEG***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLFLFCACNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query273 2.2.26 [Sep-21-2011]
O60469 2012 Down syndrome cell adhesi yes N/A 0.923 0.125 0.324 4e-33
Q8VHZ8 2013 Down syndrome cell adhesi yes N/A 0.923 0.125 0.320 2e-32
Q9ERC8 2013 Down syndrome cell adhesi yes N/A 0.923 0.125 0.320 2e-32
Q4VA61 2053 Down syndrome cell adhesi no N/A 0.915 0.121 0.353 1e-31
Q8TD84 2053 Down syndrome cell adhesi no N/A 0.915 0.121 0.353 1e-31
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.926 0.121 0.353 3e-31
Q58EX2 2172 Protein sidekick-2 OS=Hom no N/A 0.857 0.107 0.281 5e-20
Q8AV58 2169 Protein sidekick-1 OS=Gal no N/A 0.890 0.112 0.299 1e-19
Q6V4S5 2176 Protein sidekick-2 OS=Mus no N/A 0.857 0.107 0.269 4e-18
Q7Z5N4 2213 Protein sidekick-1 OS=Hom no N/A 0.897 0.110 0.301 5e-18
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 140/262 (53%), Gaps = 10/262 (3%)

Query: 2    FSRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKN 61
             +RY +  + + + +IS L I   +R+DSG  SC A N +G     IQL VQE P+ P+ 
Sbjct: 832  MARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPE- 890

Query: 62   IRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPL 121
            I I +  +R++ + WT  + GN+ IT Y I+ K+  + W +      V     SAT+  +
Sbjct: 891  IEIKDVKARTITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDI 950

Query: 122  LPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAP 181
             P++ Y +R+ A+N +G SE   EL  +  E AP+G P+EV  +P  +    + + WKAP
Sbjct: 951  HPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEP--ISSQSIRVTWKAP 1008

Query: 182  PRESWNGVLLGYDVGY-QISSGSSLALSSYTLKSVELDNQYEGEL-RIPGLTPYTKYAIV 239
             +   NG++ GY +GY + S+G      ++    + +D   + E+  +  L  +T+Y +V
Sbjct: 1009 KKHLQNGIIRGYQIGYREYSTG-----GNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLV 1063

Query: 240  VRGYNSVGKGPFSEPFIARTNE 261
            V+  N  G GP S+  I  T E
Sbjct: 1064 VQACNRAGTGPSSQEIITTTLE 1085




Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Mediates within retinal amacrine and ganglion cell subtypes both isoneuronal self-avoidance for creating an orderly dendritic arborization and heteroneuronal self-avoidance to maintain the mosaic spacing between amacrine and ganglion cell bodies. Receptor for netrin required for axon guidance independently of and in collaboration with the receptor DCC. In spinal chord development plays a role in guiding commissural axons projection and pathfinding across the ventral midline to reach the floor plate upon ligand binding. Enhances netrin-induced phosphorylation of PAK1 and FYN. Mediates intracellular signaling by stimulating the activation of MAPK8 and MAP kinase p38.
Homo sapiens (taxid: 9606)
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function description
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function description
>sp|Q58EX2|SDK2_HUMAN Protein sidekick-2 OS=Homo sapiens GN=SDK2 PE=1 SV=3 Back     alignment and function description
>sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus GN=SDK1 PE=2 SV=1 Back     alignment and function description
>sp|Q6V4S5|SDK2_MOUSE Protein sidekick-2 OS=Mus musculus GN=Sdk2 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z5N4|SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens GN=SDK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
270009930 1348 hypothetical protein TcasGA2_TC009254 [T 0.937 0.189 0.515 4e-70
189238865 1918 PREDICTED: similar to AGAP007092-PA [Tri 0.937 0.133 0.515 4e-70
242008252 1528 down syndrome cell adhesion molecule, pu 0.941 0.168 0.475 8e-65
357626167 1208 hypothetical protein KGM_10570 [Danaus p 0.937 0.211 0.494 9e-65
328711870 1925 PREDICTED: Down syndrome cell adhesion m 0.941 0.133 0.456 9e-64
328711868 1948 PREDICTED: Down syndrome cell adhesion m 0.941 0.131 0.456 9e-64
170027744 1693 down syndrome cell adhesion molecule [Cu 0.908 0.146 0.470 1e-58
442630978 1935 down syndrome cell adhesion molecule 4, 0.937 0.132 0.441 2e-58
194865958 1774 GG14294 [Drosophila erecta] gi|190653471 0.937 0.144 0.441 2e-58
195491267 1815 GE20723 [Drosophila yakuba] gi|194179590 0.937 0.141 0.441 3e-58
>gi|270009930|gb|EFA06378.1| hypothetical protein TcasGA2_TC009254 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 134/260 (51%), Positives = 178/260 (68%), Gaps = 4/260 (1%)

Query: 4   RYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIR 63
           RY++R Q L +GM+SEL I   +RQD+G  +C A+N +G+ +M IQL+VQE PE P+N+R
Sbjct: 249 RYSVRAQQLAEGMVSELSIERTIRQDTGIFTCSASNAYGSDDMNIQLIVQEIPEPPRNVR 308

Query: 64  ITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPLLP 123
           + ++ SRS+ ISWT PY+GN+ IT YI+QYK   E WP QP K+ VPGSQ + TLQ L P
Sbjct: 309 VMDQLSRSIGISWTQPYAGNSPITNYIVQYKPGSEAWPNQPAKVTVPGSQITTTLQNLRP 368

Query: 124 ATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPR 183
           A  Y +R+LAEN LG+S+    +Q STLEE P+GAP ++ ++      TEL++ W+ P R
Sbjct: 369 AQVYHLRILAENRLGLSDPSQVVQVSTLEEVPSGAPVDIRAE--AKSSTELVVTWEPPNR 426

Query: 184 ESWNGVLLGYDVGYQISS--GSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVR 241
           E+WNG LLGY VGYQ  S   S+    SYT KSVE+   Y GE  + GL+ YT Y I+V+
Sbjct: 427 ETWNGNLLGYHVGYQEVSTEDSNNVAQSYTFKSVEVRPHYGGEAVLQGLSKYTTYGIIVQ 486

Query: 242 GYNSVGKGPFSEPFIARTNE 261
            YNS G GP S+P  ART E
Sbjct: 487 AYNSRGSGPASDPVTARTLE 506




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189238865|ref|XP_972891.2| PREDICTED: similar to AGAP007092-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008252|ref|XP_002424921.1| down syndrome cell adhesion molecule, putative [Pediculus humanus corporis] gi|212508527|gb|EEB12183.1| down syndrome cell adhesion molecule, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357626167|gb|EHJ76353.1| hypothetical protein KGM_10570 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328711870|ref|XP_003244665.1| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328711868|ref|XP_001951010.2| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170027744|ref|XP_001841757.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] gi|167862327|gb|EDS25710.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|442630978|ref|NP_001261571.1| down syndrome cell adhesion molecule 4, isoform I [Drosophila melanogaster] gi|442630980|ref|NP_001261572.1| down syndrome cell adhesion molecule 4, isoform J [Drosophila melanogaster] gi|440215478|gb|AGB94266.1| down syndrome cell adhesion molecule 4, isoform I [Drosophila melanogaster] gi|440215479|gb|AGB94267.1| down syndrome cell adhesion molecule 4, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194865958|ref|XP_001971688.1| GG14294 [Drosophila erecta] gi|190653471|gb|EDV50714.1| GG14294 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195491267|ref|XP_002093489.1| GE20723 [Drosophila yakuba] gi|194179590|gb|EDW93201.1| GE20723 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.937 0.133 0.431 6.2e-54
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.934 0.125 0.388 2e-49
FB|FBgn0261046 2046 Dscam3 "Down syndrome cell adh 0.534 0.071 0.346 6e-35
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.919 0.125 0.340 4.1e-34
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.919 0.124 0.325 3.7e-33
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.919 0.124 0.321 1.3e-32
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.919 0.124 0.321 1.3e-32
UNIPROTKB|Q8TD84 2053 DSCAML1 "Down syndrome cell ad 0.915 0.121 0.346 1.9e-31
MGI|MGI:2150309 2053 Dscaml1 "Down syndrome cell ad 0.915 0.121 0.346 1.9e-31
UNIPROTKB|F1N4K6 1886 DSCAML1 "Uncharacterized prote 0.915 0.132 0.346 2.2e-31
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 572 (206.4 bits), Expect = 6.2e-54, P = 6.2e-54
 Identities = 116/269 (43%), Positives = 166/269 (61%)

Query:     3 SRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNI 62
             SRYTIR+QVL+DGM+SELGI++  RQD+G   C A+N  G  EM+IQL+VQE PE PKN+
Sbjct:   853 SRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNL 912

Query:    63 RITEESSRSLQISWTAPYSGNTAITQYIIQYK------SSEEMWPTQPLKIIVPGSQTSA 116
             RI  + SRSLQ++W+ P++GN+ I +Y I YK      S  ++W      + + G+QT  
Sbjct:   913 RINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDFFSPSDIWQNAE-HLTIAGAQTVI 971

Query:   117 TLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLI 176
              +Q L PA  Y +R+ AEN LG SE    +Q +TLEE P+G P  V ++P     TE+ +
Sbjct:   972 NIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPK--SSTEIFV 1029

Query:   177 KWKAPPRESWNGVLLGYDVGYQIXXXXXXX----XXXYTLKSVELDNQYEGELRIPGLTP 232
              W AP R+ WNG+LLGY VGYQ+              ++ K+VE+ + + GE  +  L  
Sbjct:  1030 TWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNK 1089

Query:   233 YTKYAIVVRGYNSVGKGPFSEPFIARTNE 261
             +T+Y ++V+ Y S G GP S+    +T E
Sbjct:  1090 FTQYHVIVQAYTSQGSGPPSKEIAVQTME 1118


GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0007155 "cell adhesion" evidence=ISS
GO:0042802 "identical protein binding" evidence=ISS
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0261046 Dscam3 "Down syndrome cell adhesion molecule 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TD84 DSCAML1 "Down syndrome cell adhesion molecule-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2150309 Dscaml1 "Down syndrome cell adhesion molecule like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K6 DSCAML1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 3e-17
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-15
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-15
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 9e-11
pfam0004184 pfam00041, fn3, Fibronectin type III domain 4e-08
cd0573588 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma 6e-08
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-07
smart0041085 smart00410, IG_like, Immunoglobulin like 5e-05
smart0040985 smart00409, IG, Immunoglobulin 5e-05
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-04
cd0575898 cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (I 0.001
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 74.5 bits (183), Expect = 3e-17
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 56  PEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTS 115
           P  P N+R+T+ +S S+ +SWT P      IT Y+++Y+        +      PGS+TS
Sbjct: 1   PSPPTNLRVTDVTSTSVTLSWTPPEDDGGPITGYVVEYREKGSGDWKEVEV--TPGSETS 58

Query: 116 ATLQPLLPATQYQVRLLAENPLGMSETGAELQAST 150
            TL  L P T+Y+ R+ A N  G S     +  +T
Sbjct: 59  YTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143235 cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 273
KOG4221|consensus 1381 99.97
KOG3513|consensus 1051 99.96
KOG3513|consensus 1051 99.93
KOG4221|consensus 1381 99.93
KOG0196|consensus 996 99.9
KOG4222|consensus 1281 99.74
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.45
KOG0196|consensus 996 99.43
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.31
KOG4258|consensus1025 99.07
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.96
KOG4802|consensus 516 98.9
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 98.88
KOG4222|consensus 1281 98.84
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.7
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 98.67
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 98.51
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.46
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.4
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.36
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.36
KOG4258|consensus 1025 98.34
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.33
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.28
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.26
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 98.19
KOG4367|consensus 699 98.17
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 98.15
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 98.14
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 98.14
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 98.11
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 98.1
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 98.07
KOG4152|consensus830 98.06
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 98.04
KOG3632|consensus 1335 98.04
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 98.02
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 98.01
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 97.96
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 97.92
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 97.91
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.89
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 97.89
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 97.88
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 97.88
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 97.87
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 97.87
KOG4802|consensus516 97.85
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 97.85
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 97.84
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 97.84
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 97.82
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 97.81
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 97.8
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 97.78
PHA02826227 IL-1 receptor-like protein; Provisional 97.77
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 97.77
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 97.77
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 97.77
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 97.76
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 97.72
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.7
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 97.7
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 97.68
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.67
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 97.67
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 97.67
KOG4194|consensus873 97.64
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.64
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 97.64
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.63
PHA02785326 IL-beta-binding protein; Provisional 97.63
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 97.63
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 97.62
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 97.62
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 97.62
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 97.61
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 97.61
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 97.6
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 97.6
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 97.55
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 97.55
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 97.55
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 97.55
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 97.53
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.5
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 97.49
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 97.48
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 97.46
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 97.45
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 97.45
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 97.43
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 97.4
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 97.32
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 97.3
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 97.29
COG4733 952 Phage-related protein, tail component [Function un 97.19
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.12
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 97.11
KOG4194|consensus873 97.03
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.02
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 97.01
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 97.01
KOG4367|consensus699 96.99
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 96.94
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 96.92
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 96.9
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.89
PHA02785326 IL-beta-binding protein; Provisional 96.89
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 96.88
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 96.85
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 96.83
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 96.82
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 96.81
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 96.8
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 96.78
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 96.78
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 96.77
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 96.75
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 96.73
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 96.72
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 96.68
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 96.68
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 96.67
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 96.66
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 96.65
COG3401343 Fibronectin type 3 domain-containing protein [Gene 96.65
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 96.62
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 96.59
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 96.56
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 96.53
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 96.5
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 96.45
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 96.44
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 96.42
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 96.39
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 96.36
PLN02533 427 probable purple acid phosphatase 96.15
COG3401343 Fibronectin type 3 domain-containing protein [Gene 96.12
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 96.12
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 96.08
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 96.06
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 96.0
smart0040863 IGc2 Immunoglobulin C-2 Type. 95.92
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 95.9
smart0041086 IG_like Immunoglobulin like. IG domains that canno 95.89
smart0040986 IG Immunoglobulin. 95.89
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 95.89
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 95.78
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 95.75
KOG4806|consensus454 95.74
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 95.69
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 95.63
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 95.62
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 95.53
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 95.51
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 95.33
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 95.26
KOG3632|consensus 1335 95.14
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 95.04
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 95.01
KOG4228|consensus 1087 95.0
PHA03376221 BARF1; Provisional 94.83
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.79
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 94.45
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 94.4
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 94.38
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 94.14
PF0004764 ig: Immunoglobulin domain The Prosite family only 93.98
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 93.71
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 93.69
smart0040681 IGv Immunoglobulin V-Type. 93.67
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 93.59
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 93.58
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 93.53
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 93.43
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 93.4
KOG4152|consensus 830 93.35
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 93.11
KOG0613|consensus 1205 92.75
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 92.3
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 92.27
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 91.97
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 91.94
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 91.87
PHA0263363 hypothetical protein; Provisional 91.3
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 90.74
PLN02533 427 probable purple acid phosphatase 90.61
PHA02987189 Ig domain OX-2-like protein; Provisional 90.25
KOG4806|consensus454 89.89
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 89.44
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 89.03
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 88.8
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 87.9
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 87.47
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 86.38
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 86.13
KOG3515|consensus741 85.57
KOG1948|consensus1165 85.38
PF1375454 Big_3_4: Bacterial Ig-like domain (group 3) 85.25
KOG3515|consensus741 84.94
PHA02982251 hypothetical protein; Provisional 84.92
KOG1378|consensus 452 84.72
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 84.38
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 84.24
KOG1225|consensus525 83.44
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 83.42
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 83.41
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 82.99
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 82.96
COG4733952 Phage-related protein, tail component [Function un 82.82
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 81.58
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 81.14
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 80.61
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 80.45
>KOG4221|consensus Back     alignment and domain information
Probab=99.97  E-value=9.9e-30  Score=213.17  Aligned_cols=231  Identities=26%  Similarity=0.416  Sum_probs=202.3

Q ss_pred             EEEEEeeeeeCCCEEEEEEEEcCCCCceeEEEEEEecCCCCCcceEEEEeeccEEEEEEeCCCCCCccceEEEEEEEeCC
Q psy6638          18 SELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSE   97 (273)
Q Consensus        18 ~~l~i~~~~~~~~~~y~~~a~n~~g~~~~~~~~~~~~~P~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~y~v~~~~~~   97 (273)
                      .+..+.++.+..-|.|+|.|.|..|+..++..+.|..+|..|..+.........+.+.|.+|.-+++++.+|.+.+...+
T Consensus       483 ~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pLkV~t~pEgp~~~~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~~  562 (1381)
T KOG4221|consen  483 IQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPLKVTTQPEGPVQLQAYATSPTTILVTWEPPPFGNGPITGYKLFYSEDD  562 (1381)
T ss_pred             eEEEeeecccceeEEEEEeccCcccCCccCCceEEecCCCCCccccccccCcceEEEEecCCCCCCCCceEEEEEEEcCC
Confidence            67889999999999999999999999999999999999987766777788889999999999888999999999999873


Q ss_pred             CCCCCccceEEecCCccEEEecCCCCCCeEEEEEEEeCCCCCCCCCcceEEEecCCCCCCCCeeEEecCCccCCceEEEE
Q psy6638          98 EMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIK  177 (273)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~y~~~v~a~~~~g~~~~s~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~i~l~  177 (273)
                      ..     ....+..+.+.++|.+|++.+.|.|+|.|.|..|.|..+..+.+.+..+.|..||.++++..  .++++|.|+
T Consensus       563 ~~-----~~~~~~~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev--~sStsVrVs  635 (1381)
T KOG4221|consen  563 TG-----KELRVENNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEV--VSSTSVRVS  635 (1381)
T ss_pred             CC-----ceEEEecCccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEe--cCCCeEEEE
Confidence            21     22355567789999999999999999999999999999999999999999999999999998  899999999


Q ss_pred             EeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEEEcCCCCccceEEEEEEEecCCCcCCCCccEEE
Q psy6638         178 WKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIA  257 (273)
Q Consensus       178 W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~g~~~~s~~~~~  257 (273)
                      |.+|.....+|.+.+|+|+|+....+..       ............+.+.+|+|++.|.|+|.|.+..|.|++|++..+
T Consensus       636 W~pP~~~t~ng~itgYkIRy~~~~~~~~-------~~~t~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~a  708 (1381)
T KOG4221|consen  636 WLPPPSETQNGQITGYKIRYRKLSREDE-------VNETVVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSA  708 (1381)
T ss_pred             ccCCCcccccceEEEEEEEecccCcccc-------cceeecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceec
Confidence            9999998889999999999997654321       111223334678899999999999999999999999999999999


Q ss_pred             EcCCC
Q psy6638         258 RTNEG  262 (273)
Q Consensus       258 ~t~~~  262 (273)
                      .|+..
T Consensus       709 eT~~~  713 (1381)
T KOG4221|consen  709 ETPES  713 (1381)
T ss_pred             cCccc
Confidence            99754



>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>PF13754 Big_3_4: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>KOG1378|consensus Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 1e-11
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 2e-08
3tes_A98 Crystal Structure Of Tencon Length = 98 3e-08
1wf5_A121 Solution Structure Of The First Fn3 Domain Of Sidek 3e-08
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 2e-07
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 2e-07
1uey_A127 Solution Structure Of The First Fibronectin Type Ii 6e-07
3l5h_A 589 Crystal Structure Of The Full Ectodomain Of Human G 8e-07
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 2e-06
2yux_A120 Solution Structure Of 3rd Fibronectin Type Three Do 2e-06
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 4e-06
1x5z_A115 Solution Structure Of The Fibronectin Type-Iii Doma 1e-05
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 4e-05
1mfn_A184 Solution Nmr Structure Of Linked Cell Attachment Mo 7e-05
3teu_A98 Crystal Structure Of Fibcon Length = 98 9e-05
1bqu_A215 Cytokyne-Binding Region Of Gp130 Length = 215 1e-04
3mtr_A215 Crystal Structure Of The Ig5-Fn1 Tandem Of Human Nc 2e-04
2dju_A106 Solution Structures Of The Fn3 Domain Of Human Rece 7e-04
1uen_A125 Solution Structure Of The Third Fibronectin Iii Dom 9e-04
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/119 (31%), Positives = 67/119 (56%), Gaps = 7/119 (5%) Query: 25 VLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYS-GN 83 V R+D+G A N G + T++L V + P+ P+ +++++ S S+ ++WT P S G Sbjct: 168 VERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGG 227 Query: 84 TAITQYIIQY-KSSEEMWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSE 141 + IT YI++ ++ E W L+ + +T T+ L T YQ R++AEN G+S+ Sbjct: 228 SKITNYIVEKCATTAERW----LR-VGQARETRYTVINLFGKTSYQFRVIAENKFGLSK 281
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure
>pdb|3TES|A Chain A, Crystal Structure Of Tencon Length = 98 Back     alignment and structure
>pdb|1WF5|A Chain A, Solution Structure Of The First Fn3 Domain Of Sidekick-2 Protein Length = 121 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 Back     alignment and structure
>pdb|3L5H|A Chain A, Crystal Structure Of The Full Ectodomain Of Human Gp130: New Insights Into The Molecular Assembly Of Receptor Complexes Length = 589 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|1X5Z|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Protein Tyrosine Phosphatase, Receptor Type, D Isoform 4 Variant Length = 115 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|1MFN|A Chain A, Solution Nmr Structure Of Linked Cell Attachment Modules Of Mouse Fibronectin Containing The Rgd And Synergy Regions, 20 Structures Length = 184 Back     alignment and structure
>pdb|3TEU|A Chain A, Crystal Structure Of Fibcon Length = 98 Back     alignment and structure
>pdb|1BQU|A Chain A, Cytokyne-Binding Region Of Gp130 Length = 215 Back     alignment and structure
>pdb|3MTR|A Chain A, Crystal Structure Of The Ig5-Fn1 Tandem Of Human Ncam Length = 215 Back     alignment and structure
>pdb|2DJU|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 106 Back     alignment and structure
>pdb|1UEN|A Chain A, Solution Structure Of The Third Fibronectin Iii Domain Of Human Kiaa0343 Protein Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-56
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 9e-20
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-54
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-50
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-35
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-29
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-05
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-45
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-17
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 9e-43
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-42
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-16
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-05
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-41
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-18
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-17
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-40
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-28
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-26
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-38
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 5e-22
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-20
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-07
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-38
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-09
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-37
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-15
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-13
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 5e-36
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 5e-18
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-34
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-11
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-33
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-27
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-10
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-32
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-31
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-30
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 4e-32
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-29
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-29
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-32
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-27
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 3e-09
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-30
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-16
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-06
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-30
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-30
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-23
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-14
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 8e-30
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-29
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 5e-15
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-29
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-04
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-28
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-18
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-28
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 8e-14
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 6e-28
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-12
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-27
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 4e-14
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-27
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-16
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-27
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-12
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 3e-27
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 8e-15
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-26
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-18
1x3d_A118 Fibronectin type-III domain containing protein 3A; 4e-26
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-05
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-26
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-14
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-05
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-25
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-15
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 5e-08
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-25
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 4e-10
1x4x_A106 Fibronectin type-III domain containing protein 3A; 6e-25
1x4x_A106 Fibronectin type-III domain containing protein 3A; 6e-09
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-24
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 8e-04
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 3e-24
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-18
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-24
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 6e-15
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-23
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-23
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-15
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 4e-23
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-16
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-23
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-09
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-23
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-16
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 2e-22
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 4e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 5e-22
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-04
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 5e-22
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-13
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 8e-22
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 6e-20
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-21
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-18
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-18
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-11
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-08
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 1e-20
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 4e-08
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-20
2crm_A120 Fibronectin type-III domain containing protein 3A; 1e-07
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-20
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 4e-20
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-20
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 6e-20
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 7e-07
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 7e-20
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-19
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-19
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-19
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-18
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-19
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 1e-05
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-19
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-05
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-19
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 7e-07
3k2m_C101 Monobody HA4; engineered binding protein, antibody 6e-19
3k2m_C101 Monobody HA4; engineered binding protein, antibody 8e-08
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 6e-19
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 7e-07
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 8e-19
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-16
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-18
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-05
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-18
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-17
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-18
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 3e-18
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-05
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 3e-18
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-04
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 5e-18
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 5e-18
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 9e-07
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 5e-18
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 5e-18
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-17
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 5e-18
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 6e-05
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 6e-18
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 6e-16
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 7e-18
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 8e-18
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 5e-15
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 9e-18
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 9e-16
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-17
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-16
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-17
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-08
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 1e-17
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-17
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-16
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-17
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 3e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-17
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-05
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-17
2crz_A110 Fibronectin type-III domain containing protein 3A; 6e-17
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-06
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 7e-17
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 8e-17
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 5e-09
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 9e-17
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-07
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-16
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 2e-04
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-16
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 4e-16
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-16
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-04
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 6e-16
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 8e-13
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 8e-16
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-09
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 8e-16
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-12
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-15
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 8e-08
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-15
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 6e-06
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 6e-15
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 9e-14
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 9e-15
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-14
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-14
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 3e-14
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 5e-14
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 6e-14
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 6e-14
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-04
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 8e-14
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-13
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-13
2gys_A419 Cytokine receptor common beta chain; dimer of inte 4e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-05
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-13
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 8e-08
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-12
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-10
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 6e-04
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 9e-12
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-10
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-07
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-06
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 1e-11
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-11
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-09
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-07
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 3e-11
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-05
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 3e-11
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-11
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-10
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 4e-11
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-08
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 6e-11
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-10
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-06
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 2e-10
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 5e-10
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 3e-06
2erj_C247 Cytokine receptor common gamma chain; immune syste 5e-10
2erj_C247 Cytokine receptor common gamma chain; immune syste 8e-08
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-10
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-09
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 8e-08
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-09
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 4e-07
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 1e-09
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-09
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 5e-09
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-05
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 5e-09
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-06
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 1e-08
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-08
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-08
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-08
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-06
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 1e-08
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-08
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 4e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 4e-08
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 5e-08
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 5e-08
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-08
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-08
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 3e-05
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-04
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 6e-08
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 7e-08
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-07
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-07
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-06
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 9e-06
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-07
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 1e-04
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-07
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-07
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 2e-07
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-07
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-07
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-07
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-07
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-05
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 4e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-04
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 3e-07
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 4e-07
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 4e-07
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 4e-07
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 5e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 6e-07
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 6e-07
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 7e-07
1wwb_X103 Protein (brain derived neurotrophic factor recepto 7e-07
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 8e-07
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-04
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 9e-04
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 8e-07
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 9e-07
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-06
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 7e-05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-06
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 3e-05
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-06
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-06
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-06
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-06
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-04
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 2e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-06
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-06
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-06
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-06
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-05
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-04
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 7e-05
3s35_X122 Vascular endothelial growth factor receptor 2; ant 3e-06
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 3e-06
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 7e-06
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 3e-06
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-04
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-06
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-05
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 4e-06
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 4e-06
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-06
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-05
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-06
1oww_A98 FN, fibronectin first type III module, CIG; fibron 5e-06
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 6e-06
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 6e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 7e-06
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 7e-06
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-05
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 8e-06
1he7_A126 High affinity nerve growth factor receptor; transf 9e-06
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-05
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-05
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-05
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 1e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 8e-04
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 1e-05
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-05
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-05
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 6e-05
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-05
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-05
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-05
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-05
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 7e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-05
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-05
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-05
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 3e-05
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-04
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-05
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-04
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-04
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 3e-05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 5e-05
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-05
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 5e-04
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 4e-05
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-04
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-05
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-05
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-05
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 3e-04
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 4e-05
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 9e-05
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 5e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-04
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-04
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 1e-04
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-04
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-04
1waa_A93 Titin; metal binding protein, calmodulin-binding, 2e-04
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 2e-04
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-04
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-04
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-04
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-04
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 3e-04
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-04
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 3e-04
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-04
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-04
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 5e-04
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 5e-04
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 6e-04
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 7e-04
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 7e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 7e-04
3mjg_X289 Beta-type platelet-derived growth factor receptor; 8e-04
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 8e-04
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 9e-04
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
 Score =  185 bits (470), Expect = 2e-56
 Identities = 49/258 (18%), Positives = 85/258 (32%), Gaps = 16/258 (6%)

Query: 3   SRYTIREQVLEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNI 62
           ++ T   +    G    L IA     D G  +C ATN+ GT      L + + P +P  +
Sbjct: 143 AKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGV 202

Query: 63  RITEESSRSLQISWTAP-YSGNTAITQYIIQYKSSEEMWPTQPLKIIVPGSQTSATLQPL 121
           +I E S  + ++S+  P   G   I  Y +  K   E+       +   G QT   L  L
Sbjct: 203 KIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVK---EVASEIWKIVRSHGVQTMVVLNNL 259

Query: 122 LPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAP 181
            P T Y++R+ A N  G  +        TL       P                +     
Sbjct: 260 EPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQP---SSGKSFKLSIT-- 314

Query: 182 PRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVR 241
            ++     +L Y V Y+                 ++    +  + +  L     Y + + 
Sbjct: 315 KQDDGGAPILEYIVKYRSKDKED------QWLEKKVQGN-KDHIILEHLQWTMGYEVQIT 367

Query: 242 GYNSVGKGPFSEPFIART 259
             N +G    +    +  
Sbjct: 368 AANRLGYSEPTVYEFSMP 385


>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Length = 120 Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Length = 120 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Length = 229 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 100.0
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.97
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.97
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.97
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.96
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.96
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.96
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.96
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.95
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.95
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.95
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.95
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.95
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.95
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.94
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.94
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.94
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.94
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.94
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.93
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.93
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.93
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.93
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.93
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.93
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.92
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.92
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.92
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.91
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.91
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.91
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.9
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.89
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.89
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.88
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.88
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.87
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.87
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.87
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.86
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.86
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.86
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.85
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.84
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.84
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.83
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.83
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.82
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.81
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.8
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.8
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.79
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.79
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.79
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.79
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.78
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.78
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.78
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.77
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.77
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.77
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.76
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.76
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.75
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.75
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.74
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.74
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.74
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.74
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.74
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.74
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.73
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.73
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.72
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.72
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.72
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.71
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.71
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.7
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.7
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.7
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.7
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.69
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.69
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.69
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.69
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.69
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.69
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.68
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.68
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.68
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.68
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.68
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.67
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.67
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.67
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.66
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.66
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.66
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.66
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.66
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.66
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.66
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.65
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.65
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.64
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.64
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.64
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.63
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.63
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.63
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.63
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.63
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.62
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.62
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.62
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.61
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.61
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.61
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.61
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.6
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.6
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.6
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.59
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.59
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.59
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.59
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.59
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.59
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.59
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.58
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.58
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.58
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.58
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.58
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.58
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.58
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.58
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.58
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.57
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.57
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.57
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.57
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.57
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.56
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.56
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.56
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.56
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.56
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.55
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.55
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.55
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.54
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.54
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.54
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.54
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.54
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.53
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.53
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.53
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.52
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.52
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.52
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.51
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.51
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.51
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.51
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.5
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.5
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.5
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.5
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.5
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.5
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.5
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.49
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.49
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.49
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.48
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.48
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.48
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.47
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.47
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.46
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.46
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.46
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.46
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.46
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.45
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.45
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.44
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.44
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.44
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.44
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.44
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.44
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.44
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.44
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.43
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.43
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.43
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.43
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.43
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.42
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.42
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.42
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.42
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.4
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.4
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.4
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.4
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.4
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.39
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.39
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.39
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.39
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.38
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 99.37
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.36
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.36
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.35
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.35
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.35
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.34
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.33
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.32
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 99.32
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.31
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.31
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.3
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.29
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.28
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.27
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.26
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.25
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.24
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.22
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.22
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.21
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.21
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.21
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.21
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.2
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.2
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.19
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.19
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 99.19
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 99.15
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.15
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.13
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.12
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.11
1oww_A98 FN, fibronectin first type III module, CIG; fibron 99.11
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.11
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.11
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.06
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.05
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 99.04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 99.01
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.96
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.94
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.91
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.91
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.88
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.84
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 98.84
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.81
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.79
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.73
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 98.71
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.71
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 98.71
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 98.65
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 98.65
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.63
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.62
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.58
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.51
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.5
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 98.48
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 98.43
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.42
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 98.4
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.38
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 98.37
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 98.35
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.33
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 98.3
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 98.28
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 98.28
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 98.27
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 98.25
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.25
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 98.23
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.22
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.21
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 98.2
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 98.18
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 98.18
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 98.17
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 98.17
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 98.15
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 98.14
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.13
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 98.11
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 98.11
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 98.11
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 98.11
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 98.11
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 98.1
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 98.1
1wwb_X103 Protein (brain derived neurotrophic factor recepto 98.08
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 98.07
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 98.07
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 98.05
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 98.03
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 98.03
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 98.03
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 98.02
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 98.0
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 98.0
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 98.0
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 97.99
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 97.99
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 97.98
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 97.98
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 97.97
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 97.97
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 97.97
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 97.97
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 97.96
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 97.96
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 97.96
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 97.93
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 97.92
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 97.91
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 97.9
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 97.9
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 97.89
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 97.89
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 97.88
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 97.88
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 97.87
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 97.87
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 97.86
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 97.86
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.85
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 97.84
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 97.84
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 97.83
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 97.83
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 97.83
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 97.83
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 97.82
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 97.81
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 97.81
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 97.8
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 97.78
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 97.78
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 97.78
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 97.78
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 97.77
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 97.76
1he7_A126 High affinity nerve growth factor receptor; transf 97.76
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 97.75
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 97.75
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 97.75
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 97.74
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 97.74
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 97.73
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 97.73
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 97.73
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 97.73
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 97.73
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 97.72
2fbo_J250 V1V2;, variable region-containing chitin-binding p 97.72
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 97.72
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 97.71
3s35_X122 Vascular endothelial growth factor receptor 2; ant 97.71
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 97.71
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 97.71
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 97.71
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 97.7
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 97.7
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 97.69
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.69
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 97.69
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 97.68
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 97.68
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 97.68
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 97.68
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 97.67
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 97.65
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 97.64
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 97.64
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 97.64
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 97.63
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 97.63
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 97.61
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 97.61
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 97.61
3mjg_X289 Beta-type platelet-derived growth factor receptor; 97.61
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 97.61
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 97.59
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 97.58
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 97.58
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 97.58
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 97.58
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 97.58
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 97.57
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 97.52
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 97.51
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 97.5
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 97.5
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 97.49
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 97.48
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.48
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 97.47
1nqb_A256 Single-chain antibody fragment; multivalent antibo 97.47
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 97.46
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 97.46
1zox_A113 CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I 97.44
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 97.43
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 97.42
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 97.41
1waa_A93 Titin; metal binding protein, calmodulin-binding, 97.41
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 97.41
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.4
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 97.4
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 97.39
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 97.39
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 97.38
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 97.38
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 97.37
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 97.36
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 97.36
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 97.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.33
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 97.33
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 97.33
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 97.33
1gl4_B98 Basement membrane-specific heparan sulfate proteog 97.33
2nms_A124 CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 97.33
3rrq_A129 Protein PD-1, programmed cell death protein 1; pro 97.33
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 97.32
3umt_A256 SCFV heavy chain and light chain; stability engine 97.32
3ux9_B256 SCFV antibody; five helices, long loop connecting 97.32
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 97.31
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 97.31
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 97.31
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 97.3
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 97.3
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 97.3
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 97.29
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 97.29
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 97.27
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.27
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 97.26
3khq_A133 B-cell antigen receptor complex-associated protei 97.26
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 97.26
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 97.24
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 97.24
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 97.24
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 97.23
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 97.22
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 97.21
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 97.21
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 97.2
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 97.16
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 97.16
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 97.15
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 97.14
4gos_A125 V-SET domain-containing T-cell activation inhibit; 97.14
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 97.13
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 97.12
2q87_A110 CMRF35-H antigen; all-beta, immunoglobulin, IG-sup 97.12
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 97.11
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 97.11
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 97.11
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 97.11
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 97.1
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 97.1
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 97.09
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 97.06
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 97.05
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 97.04
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 97.04
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 97.04
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 97.03
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 97.01
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 96.99
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 96.99
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 96.99
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 96.99
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 96.98
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 96.96
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 96.95
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 96.92
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 96.92
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
Probab=100.00  E-value=1.7e-30  Score=208.28  Aligned_cols=234  Identities=21%  Similarity=0.273  Sum_probs=185.6

Q ss_pred             ecCCcEEEEEEeeeeeCCCEEEEEEEEcCCCCceeEEEEEEecCCCCCcceEEEEeeccEEEEEEeCCCC-CCccceEEE
Q psy6638          12 LEDGMISELGIANVLRQDSGTLSCLATNYHGTAEMTIQLLVQETPEAPKNIRITEESSRSLQISWTAPYS-GNTAITQYI   90 (273)
Q Consensus        12 ~~~~~~~~l~i~~~~~~~~~~y~~~a~n~~g~~~~~~~~~~~~~P~~p~~~~~~~~~~~~~~l~W~~~~~-~~~~~~~y~   90 (273)
                      ..++....|.|.++.+.|.|.|+|.|.|..|.....+.+.+..+|.+|..+.+.......+.|.|.++.. ++.++..|.
T Consensus       152 ~~~~~~~~L~i~~~~~~d~G~Y~C~a~N~~G~~~~~~~l~v~~~P~~P~~~~~~~~~~~~~~l~w~~p~~~~g~pi~~y~  231 (389)
T 2jll_A          152 YSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQ  231 (389)
T ss_dssp             EECSSCEEEEECCCSTTSSEEEEEEEEETTEEEEEEEEEEECCCCCCCEEEEEEEECSSCEEEEEECCSCCTTSCEEEEE
T ss_pred             eccCCEEEEEECCCChhhCEEEEEEEEcCCCcEEEEEEEEecCCCCCCcceEEeeccCCEEEEEEeCCCCCCCcceEEEE
Confidence            3455667899999999999999999999999988888888889999998888888888999999997753 445788999


Q ss_pred             EEEEeCCC-CCCCccceEEecCCccEEEecCCCCCCeEEEEEEEeCCCCCCCCCcceEEEecCCCCCCCCeeEEecCCcc
Q psy6638          91 IQYKSSEE-MWPTQPLKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEEAPNGAPREVTSDPGVV  169 (273)
Q Consensus        91 v~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~y~~~v~a~~~~g~~~~s~~~~~~~~~~~p~~~p~~~~~~~~~~  169 (273)
                      ++|+..+. .|.    ..........+.|.+|.+++.|.|+|.|.|..|.+.++....+.+....|+.+|. +....  .
T Consensus       232 v~~~~~~~~~~~----~~~~~~~~~~~~i~~l~~~~~y~~~v~A~N~~G~~~~s~~~~~~t~~~~~p~~p~-~~~~~--~  304 (389)
T 2jll_A          232 VDVKEVASEIWK----IVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPS-IHGQP--S  304 (389)
T ss_dssp             EEEEETTCSCCE----EEECSTTCSEEEECSCCTTCEEEEEEEEEESSCBCCCCCCEEEECCCCCCCCCCC-EEEEE--E
T ss_pred             EEEEECCCcccE----EeeccCCcceEEECCccCCCEEEEEEEEEcCCccCCCCcceEEEecCCCCCCCCc-ccccc--C
Confidence            99998654 443    2233345578999999999999999999999999998888888887776766774 55555  6


Q ss_pred             CCceEEEEEeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEEEcCCCCccceEEEEEEEecCCCcC
Q psy6638         170 DPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGELRIPGLTPYTKYAIVVRGYNSVGKG  249 (273)
Q Consensus       170 ~~~~i~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~g~~  249 (273)
                      +.+++.|+|+++.+  .++.+.+|.|+|+..+...+       ............++|.+|.+++.|.|+|+|.|..|.|
T Consensus       305 ~~~~v~l~W~~p~~--~~~~i~~Y~v~~~~~~~~~~-------~~~~~~~~~~~~~~i~~L~~~t~Y~~~V~A~n~~G~s  375 (389)
T 2jll_A          305 SGKSFKLSITKQDD--GGAPILEYIVKYRSKDKEDQ-------WLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYS  375 (389)
T ss_dssp             TTTEEEEEECCCCC--CSSCCCEEEEEEEC-----C-------CBCCEECTTCCEEEECSCCTTCEEEEEEEEEC-CCBC
T ss_pred             cCCEEEEEEECCCC--CCCcccEEEEEEEeCCCCcc-------eeEeeccCCcceEEeCCcCCCCEEEEEEEEEcCCcCC
Confidence            88999999999865  47789999999998544321       1111123345789999999999999999999999999


Q ss_pred             CCCccEEEEcCCC
Q psy6638         250 PFSEPFIARTNEG  262 (273)
Q Consensus       250 ~~s~~~~~~t~~~  262 (273)
                      ++|. +.++|.+.
T Consensus       376 ~~s~-~~~~T~~~  387 (389)
T 2jll_A          376 EPTV-YEFSMPPK  387 (389)
T ss_dssp             CCEE-EEEECCCC
T ss_pred             Ccee-eEecCCCC
Confidence            9885 57777654



>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} Back     alignment and structure
>3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 273
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-18
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-06
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 4e-17
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 7e-17
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-13
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 9e-17
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-14
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-16
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-12
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-16
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-11
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 1e-15
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 1e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-15
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 9e-06
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-14
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-14
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-08
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 2e-14
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 9e-11
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 1e-13
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 3e-12
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 1e-13
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-05
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-13
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-13
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 3e-04
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 6e-13
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-06
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 8e-08
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-12
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 7e-11
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 1e-12
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-12
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.001
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-12
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 4e-12
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 7e-12
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-05
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 1e-11
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-04
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-11
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 3e-11
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 4e-11
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 4e-11
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 5e-04
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-11
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 5e-11
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 5e-11
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 6e-11
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 1e-10
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 8e-08
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 2e-10
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-10
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 3e-10
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 3e-10
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 4e-10
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 7e-06
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 5e-10
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 5e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 6e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 5e-06
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 7e-10
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 6e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 9e-10
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 9e-10
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1e-09
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 1e-09
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 0.001
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-09
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-04
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-09
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-07
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-09
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-08
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 3e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 3e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 4e-09
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-09
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 8e-09
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 9e-09
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-04
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 2e-08
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 2e-08
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 6e-08
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 0.002
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 8e-08
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 0.001
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 1e-07
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-07
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 4e-04
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-07
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 2e-07
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 0.001
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 2e-07
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 5e-07
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 7e-07
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 7e-07
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-06
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 1e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 1e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-06
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-06
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 2e-06
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.004
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-06
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 3e-06
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-06
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 8e-06
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 8e-06
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 1e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 2e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 0.004
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 3e-05
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 5e-05
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 6e-05
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 6e-05
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 6e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 7e-05
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 1e-04
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 2e-04
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 2e-04
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-04
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 5e-04
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 6e-04
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 6e-04
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 6e-04
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 8e-04
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 9e-04
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 9e-04
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 0.001
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 0.001
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 0.001
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 0.004
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 76.0 bits (186), Expect = 3e-18
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 47  TIQLLVQETPEAPKN--IRITEESSRSLQISWTAPYSGNTAITQYIIQYKSSEEMWPTQP 104
           +  L V++ P AP++    ++    R++ ++WT P+ GN+ + +YI++   +   W    
Sbjct: 2   SAHLRVRQLPHAPEHPVATLSTVERRAINLTWTKPFDGNSPLIRYILEMSENNAPWTVLL 61

Query: 105 LKIIVPGSQTSATLQPLLPATQYQVRLLAENPLGMSETGAELQASTLEE 153
               V    TS T++ L+PA  YQ RL A N +G  +   + +  +L E
Sbjct: 62  --ASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDTERVSLPE 108


>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.76
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.76
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.76
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.74
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.73
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.73
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.72
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.71
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.7
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.69
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.69
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.69
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.69
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.69
d2crza197 Fibronectin type-III domain containing protein 3a, 99.67
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.67
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.67
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.67
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.66
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.66
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.65
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.64
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.64
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.63
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.63
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.62
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.62
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.62
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.62
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.61
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.61
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.61
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.6
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.6
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.6
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.6
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.59
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.59
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.58
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.58
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.57
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.57
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.57
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.57
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.57
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.56
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.56
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.56
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.56
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.56
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.55
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.55
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.54
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2crza197 Fibronectin type-III domain containing protein 3a, 99.53
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.53
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.53
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.52
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.52
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.51
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.51
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.51
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.51
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.5
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.5
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.49
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.49
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.49
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.48
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.48
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.48
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.48
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.48
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.47
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.47
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.46
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.46
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.46
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.46
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.46
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.45
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.45
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.45
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.44
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.44
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.43
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.43
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.42
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.42
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.41
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.4
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.4
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.39
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.39
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.39
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.39
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.38
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.37
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.37
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.35
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.34
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.33
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.33
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.32
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.32
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.32
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.32
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.31
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.31
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.31
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.3
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.3
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.29
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.29
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.27
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.26
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.26
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.26
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.25
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.25
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.24
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.21
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.2
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.15
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.14
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.12
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.09
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.07
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 99.06
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.04
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.03
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.96
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.85
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 98.53
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.51
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 98.25
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 98.21
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 98.13
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.1
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 98.04
d1gxea_130 Cardiac myosin binding protein C, different domain 98.04
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 97.95
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.94
d2avga1110 Cardiac myosin binding protein C, different domain 97.93
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.92
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 97.92
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 97.9
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 97.9
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 97.87
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 97.8
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 97.78
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 97.77
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.74
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 97.73
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.72
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.71
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.7
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.69
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 97.63
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 97.62
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.62
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 97.58
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.56
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.5
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 97.5
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 97.38
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.38
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 97.25
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.23
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 97.23
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 97.21
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.21
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.2
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 97.2
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 97.17
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 97.13
d2ifga192 High affinity nerve growth factor receptor TrkA, d 97.1
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 97.1
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 97.08
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.03
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 97.02
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.0
d2c4fu1116 Extracellular region of human tissue factor {Human 96.99
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 96.97
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 96.97
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 96.96
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.94
d2hfta1106 Extracellular region of human tissue factor {Human 96.9
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.87
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 96.84
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.83
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 96.8
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.8
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.78
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 96.78
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 96.77
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.76
d1pd6a_94 Cardiac myosin binding protein C, different domain 96.58
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.43
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.27
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 96.22
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.13
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 96.1
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 96.09
d2hfta1106 Extracellular region of human tissue factor {Human 96.06
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 95.94
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 95.75
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 95.65
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 95.36
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 95.09
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 94.95
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 94.9
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 94.56
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 94.52
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 94.31
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 94.16
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 93.96
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 93.63
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 93.58
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 93.29
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 93.24
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 93.14
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 92.99
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 92.84
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 92.71
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 92.68
d2rhea_114 Immunoglobulin light chain lambda variable domain, 92.53
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 92.49
d2c4fu1116 Extracellular region of human tissue factor {Human 92.38
d1op3k1106 Immunoglobulin light chain kappa variable domain, 92.23
d1lgva1112 Immunoglobulin light chain lambda variable domain, 92.23
d1oaql_110 Immunoglobulin light chain lambda variable domain, 92.14
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 92.08
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 92.05
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 91.99
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 91.9
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 91.68
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 91.35
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 91.0
d1ospl1107 Immunoglobulin light chain kappa variable domain, 90.95
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 90.93
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 90.71
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 90.7
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 90.63
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 90.61
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 90.55
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 90.52
d2gsia1111 Immunoglobulin light chain kappa variable domain, 90.4
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 90.38
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 90.23
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 90.12
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 90.01
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 89.96
d1d5il1107 Immunoglobulin light chain kappa variable domain, 89.95
d1nfde1108 Immunoglobulin light chain lambda variable domain, 89.6
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 89.5
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 89.49
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 89.47
d8faba1103 Immunoglobulin light chain lambda variable domain, 89.45
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 89.42
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 89.41
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 89.36
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 89.21
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 89.11
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 89.1
d1mexl1107 Immunoglobulin light chain kappa variable domain, 89.07
d1mjul1112 Immunoglobulin light chain kappa variable domain, 88.96
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 88.95
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 88.88
d1j05a_111 Immunoglobulin light chain kappa variable domain, 88.83
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 88.76
d1jhll_108 Immunoglobulin light chain kappa variable domain, 88.66
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 88.64
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 88.34
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 88.14
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 88.11
d2b5ic296 Cytokine receptor common gamma chain {Human (Homo 87.84
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 87.31
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 86.95
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 86.81
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 86.8
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 86.56
d1w72l1109 Immunoglobulin light chain lambda variable domain, 86.5
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 86.38
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 86.35
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 85.9
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 85.82
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 85.58
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 85.5
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 85.31
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 84.89
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 84.58
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 84.05
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 83.13
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 83.09
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 83.09
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 83.05
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 82.5
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 82.36
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 82.36
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 82.36
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 82.24
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 81.84
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 81.79
d2gysa399 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 81.78
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 81.7
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 81.39
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 81.2
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 81.16
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 81.12
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 81.02
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 80.85
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 80.75
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 80.52
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 80.49
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 80.34
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 80.16
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 80.09
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 80.08
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 80.06
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=1.7e-19  Score=118.03  Aligned_cols=112  Identities=26%  Similarity=0.404  Sum_probs=90.7

Q ss_pred             eEEEecCCCCCCCCeeEEecCCccCCceEEEEEeCCCCCCccceeeeEEEEEEEcCCCCccceeeeeeeEEecCCcccEE
Q psy6638         146 LQASTLEEAPNGAPREVTSDPGVVDPTELLIKWKAPPRESWNGVLLGYDVGYQISSGSSLALSSYTLKSVELDNQYEGEL  225 (273)
Q Consensus       146 ~~~~~~~~~p~~~p~~~~~~~~~~~~~~i~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  225 (273)
                      +.++|..++|..+|.++++..  .+.+++.|+|++|.....+|.+.+|.|+|+..+...       .............+
T Consensus         2 v~v~T~~~~P~~~P~~v~~~~--~~~~si~v~W~~p~~~~~ng~i~~Y~v~y~~~~~~~-------~~~~~~~~~~~~~~   72 (119)
T d1x5ha1           2 VAVRTLSDVPSAAPQNLSLEV--RNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKS-------DVTETLVSGTQLSQ   72 (119)
T ss_dssp             CCCCCCCSSCCCCCEEEEEEC--CSSSEEEEEEECCCTTTCCSCEEEEBCEEEETTEEE-------EEECCBCCTTCCEE
T ss_pred             EEEEcCCCCCCCCCcCeEEEE--ecCcEEEEEEEcccccCCCCCEEEEEEEEeeccccc-------ceeeeecCCCccEE
Confidence            345677778888899999988  899999999999876556889999999998875421       11122234456789


Q ss_pred             EcCCCCccceEEEEEEEecCCCcCCCCccEEEEcCCCCCcc
Q psy6638         226 RIPGLTPYTKYAIVVRGYNSVGKGPFSEPFIARTNEGDFLF  266 (273)
Q Consensus       226 ~i~~L~p~~~Y~~~v~a~n~~g~~~~s~~~~~~t~~~~P~~  266 (273)
                      .|.+|+|++.|.|+|+|+|..|.|++|+.+.++|.++.|..
T Consensus        73 ~i~~L~p~t~Y~~~V~A~n~~G~G~~S~~~~~~T~~~~~~~  113 (119)
T d1x5ha1          73 LIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDE  113 (119)
T ss_dssp             EEECCCSSCEEEEECEEEETTEEEEECCCEEEECCSSCCCC
T ss_pred             EeCCCCCCCEEEEEEEEEcCCcCCCCCCCEEEEeCCCCCCC
Confidence            99999999999999999999999999999999998766543



>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure