Psyllid ID: psy6756

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050-----
MFTITASRRRRRSSSTPVNLSLSNPEVHNESKSPENSHKPLRKSSSLVESSSEEEVMRSTSAEKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEEQRKLQEKVQQQTAPENYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYRPPSEEGSPIQRPASPRYGGIGNNDAPWGPWSLCQTGGDSSTPDLSKGSCRRKCNSKQRPRITWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLSTAYSKSSKWKHKDITALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSNNVGSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDDLRSSSSGEEVGDDLRSSSSGEEVSDDSGKSANGSVHNASPKKII
ccEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHccHHHHccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEEccccccccEEEEcccccccHHHHHHHHHcccccccEEEEEcccEEEEEHHHHHHcccHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHccccccccEEEEcccEEEEEEEEEEccccHHHHHHHHHcccccccccEEEcccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHEEEEEcccccccHHHHHHcccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccccEEHHEEccEEEEEEEEccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
cEEEEcccccccccccccEEEcccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHccHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccccccHcEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEEEccccEEEEHHHHHHHHHccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHEHEccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc
mftitasrrrrrssstpvnlslsnpevhneskspenshkplrkssslvessseeEVMRSTSAEKIATRLQQEIENQALFYRKRKSRYmdyynsntidDVEEQRKLQEKVQQqtapenyvvmphrkrrpgfhnspaqnppfipfspsyideisfrhyrsphllsssnppylmdnpsktpphpgvllpnsveeivvkyrppseegspiqrpaspryggignndapwgpwslcqtggdsstpdlskgscrrkcnskqrpriTWLCLignadlafttppprihpsyrshpptlMKFRLvcdknspghltlkyklhhpslaDEVRQWfdsenctdismiCERGEILHAHRLVLASASPLIKRLLEEarfplgspvyiqfpdikVFHMKTILHFLYtgqasvpyklhhpslaDEVRQWfdsenctdismiCERGEILHAHRLVLASASPLIKRLLEEarfplgspvyiqfpdikVFHMKTILHFLYTGQAYMGIVRTVLdgfwnpniwlppnitwsdlepndkiqyadhrhlfyplPMALGMLLLRFFLEkywfapigasvgiknikkkaapyneVLSTaysksskwkhKDITALAKQLDWTernlnslsgpggghtnhehedtnstnedmisksscttsnnvgsareyrctycgkqfgmswnlKTHLrvhtgekpfACRLCVAMFKQKAHLLKHLCSVHRNVIssvnddgnsshfnccfcsmtIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFtrnyifpfwiirstaldapkiantmfPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNageaqgkpsVLVKFCESSWRCIYYFFSFGFGLVclwdkewlwnmdtcwvnyphqsvpsdVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKvgddlrssssgeevgddlrssssgeevsddsgksangsvhnaspkkii
mftitasrrrrrssstpvnlslsnpevhneskspenshkplrkssslvessseeevmRSTSAEKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEEQRKLQEKVqqqtapenyvvMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYrppseegspiqrpASPRYGGIGNNDAPWGPWSLCQTGGDsstpdlskgscrrkcnskqrpritWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLStaysksskwkhKDITALAKQLDWTERNLNSlsgpggghtnhehedtnstnedmisksscttsnnvgsarEYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDdlrssssgeevgddlrssssgeevsddsgksangsvhnaspkkii
MFTITAsrrrrrsssTPVNLSLSNPEVHNESKSPENSHKPLRKssslvessseeevmrstsAEKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEEQRKLQEKVQQQTAPENYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYRPPSEEGSPIQRPASPRYGGIGNNDAPWGPWSLCQTGGDSSTPDLSKGSCRRKCNSKQRPRITWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLSTAYSKSSKWKHKDITALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSNNVGSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEIlflaftflwlftRNYIFPFWIIRSTALDAPKIANTMFPAYYifngllillfilhlfWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEIlflaftflwlftRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDDLRSSSSGEEVGDDLRssssgeevsddsgksANGSVHNASPKKII
***************************************************************************QALFYRKRKSRYMDYYNS*************************************************FSPSYIDEISFRHY*****************************************************************APWGPWSLC*************************PRITWLCLIGNADLAFTTPPPRIH**Y***PPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGI****************************ITALAKQLDW********************************************AREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKV***********************************************
*************************************************************************************RYMDYYNSNT*********************NYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISF**********************************************************PRYGGIGNNDAPWG**********************************WLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLI**LLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLSTAYSKSSKWKHKDITALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSNNVGSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDDLRSSS***************************************
*************************************************************AEKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEE***********TAPENYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYR**********RPASPRYGGIGNNDAPWGPWSLCQT**********************RPRITWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLST**********KDITALAKQLDWTERNLNSLSGP*******************************GSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVG**********************************************
**************************************************************EKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEEQRKLQEKVQQQTAPENYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYRPP***********SPRYGGIGNNDAPWGPWSLCQT************SC*RK**SKQRPRITWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLSTAYSKSSKWKHKDITALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSNNVGSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDDLRSSSSGEE***********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTITASRRRRRSSSTPVNLSLSNPEVHNESKSPENSHKPLRKSSSLVESSSEEEVMRSTSAEKIATRLQQEIENQALFYRKRKSRYMDYYNSNTIDDVEEQRKLQEKVQQQTAPENYVVMPHRKRRPGFHNSPAQNPPFIPFSPSYIDEISFRHYRSPHLLSSSNPPYLMDNPSKTPPHPGVLLPNSVEEIVVKYRPPSEEGSPIQRPASPRYGGIGNNDAPWGPWSLCQTGGDSSTPDLSKGSCRRKCNSKQRPRITWLCLIGNADLAFTTPPPRIHPSYRSHPPTLMKFRLVCDKNSPGHLTLKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQASVPYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTILHFLYTGQAYMGIVRTVLDGFWNPNIWLPPNITWSDLEPNDKIQYADHRHLFYPLPMALGMLLLRFFLEKYWFAPIGASVGIKNIKKKAAPYNEVLSTAYSKSSKWKHKDITALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSNNVGSAREYRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRSTALDAPKIANTMFPAYYIFNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKKSIEIWSYLNLELLHQKVGDDLRSSSSGEEVGDDLRSSSSGEEVSDDSGKSANGSVHNASPKKII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1055 2.2.26 [Sep-21-2011]
Q8C172384 Ceramide synthase 6 OS=Mu yes N/A 0.132 0.364 0.517 5e-46
Q6ZMG9384 Ceramide synthase 6 OS=Ho yes N/A 0.130 0.359 0.505 9e-45
Q8N5B7392 Ceramide synthase 5 OS=Ho no N/A 0.109 0.295 0.479 2e-42
Q9D6K9414 Ceramide synthase 5 OS=Mu no N/A 0.109 0.280 0.461 3e-40
Q9HA82394 Ceramide synthase 4 OS=Ho no N/A 0.110 0.296 0.418 1e-38
Q96G23380 Ceramide synthase 2 OS=Ho no N/A 0.160 0.444 0.452 2e-38
Q924Z4380 Ceramide synthase 2 OS=Mu no N/A 0.108 0.3 0.458 3e-38
Q9D6J1393 Ceramide synthase 4 OS=Mu no N/A 0.229 0.615 0.343 5e-38
Q3ZBF8380 Ceramide synthase 2 OS=Bo no N/A 0.160 0.444 0.447 7e-38
G5ED45368 Ceramide synthase hyl-1 O yes N/A 0.202 0.581 0.355 5e-37
>sp|Q8C172|CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus GN=Cers6 PE=1 SV=1 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 88/170 (51%), Positives = 120/170 (70%)

Query: 818 QYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSV 877
           ++F     Q KPS L +FCES WR  +Y + F +G+  L    WLWN   CW NYP+Q +
Sbjct: 115 RWFRQRRNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPL 174

Query: 878 PSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLV 937
            +D+ +YY++ LSFY+SL VSQF D+KRKDF  MFLHH+ TI L++FS++ N+ R+GTLV
Sbjct: 175 TADLHYYYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLV 234

Query: 938 LLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWII 987
           L +HD AD  LEAAKMA YAKF K C++LF+ F  +++ TR  IFP W++
Sbjct: 235 LCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVL 284
May be involved in sphingolipid synthesis or its regulation.
Mus musculus (taxid: 10090)
>sp|Q6ZMG9|CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens GN=CERS6 PE=1 SV=1 Back     alignment and function description
>sp|Q8N5B7|CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens GN=CERS5 PE=2 SV=1 Back     alignment and function description
>sp|Q9D6K9|CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus GN=Cers5 PE=1 SV=1 Back     alignment and function description
>sp|Q9HA82|CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens GN=CERS4 PE=1 SV=2 Back     alignment and function description
>sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens GN=CERS2 PE=1 SV=1 Back     alignment and function description
>sp|Q924Z4|CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus GN=Cers2 PE=1 SV=1 Back     alignment and function description
>sp|Q9D6J1|CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus GN=Cers4 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus GN=CERS2 PE=2 SV=1 Back     alignment and function description
>sp|G5ED45|HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans GN=hyl-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1055
240848627372 longevity assurance factor 1 (lag1)-like 0.213 0.604 0.530 2e-70
91087843358 PREDICTED: similar to Longevity assuranc 0.292 0.863 0.438 2e-66
21358551400 schlank, isoform B [Drosophila melanogas 0.221 0.585 0.461 8e-66
350410061375 PREDICTED: ceramide synthase 6-like [Bom 0.198 0.557 0.526 2e-65
195340408400 GM12585 [Drosophila sechellia] gi|194130 0.222 0.587 0.460 2e-65
380026916375 PREDICTED: ceramide synthase 5-like [Api 0.198 0.557 0.538 3e-65
340720429375 PREDICTED: LAG1 longevity assurance homo 0.198 0.557 0.522 6e-65
195132649406 GI21529 [Drosophila mojavensis] gi|19390 0.205 0.534 0.484 1e-64
307194329375 LAG1 longevity assurance-like protein 6 0.194 0.546 0.522 1e-64
195399343412 GJ16002 [Drosophila virilis] gi|19415070 0.210 0.538 0.475 1e-64
>gi|240848627|ref|NP_001155629.1| longevity assurance factor 1 (lag1)-like [Acyrthosiphon pisum] gi|239792370|dbj|BAH72537.1| ACYPI005492 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  274 bits (701), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 167/260 (64%), Gaps = 35/260 (13%)

Query: 818  QYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSV 877
            ++     AQ KPS L+KFCESSWRC YY FSF +GLV LW+K WL N+D CW+ YPHQ V
Sbjct: 117  RWLRLRRAQDKPSTLIKFCESSWRCFYYTFSFHYGLVFLWNKPWLLNIDYCWIGYPHQGV 176

Query: 878  PSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLV 937
              D WWYYM+SLSFY++LAVSQFFDVKRKDFWQMF+HHICTICLLSFSWICN  RIGTLV
Sbjct: 177  TRDTWWYYMMSLSFYWALAVSQFFDVKRKDFWQMFVHHICTICLLSFSWICNFHRIGTLV 236

Query: 938  LLVHDCADIFLEAAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKK------ 991
            LL HDC DIFLE AKMAKYAK+ K C+ + + F F+WLFTR  +FPFWI+          
Sbjct: 237  LLTHDCGDIFLEFAKMAKYAKYQKLCDFISVVFIFVWLFTRIGLFPFWILYSTSVNAPQV 296

Query: 992  --------------------SIEIWSYLNLELLH-----QKVGDDLRSSSSGEEVGDDLR 1026
                                    W++L L + +      K+  D+RSSSS E   DD  
Sbjct: 297  VNQMFPAYYIFNGLLFLLLGLHLYWTHLILRIAYLSWNSGKMDGDIRSSSSDEITLDD-- 354

Query: 1027 SSSSGEEVSDDSGKSANGSV 1046
               S  ++ D +G   NG++
Sbjct: 355  --DSNTKIDDINGALPNGTI 372

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91087843|ref|XP_968073.1| PREDICTED: similar to Longevity assurance gene 1 CG3576-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|21358551|ref|NP_652526.1| schlank, isoform B [Drosophila melanogaster] gi|24640075|ref|NP_727075.1| schlank, isoform A [Drosophila melanogaster] gi|16769168|gb|AAL28803.1| LD18904p [Drosophila melanogaster] gi|18086543|gb|AAL57756.1| longevity protein [Drosophila melanogaster] gi|22831801|gb|AAF46137.2| schlank, isoform A [Drosophila melanogaster] gi|22831802|gb|AAG22409.2| schlank, isoform B [Drosophila melanogaster] gi|220943140|gb|ACL84113.1| Lag1-PA [synthetic construct] gi|220953202|gb|ACL89144.1| Lag1-PA [synthetic construct] Back     alignment and taxonomy information
>gi|350410061|ref|XP_003488933.1| PREDICTED: ceramide synthase 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195340408|ref|XP_002036805.1| GM12585 [Drosophila sechellia] gi|194130921|gb|EDW52964.1| GM12585 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|380026916|ref|XP_003697185.1| PREDICTED: ceramide synthase 5-like [Apis florea] Back     alignment and taxonomy information
>gi|340720429|ref|XP_003398641.1| PREDICTED: LAG1 longevity assurance homolog 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195132649|ref|XP_002010755.1| GI21529 [Drosophila mojavensis] gi|193907543|gb|EDW06410.1| GI21529 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|307194329|gb|EFN76685.1| LAG1 longevity assurance-like protein 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195399343|ref|XP_002058280.1| GJ16002 [Drosophila virilis] gi|194150704|gb|EDW66388.1| GJ16002 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1055
FB|FBgn0040918400 schlank "schlank" [Drosophila 0.139 0.367 0.646 5.9e-84
ZFIN|ZDB-GENE-030131-1740387 cers5 "ceramide synthase 5" [D 0.171 0.467 0.439 1.1e-59
MGI|MGI:2442564384 Cers6 "ceramide synthase 6" [M 0.168 0.463 0.480 1.4e-58
UNIPROTKB|Q6ZMG9384 CERS6 "Ceramide synthase 6" [H 0.168 0.463 0.469 6.5e-58
UNIPROTKB|H9KZD8394 CERS5 "Uncharacterized protein 0.176 0.472 0.420 5.3e-57
UNIPROTKB|F1PV86415 CERS5 "Uncharacterized protein 0.176 0.448 0.425 1.3e-56
UNIPROTKB|E1BP45384 CERS6 "Uncharacterized protein 0.168 0.463 0.452 1.7e-56
UNIPROTKB|F1P6P4391 CERS6 "Uncharacterized protein 0.161 0.434 0.491 2e-56
ZFIN|ZDB-GENE-070522-1383 cers6 "ceramide synthase 6" [D 0.171 0.472 0.445 4.5e-56
UNIPROTKB|Q8N5B7392 CERS5 "Ceramide synthase 5" [H 0.170 0.459 0.436 4.6e-56
FB|FBgn0040918 schlank "schlank" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 602 (217.0 bits), Expect = 5.9e-84, Sum P(3) = 5.9e-84
 Identities = 95/147 (64%), Positives = 123/147 (83%)

Query:   818 QYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSV 877
             +++    AQ KPS LVKFCE++WRCIYY +SF FG++ LWDK W W++ +CW  YPHQS+
Sbjct:   119 RWWRLRRAQDKPSTLVKFCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSI 178

Query:   878 PSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLV 937
              +D+WWYYMIS+SFY+SL  +QFFDVKRKDFWQMF+HH+ T+ L+S SW+CNL R+G+LV
Sbjct:   179 SNDIWWYYMISMSFYWSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLV 238

Query:   938 LLVHDCADIFLEAAKMAKYAKFDKTCE 964
             L+VHDCADIFLEAAK+ KYAK+ K C+
Sbjct:   239 LVVHDCADIFLEAAKLTKYAKYQKLCD 265
GO:0005886 "plasma membrane" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006641 "triglyceride metabolic process" evidence=IMP
GO:0046889 "positive regulation of lipid biosynthetic process" evidence=IMP
GO:0050995 "negative regulation of lipid catabolic process" evidence=IMP
GO:0032933 "SREBP signaling pathway" evidence=IMP
GO:0046513 "ceramide biosynthetic process" evidence=IMP
ZFIN|ZDB-GENE-030131-1740 cers5 "ceramide synthase 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2442564 Cers6 "ceramide synthase 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZMG9 CERS6 "Ceramide synthase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZD8 CERS5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV86 CERS5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP45 CERS6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6P4 CERS6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070522-1 cers6 "ceramide synthase 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N5B7 CERS5 "Ceramide synthase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
pfam03798198 pfam03798, TRAM_LAG1_CLN8, TLC domain 6e-49
smart00724205 smart00724, TLC, TRAM, LAG1 and CLN8 homology doma 2e-44
COG5058395 COG5058, LAG1, Protein transporter of the TRAM (tr 1e-28
pfam03798198 pfam03798, TRAM_LAG1_CLN8, TLC domain 3e-24
smart00724205 smart00724, TLC, TRAM, LAG1 and CLN8 homology doma 6e-20
COG5058395 COG5058, LAG1, Protein transporter of the TRAM (tr 2e-08
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 5e-08
pfam00651101 pfam00651, BTB, BTB/POZ domain 2e-07
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-07
pfam00651101 pfam00651, BTB, BTB/POZ domain 3e-07
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-04
>gnl|CDD|217735 pfam03798, TRAM_LAG1_CLN8, TLC domain Back     alignment and domain information 
 Score =  172 bits (437), Expect = 6e-49
 Identities = 56/159 (35%), Positives = 84/159 (52%), Gaps = 6/159 (3%)

Query: 834 KFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYPHQSVPSDVW---WYYMISLS 890
           KF E     ++Y  S   GL  L  + W WN    W  YP + +        +YY+I L 
Sbjct: 1   KFNERGVSLVHYLVSGILGLYVLLSEPWFWNPTWLWYPYPDRILGGTSALVKFYYLIQLG 60

Query: 891 FY-YSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLE 949
           ++ + L V  F++ +RK   +M LHHI T+ L+SFS+  N TR+G LVLL+H+ +D FL 
Sbjct: 61  YFLHDLLVLLFYEKRRKW--EMLLHHIITLLLISFSYFYNFTRVGLLVLLLHELSDPFLH 118

Query: 950 AAKMAKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIR 988
             K   Y    K+C++LF+ F   +   R  + PF I+ 
Sbjct: 119 LRKFLNYLGKKKSCDVLFVLFLVSFFLVRLVLGPFLILL 157

Length = 198
>gnl|CDD|214789 smart00724, TLC, TRAM, LAG1 and CLN8 homology domains Back     alignment and domain information
>gnl|CDD|227391 COG5058, LAG1, Protein transporter of the TRAM (translocating chain-associating membrane) superfamily, longevity assurance factor [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|217735 pfam03798, TRAM_LAG1_CLN8, TLC domain Back     alignment and domain information
>gnl|CDD|214789 smart00724, TLC, TRAM, LAG1 and CLN8 homology domains Back     alignment and domain information
>gnl|CDD|227391 COG5058, LAG1, Protein transporter of the TRAM (translocating chain-associating membrane) superfamily, longevity assurance factor [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1055
KOG1607|consensus318 100.0
COG5058395 LAG1 Protein transporter of the TRAM (translocatin 100.0
KOG1608|consensus374 99.96
smart00724205 TLC TRAM, LAG1 and CLN8 homology domains. Protein 99.93
KOG2462|consensus279 99.83
PF03798198 TRAM_LAG1_CLN8: TLC domain; InterPro: IPR006634 TL 99.82
KOG2462|consensus279 99.79
KOG1074|consensus958 99.69
KOG3608|consensus467 99.6
PHA02713557 hypothetical protein; Provisional 99.54
KOG4441|consensus571 99.52
KOG4350|consensus620 99.39
PHA02790480 Kelch-like protein; Provisional 99.38
KOG3608|consensus467 99.29
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.29
KOG1074|consensus 958 99.27
KOG0783|consensus1267 99.26
KOG3576|consensus267 99.22
KOG3623|consensus1007 99.18
KOG3623|consensus 1007 99.15
KOG3576|consensus267 99.09
PHA03098534 kelch-like protein; Provisional 99.08
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 98.9
KOG2838|consensus401 98.69
PLN03086567 PRLI-interacting factor K; Provisional 98.59
KOG2075|consensus521 98.58
PLN03086567 PRLI-interacting factor K; Provisional 98.58
KOG3993|consensus500 98.39
KOG4591|consensus280 98.38
PHA00733128 hypothetical protein 98.27
PHA00733128 hypothetical protein 98.26
PHA0276855 hypothetical protein; Provisional 98.23
PHA0276855 hypothetical protein; Provisional 98.16
PHA02713557 hypothetical protein; Provisional 98.01
KOG0783|consensus1267 97.94
PHA02790480 Kelch-like protein; Provisional 97.93
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.92
KOG3993|consensus500 97.9
KOG4441|consensus571 97.83
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.68
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 97.65
PHA0061644 hypothetical protein 97.35
PHA0073279 hypothetical protein 97.33
PHA0061644 hypothetical protein 97.33
PHA0073279 hypothetical protein 97.28
KOG1607|consensus318 97.23
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.2
PHA03098534 kelch-like protein; Provisional 97.19
KOG4350|consensus620 97.14
KOG4682|consensus488 96.85
COG5189423 SFP1 Putative transcriptional repressor regulating 96.82
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 96.76
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.51
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.44
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.33
COG5189423 SFP1 Putative transcriptional repressor regulating 96.22
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.05
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.88
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.32
KOG2838|consensus401 95.19
KOG4561|consensus281 95.12
KOG0511|consensus516 95.02
KOG2231|consensus 669 94.96
KOG4474|consensus253 94.95
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.69
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.42
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.12
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.7
COG5048467 FOG: Zn-finger [General function prediction only] 93.34
PRK04860160 hypothetical protein; Provisional 93.31
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 93.29
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.03
PRK04860160 hypothetical protein; Provisional 92.79
KOG2231|consensus 669 92.3
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.08
smart0035526 ZnF_C2H2 zinc finger. 91.77
smart0035526 ZnF_C2H2 zinc finger. 91.7
KOG1146|consensus 1406 91.62
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 90.53
KOG2075|consensus521 89.78
KOG4591|consensus280 89.71
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 89.16
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 88.62
COG5236493 Uncharacterized conserved protein, contains RING Z 88.47
KOG1146|consensus 1406 88.46
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 86.31
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 85.88
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 85.35
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 83.72
KOG2893|consensus341 82.36
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 81.67
KOG2482|consensus423 80.18
>KOG1607|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-54  Score=466.86  Aligned_cols=242  Identities=34%  Similarity=0.756  Sum_probs=213.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccCCCcchhhhhccccccchhhhhhheeeeeeecCCccCCchhhhccCC
Q psy6756         794 FNGLLILLFILHLFWTRLIMKIAVQYFNAGEAQGKPSVLVKFCESSWRCIYYFFSFGFGLVCLWDKEWLWNMDTCWVNYP  873 (1055)
Q Consensus       794 ~~~ll~~l~Il~~~l~~lIl~~a~r~f~~k~~~~~~~~~~Kf~Es~w~~~~y~~~~~~g~~il~~~~w~~~~~~~w~~yP  873 (1055)
                      ...++.++.++..+.+.+++....+......+...+.+.+||+||+|+++||++++++|+|+++++||++|++.+|.+||
T Consensus        48 ~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~k~~Es~Wk~~yy~~s~~~glyV~~~~~wf~~~k~~w~~yP  127 (318)
T KOG1607|consen   48 DICFLRFYLLFFTFTRLFLMLLVGRPFPLRLNVTADRRKKKFCESAWKFLYYLVSWIFGLYVMYHEPWFYDTKSFWEGYP  127 (318)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHhhhHHHhcCCcCchhhhhhHHHHHHHHHHHHHHHHhhhheecchhhcCHHHHHhcCC
Confidence            34444445555555555666666665554445555555599999999999999999999999999999999999999999


Q ss_pred             CCCCChhhHHHHHHHHHHHHHHHHHhhhhcccchhhHHHHHHHHHHHHHHHHhhcCCcccceEEEEecchhhHHHHHHHH
Q psy6756         874 HQSVPSDVWWYYMISLSFYYSLAVSQFFDVKRKDFWQMFLHHICTICLLSFSWICNLTRIGTLVLLVHDCADIFLEAAKM  953 (1055)
Q Consensus       874 ~~~~~~~~~~yYl~q~afy~~~~~~l~~~~~RkD~~~m~~HH~~Tl~Li~~SY~~n~~rvG~lvl~lHD~sDi~l~~aK~  953 (1055)
                      +++++..+|+||++|+|||+++++.+++|.+||||++|++|||+|++||++||++||+|+|++||++||+||++||++|+
T Consensus       128 ~~~~~~~~k~~Y~~e~gfY~~~l~al~~d~~rkDf~~m~vHHvvTl~Li~lSy~~~f~R~G~lil~lhD~SD~~Le~~K~  207 (318)
T KOG1607|consen  128 DQTLPPSFKAYYLLEAGFYIQLLFALFLDEKRKDFWEMVVHHVVTLILISLSYVFNFTRVGTLILALHDASDVFLELGKM  207 (318)
T ss_pred             CCCCCHHHHHHHHHhhHHHHHHHHHHHhhccccHHHHHHHHHHHHHHHHHHHHHhhhhcccceeeeeecchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcccchhhhhHHHHHHHHHHHhhcccceEEEeccc--hHH-------------------------HHHHHHHHHHHH
Q psy6756         954 AKYAKFDKTCEILFLAFTFLWLFTRNYIFPFWIIRRKK--SIE-------------------------IWSYLNLELLHQ 1006 (1055)
Q Consensus       954 ~~y~~~~~~~~~~F~~f~~~w~~~Rl~~~p~~ii~~~~--~~~-------------------------~W~~lI~~~~~~ 1006 (1055)
                      +||++.+.+++.+|++|+++|+++||++||+|+++++.  ...                         ||+++|+||++|
T Consensus       208 ~nY~~~~~~~~~~F~~F~~~wi~~RL~~~p~wil~st~~~~~~~~~~~~~~~~~~~~~lL~~Lqll~i~W~~lI~rm~~r  287 (318)
T KOG1607|consen  208 LNYLQFEAIADFVFVLFAFSWIYTRLIYYPFWILRSTSREDFSLRQYQPKPSYYFFNCLLLALQLLHIYWFYLILRMAYR  287 (318)
T ss_pred             HchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhccCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999983  111                         999999999999


Q ss_pred             HHhcccccCCCCCCccCcCCCCCCCCCCCccccccCC
Q psy6756        1007 KVGDDLRSSSSGEEVGDDLRSSSSGEEVSDDSGKSAN 1043 (1055)
Q Consensus      1007 ~~~~~~~~~~~g~~~~~D~Rsd~e~~~~~~~~~~~~~ 1043 (1055)
                      ++.       +| ++.||+|||+|+||++|++.++++
T Consensus       288 ~~~-------~g-~~~eD~Rsd~~s~d~~~~~~~~~~  316 (318)
T KOG1607|consen  288 VIK-------RG-MQGEDIRSDSESEDSSEEESKAEK  316 (318)
T ss_pred             HHh-------cC-CccccccccccccccccccccccC
Confidence            997       57 799999999988887666655543

>COG5058 LAG1 Protein transporter of the TRAM (translocating chain-associating membrane) superfamily, longevity assurance factor [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1608|consensus Back     alignment and domain information
>smart00724 TLC TRAM, LAG1 and CLN8 homology domains Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>PF03798 TRAM_LAG1_CLN8: TLC domain; InterPro: IPR006634 TLC is a protein domain with at least 5 transmembrane alpha-helices Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG1607|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG4561|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG4474|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-07
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-06
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-06
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 4e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 8e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (59%)
Query: 643 YRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKH 689
           Y+C  CGK F    NL+ H R HTGEKP+AC  C   F Q AHL  H
Sbjct: 78  YKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAH 124
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1055
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-08
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-07
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 6e-07
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-06
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 7e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 5e-06
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 1e-05
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-05
3b84_A119 Zinc finger and BTB domain-containing protein 48; 4e-05
3b84_A119 Zinc finger and BTB domain-containing protein 48; 5e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-05
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 5e-05
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 7e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-05
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-04
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-04
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 1e-04
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 2e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 2e-04
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 2e-04
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 3e-04
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 2e-04
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 4e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-04
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 3e-04
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 5e-04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 4e-04
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 4e-04
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 5e-04
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 5e-04
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 6e-04
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 6e-04
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 6e-04
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 6e-04
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 6e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 7e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 8e-04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 7e-04
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
 Score = 73.3 bits (181), Expect = 4e-16
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 643 YRCTYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKH 689
           ++C  C + F  S +L TH+R HTGEKPFAC +C   F +     +H
Sbjct: 4   FQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 50
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Length = 28 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1055
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.86
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.82
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.78
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.73
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.73
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.72
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.72
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.71
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.7
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.7
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.7
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.7
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.69
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.69
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.69
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.68
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.68
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.67
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.66
2vpk_A116 Myoneurin; transcription regulation, transcription 99.65
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.63
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.62
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.57
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.56
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.56
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.55
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.55
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.55
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.54
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.53
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.53
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.53
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.5
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.48
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.46
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.46
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.44
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.42
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.4
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.4
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.4
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.39
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.37
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.35
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.34
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.34
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.31
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.3
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.3
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.29
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.27
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.26
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.25
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.22
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.21
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.17
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.15
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.14
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.03
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.03
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.01
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.0
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.0
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.98
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.98
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.97
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.96
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.96
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.96
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.95
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.93
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.93
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.92
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.92
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.91
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.89
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.87
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.86
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.83
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.83
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.83
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.81
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.81
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.8
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.79
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.79
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.79
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.77
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.75
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.75
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.75
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.75
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.73
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.73
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.71
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.7
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.68
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.67
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.67
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.66
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 98.64
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.64
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.63
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.63
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 98.62
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.62
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 98.62
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.61
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.61
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.61
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.61
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.6
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.6
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 98.6
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.6
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.59
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.59
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.59
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.58
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.58
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.58
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.58
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.58
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 98.58
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 98.57
3b84_A119 Zinc finger and BTB domain-containing protein 48; 98.57
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.57
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.57
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 98.57
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.56
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.56
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.56
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 98.56
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.56
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 98.54
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.53
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.51
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.51
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.5
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.5
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.48
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 98.48
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.45
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.45
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.44
2vpk_A116 Myoneurin; transcription regulation, transcription 98.44
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.44
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.43
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.43
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.43
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.43
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 98.42
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.4
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.37
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.35
4ajy_C97 Transcription elongation factor B polypeptide 1; E 98.35
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.35
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.35
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.35
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.35
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.35
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.34
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.34
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.34
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.34
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.34
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.33
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.33
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.33
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.33
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.33
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.33
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.33
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.33
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.33
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.32
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.32
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.32
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.32
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.31
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.31
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.31
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.3
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.3
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.3
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.3
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.29
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.29
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.29
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.29
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.29
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.29
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 98.28
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.28
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.28
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.28
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.27
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.27
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 98.27
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.26
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.26
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.25
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.25
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.21
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 98.16
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.11
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 98.08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.08
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.04
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 98.04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.03
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.03
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.03
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.02
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 98.02
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.0
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.99
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.99
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.99
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.98
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.97
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.97
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.96
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.96
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.95
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.89
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.88
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.87
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.85
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.84
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.83
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.82
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.8
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 97.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.77
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 97.76
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.72
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 97.72
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.71
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.65
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.64
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.64
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.62
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.6
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.55
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.53
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.52
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.5
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.48
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.48
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.45
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.43
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.43
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.43
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.41
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.35
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 97.33
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.32
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.31
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.3
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.3
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.27
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.27
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.25
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.21
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.18
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.18
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.17
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.11
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.11
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.1
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.08
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.05
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.02
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.02
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.01
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.0
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 96.98
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 96.95
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 96.95
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.92
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.92
2fnj_C96 Transcription elongation factor B polypeptide 1; b 96.92
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 96.92
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 96.9
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.94
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 96.89
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 96.89
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 96.88
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.88
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.88
1ard_A29 Yeast transcription factor ADR1; transcription reg 96.83
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 96.82
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.81
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.84
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 96.8
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.79
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 96.79
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 96.75
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 96.69
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 96.69
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.71
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.68
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 96.67
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.62
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 96.53
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.52
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 96.41
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.06
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 95.97
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 95.78
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 94.26
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 92.92
4ajy_C97 Transcription elongation factor B polypeptide 1; E 92.62
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 92.36
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.17
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.87
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 91.27
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 90.6
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.47
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 86.09
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 84.6
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.0
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.86  E-value=8.3e-23  Score=212.38  Aligned_cols=157  Identities=22%  Similarity=0.333  Sum_probs=110.9

Q ss_pred             cccccccccccccCCCCCCCCCCCCCCccCCCCCcccccCcccccccC-cCCCCcccccCCCCCccCChhhHhhhhhhcc
Q psy6756         588 ALAKQLDWTERNLNSLSGPGGGHTNHEHEDTNSTNEDMISKSSCTTSN-NVGSAREYRCTYCGKQFGMSWNLKTHLRVHT  666 (1055)
Q Consensus       588 ~~C~~C~k~f~~~~~L~~H~~~h~~e~~~~c~~c~~~~~~~s~l~~h~-~~~~~k~y~C~~C~k~F~~~ssL~~H~~~H~  666 (1055)
                      +.|..|++.|.+...|..|++.|.+++++.|..|+..|.....+..|. .+.++++|.|+.|++.|.+...|..|++.|.
T Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  101 (190)
T 2i13_A           22 YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHT  101 (190)
T ss_dssp             ---------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHH
T ss_pred             CcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcC
Confidence            677777777777777777777777777777777777777777666665 4455667777777777777777777777777


Q ss_pred             CCCCeecCcCcccccChHHHHHHHHhhcccccccccCCCCCcccccCCCCCCcCcccceecccchhccCHHHHHHHHHcC
Q psy6756         667 GEKPFACRLCVAMFKQKAHLLKHLCSVHRNVISSVNDDGNSSHFNCCFCSMTIGTLVLLVHDCADIFLEAAKMAKYAKFD  746 (1055)
Q Consensus       667 gekpf~C~~Cgk~F~~k~sL~~H~r~~H~~~~~~~~~HtgeKpy~C~~Cgk~F~t~~lLcH~C~k~F~~~~~L~~H~r~h  746 (1055)
                      ++++|.|++|++.|.+...|.+|++.           |+++++|+|+.||              +.|.+...|..|++.|
T Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~-----------h~~~~~~~C~~C~--------------~~f~~~~~L~~H~~~H  156 (190)
T 2i13_A          102 GEKPYACPECGKSFSQLAHLRAHQRT-----------HTGEKPYKCPECG--------------KSFSREDNLHTHQRTH  156 (190)
T ss_dssp             TCCCEECTTTCCEESSHHHHHHHHHH-----------HHCCCCEECTTTC--------------CEESCHHHHHHHHHHH
T ss_pred             CCCCCcCCCCCCccCCHHHHHHHHHH-----------hCCCCCeECCCCC--------------cccCCHHHHHHHHHhc
Confidence            77777777777777777777777763           3356777777665              5777888999999988


Q ss_pred             -----cccccchhhccCcccceeccccc
Q psy6756         747 -----KTCEILFLAFTFLWLFTRNYIFP  769 (1055)
Q Consensus       747 -----y~C~~Cg~~F~~~~~L~rHv~~p  769 (1055)
                           |+|++|++.|.....|.+|+..+
T Consensus       157 ~~~~~~~C~~C~~~f~~~~~L~~H~~~H  184 (190)
T 2i13_A          157 TGEKPYKCPECGKSFSRRDALNVHQRTH  184 (190)
T ss_dssp             HCCCCEECTTTCCEESSHHHHHHHHTTC
T ss_pred             CCCCCeECCCCCCccCCHHHHHHHHHhc
Confidence                 99999999999999999998754
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1055
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-09
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-08
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 5e-06
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 4e-04
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.001
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 0.002
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 0.003
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.5 bits (129), Expect = 4e-10
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 639 SAREYRCTYCGKQFGMSWNLKTHLR-VHTGEKPFACRL 675
             + Y C  CGK F    +L  H++ VHT E+P  C++
Sbjct: 2   VGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1055
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.73
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.23
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.08
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.79
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.62
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 98.62
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 98.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.5
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.49
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.46
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.44
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.31
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.24
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.22
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.18
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.18
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.16
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.13
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.12
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.12
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.11
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.09
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.07
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.94
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.82
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.81
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.7
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 97.67
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.66
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.66
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.66
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.64
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.26
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.25
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.24
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.23
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.08
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.01
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.95
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.84
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.68
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.5
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.16
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.13
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.02
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.97
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.89
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.89
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.81
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.59
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.57
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.53
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.42
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.2
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.85
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.79
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.74
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 94.65
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.65
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.58
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.44
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.42
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.11
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.9
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.88
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.78
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 93.76
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 93.68
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 92.98
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 92.53
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 92.48
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.58
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.39
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 91.07
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.65
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 90.28
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 90.05
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.87
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.25
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 89.13
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 88.81
d3kvta_103 akv3.1 voltage-gated potassium channel {California 88.73
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.1
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 86.61
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 86.38
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 86.37
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 86.24
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 85.93
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 84.83
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 84.53
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 84.26
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 82.87
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 82.8
d1t1da_100 Shaker potassium channel {California sea hare (Apl 80.91
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.73
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.73  E-value=1.3e-18  Score=166.09  Aligned_cols=95  Identities=18%  Similarity=0.277  Sum_probs=85.7

Q ss_pred             eeeCCChhhHHHHHHHHhhcCCccceEEEeeCCeEEehhhHHhhccChhHHHHhhhCCCCCCCCeEEecCCCCHHHHHHH
Q psy6756         306 LKYKLHHPSLADEVRQWFDSENCTDISMICERGEILHAHRLVLASASPLIKRLLEEARFPLGSPVYIQFPDIKVFHMKTI  385 (1055)
Q Consensus       306 l~~~~h~~~l~~~L~~l~~~~~~~DVtl~ve~g~~f~AHk~VLaA~S~yFr~lF~~~~~~~~~~~~I~l~~v~~~~~~~l  385 (1055)
                      ++|++|+.++++.|+++++++.+|||+|.+ +|+.|+|||+|||++|+||++||.+ .+.+....++.++++++++|+.+
T Consensus         3 ~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v-~~~~~~~Hk~vLa~~S~~F~~~f~~-~~~e~~~~~~~~~~v~~~~f~~l   80 (122)
T d1r29a_           3 IQFTRHASDVLLNLNRLRSRDILTDVVIVV-SREQFRAHKTVLMACSGLFYSIFTD-QLKRNLSVINLDPEINPEGFNIL   80 (122)
T ss_dssp             CCCTTHHHHHHHHHHHHHHTTCSCCEEEEE-TTEEEEECHHHHHHHCHHHHHHHTS-TTTTTCSEEECCTTSCHHHHHHH
T ss_pred             cccchHHHHHHHHHHHHHhcCCCeEEEEEE-CCEEEEEehHHhhhCCHHHHHHhcc-chhhhcceeeeecccCHHHHHHH
Confidence            678899999999999999999999999999 6999999999999999999999975 55556666777789999999999


Q ss_pred             HHHhhcCCCcCCcccCC
Q psy6756         386 LHFLYTGQASVPYKLHH  402 (1055)
Q Consensus       386 L~f~YTG~l~Ls~~nl~  402 (1055)
                      |+|||||++.++.+++.
T Consensus        81 l~~~Ytg~~~i~~~~v~   97 (122)
T d1r29a_          81 LDFMYTSRLNLREGNIM   97 (122)
T ss_dssp             HHHHHHSCCCCCTTTHH
T ss_pred             HhhhcCCeecCchhhHH
Confidence            99999999988776654
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure