Psyllid ID: psy6892

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
METEVSFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFKAGARDETAREEEEEEEEEEEEEEEQEQDEYLEEDENEKERRLPEEDERGEDEEKKEEEEDKQGEEKRVEDKIGDEKRLEENKKKKTQKR
ccccccccccccHHHHHHHHHHHHHHHHHHHcHHHEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccccEEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHccccccHHHHHHHHHcccccHccHcccccHHHHHHHHccccccc
metevsfgldaaswNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKnilcenqlfkagardetareeeeeeeeeeeEEEEQEQDEYLeedenekerrlpeedergedeekkEEEEDKQGEEKRVEDKIGDEKRLEENkkkktqkr
METEVSFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLrlkknilcenqlfkagardetareeeeeeeeeeeeeeeqeqdeyleedenekerrlpeedergedeekkeeeedkqgeekrvedkigdekrleenkkkktqkr
METEVSFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFKAGArdetareeeeeeeeeeeeeeeqeqdeyleedenekerrlpeedergedeekkeeeedkqgeekrveDKIGDEKRLEENKKKKTQKR
*****SFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFK*****************************************************************************************
*********DAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFKAGARDE***********************************************************************************
METEVSFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFKA**********************************************************************IGDEKRL***********
*****SFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFKAGARDETAREEEEE***************YL*EDE*****************************************R************
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METEVSFGLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRLKKNILCENQLFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLPEEDERGEDEEKKEEEEDKQGEEKRVEDKIGDEKRLEENKKKKTQKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
O46635 470 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 9e-13
P50129 470 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 9e-13
Q5R4Q6 471 5-hydroxytryptamine recep N/A N/A 0.310 0.125 0.542 9e-13
P50128 471 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 1e-12
P28223 471 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 1e-12
P18599 471 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 1e-12
P35363 471 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 1e-12
P14842 471 5-hydroxytryptamine recep no N/A 0.310 0.125 0.542 1e-12
Q75Z89 470 5-hydroxytryptamine recep yes N/A 0.310 0.125 0.542 2e-12
Q8IS44 506 Dopamine D2-like receptor no N/A 0.326 0.122 0.516 3e-12
>sp|O46635|5HT2A_CANFA 5-hydroxytryptamine receptor 2A OS=Canis familiaris GN=HTR2A PE=2 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%)

Query: 18  AVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLV 76
           A++T +++  T  GNILV +A+S EK+LQN TNYFLMSLAI D+++  LVMP+ +LT++
Sbjct: 78  ALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTIL 136
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production.
Canis familiaris (taxid: 9615)
>sp|P50129|5HT2A_PIG 5-hydroxytryptamine receptor 2A OS=Sus scrofa GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|Q5R4Q6|5HT2A_PONPY 5-hydroxytryptamine receptor 2A OS=Pongo pygmaeus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P50128|5HT2A_MACMU 5-hydroxytryptamine receptor 2A OS=Macaca mulatta GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P28223|5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens GN=HTR2A PE=1 SV=2 Back     alignment and function description
>sp|P18599|5HT2A_CRIGR 5-hydroxytryptamine receptor 2A OS=Cricetulus griseus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P35363|5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus GN=Htr2a PE=2 SV=1 Back     alignment and function description
>sp|P14842|5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus GN=Htr2a PE=2 SV=1 Back     alignment and function description
>sp|Q75Z89|5HT2A_BOVIN 5-hydroxytryptamine receptor 2A OS=Bos taurus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|Q8IS44|DRD2L_DROME Dopamine D2-like receptor OS=Drosophila melanogaster GN=D2R PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
195395979 926 GJ10131 [Drosophila virilis] gi|19414332 0.363 0.074 0.797 1e-23
195111751 942 GI22528 [Drosophila mojavensis] gi|19391 0.363 0.073 0.797 1e-23
332025971 311 5-hydroxytryptamine receptor 2A [Acromyr 0.331 0.202 0.825 1e-23
195054341166 GH17576 [Drosophila grimshawi] gi|193895 0.331 0.379 0.825 2e-23
322789409117 hypothetical protein SINV_11093 [Solenop 0.331 0.538 0.825 2e-23
24201002688 beta-3 adrenergic receptor, putative [Pe 0.373 0.806 0.788 5e-23
307200652237 5-hydroxytryptamine receptor 2A [Harpegn 0.331 0.265 0.825 5e-23
312373288240 hypothetical protein AND_17644 [Anophele 0.331 0.262 0.809 9e-23
347967429 942 AGAP002229-PA [Anopheles gambiae str. PE 0.368 0.074 0.757 4e-22
270008194 700 hypothetical protein TcasGA2_TC013982 [T 0.331 0.09 0.809 8e-22
>gi|195395979|ref|XP_002056611.1| GJ10131 [Drosophila virilis] gi|194143320|gb|EDW59723.1| GJ10131 [Drosophila virilis] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/69 (79%), Positives = 61/69 (88%)

Query: 15  NIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILT 74
           N WA++ L+LVF TA GNILVCLAI+WE+RLQNVTNYFLMSLAITDLMVAVLVMPLGILT
Sbjct: 80  NYWALLALVLVFGTAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILT 139

Query: 75  LVRVRTNLS 83
           LV+    LS
Sbjct: 140 LVKGHFPLS 148

Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195111751|ref|XP_002000441.1| GI22528 [Drosophila mojavensis] gi|193917035|gb|EDW15902.1| GI22528 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|332025971|gb|EGI66124.1| 5-hydroxytryptamine receptor 2A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195054341|ref|XP_001994084.1| GH17576 [Drosophila grimshawi] gi|193895954|gb|EDV94820.1| GH17576 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|322789409|gb|EFZ14714.1| hypothetical protein SINV_11093 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242010026|ref|XP_002425777.1| beta-3 adrenergic receptor, putative [Pediculus humanus corporis] gi|212509710|gb|EEB13039.1| beta-3 adrenergic receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307200652|gb|EFN80760.1| 5-hydroxytryptamine receptor 2A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|312373288|gb|EFR21055.1| hypothetical protein AND_17644 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347967429|ref|XP_001687830.2| AGAP002229-PA [Anopheles gambiae str. PEST] gi|333466300|gb|EDO64817.2| AGAP002229-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270008194|gb|EFA04642.1| hypothetical protein TcasGA2_TC013982 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
ZFIN|ZDB-GENE-030910-1 437 drd2l "dopamine receptor D2 li 0.310 0.135 0.525 2.8e-13
UNIPROTKB|E1BVI5 468 HTR2A "5-hydroxytryptamine (Se 0.357 0.145 0.514 3.2e-13
UNIPROTKB|A3RL34 480 Htr2b "5-HT2b serotonin recept 0.315 0.125 0.540 3.7e-13
ZFIN|ZDB-GENE-081022-57 443 htr2b "5-hydroxytryptamine (se 0.352 0.151 0.507 4.8e-13
UNIPROTKB|O46635 470 HTR2A "5-hydroxytryptamine rec 0.347 0.140 0.5 6.9e-13
UNIPROTKB|F1RK09 470 HTR2A "5-hydroxytryptamine rec 0.347 0.140 0.5 6.9e-13
UNIPROTKB|P50129 470 HTR2A "5-hydroxytryptamine rec 0.347 0.140 0.5 6.9e-13
UNIPROTKB|P28223 471 HTR2A "5-hydroxytryptamine rec 0.347 0.140 0.5 7e-13
MGI|MGI:109521 471 Htr2a "5-hydroxytryptamine (se 0.347 0.140 0.5 7e-13
RGD|61800 471 Htr2a "5-hydroxytryptamine (se 0.347 0.140 0.5 7e-13
ZFIN|ZDB-GENE-030910-1 drd2l "dopamine receptor D2 like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 181 (68.8 bits), Expect = 2.8e-13, P = 2.8e-13
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query:    14 WNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGI 72
             +N +AV+ ++L+FC   GN+LVC+A+S EK LQ  TNY ++SLA++DL++A LVMP G+
Sbjct:    40 YNFYAVLLVLLIFCVVFGNVLVCVAVSREKALQTTTNYLIVSLAVSDLLLATLVMPWGV 98
GO:0030815 "negative regulation of cAMP metabolic process" evidence=IEA
GO:0004952 "dopamine neurotransmitter receptor activity" evidence=IEA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA
GO:0007195 "adenylate cyclase-inhibiting dopamine receptor signaling pathway" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0042221 "response to chemical stimulus" evidence=IEA
GO:0097458 "neuron part" evidence=IEA
GO:0004930 "G-protein coupled receptor activity" evidence=IEA
GO:0005887 "integral to plasma membrane" evidence=IEA
GO:0001591 "dopamine neurotransmitter receptor activity, coupled via Gi/Go" evidence=ISS
GO:0007212 "dopamine receptor signaling pathway" evidence=ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
UNIPROTKB|E1BVI5 HTR2A "5-hydroxytryptamine (Serotonin) receptor 2A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A3RL34 Htr2b "5-HT2b serotonin receptor" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081022-57 htr2b "5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O46635 HTR2A "5-hydroxytryptamine receptor 2A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RK09 HTR2A "5-hydroxytryptamine receptor 2A" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P50129 HTR2A "5-hydroxytryptamine receptor 2A" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P28223 HTR2A "5-hydroxytryptamine receptor 2A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:109521 Htr2a "5-hydroxytryptamine (serotonin) receptor 2A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61800 Htr2a "5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-12
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-06
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 2e-05
pfam03985431 pfam03985, Paf1, Paf1 2e-05
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-05
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 5e-05
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 5e-05
pfam03344 715 pfam03344, Daxx, Daxx Family 5e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 9e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
pfam02724 583 pfam02724, CDC45, CDC45-like protein 1e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
pfam02724 583 pfam02724, CDC45, CDC45-like protein 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 2e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 3e-04
TIGR00790239 TIGR00790, fnt, formate/nitrite transporter 3e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 3e-04
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 4e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 5e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 5e-04
TIGR01651 600 TIGR01651, CobT, cobaltochelatase, CobT subunit 5e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 6e-04
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 6e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 7e-04
pfam02724 583 pfam02724, CDC45, CDC45-like protein 7e-04
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 7e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 8e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 9e-04
PHA03087 335 PHA03087, PHA03087, G protein-coupled chemokine re 9e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.001
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK14953486 PRK14953, PRK14953, DNA polymerase III subunits ga 0.001
pfam05285 317 pfam05285, SDA1, SDA1 0.001
COG5167 776 COG5167, VID27, Protein involved in vacuole import 0.001
pfam04502321 pfam04502, DUF572, Family of unknown function (DUF 0.001
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.002
pfam12446133 pfam12446, DUF3682, Protein of unknown function (D 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
pfam07767 387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
pfam13520 425 pfam13520, AA_permease_2, Amino acid permease 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.003
pfam14153185 pfam14153, Spore_coat_CotO, Spore coat protein Cot 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 0.004
COG5177 769 COG5177, COG5177, Uncharacterized conserved protei 0.004
pfam05758 832 pfam05758, Ycf1, Ycf1 0.004
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.004
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 63.1 bits (154), Expect = 2e-12
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 37 LAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLV 76
          L I   K+L+  TN FL++LA+ DL+  + + P  +  LV
Sbjct: 1  LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLV 40

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|162039 TIGR00790, fnt, formate/nitrite transporter Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237867 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|222193 pfam13520, AA_permease_2, Amino acid permease Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
KOG4219|consensus 423 99.64
PHA03234 338 DNA packaging protein UL33; Provisional 99.37
KOG4220|consensus 503 99.36
PHA02834 323 chemokine receptor-like protein; Provisional 99.21
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.13
PHA03087 335 G protein-coupled chemokine receptor-like protein; 99.06
PHA03235 409 DNA packaging protein UL33; Provisional 99.04
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.7
KOG2087|consensus 363 98.41
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.31
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 96.85
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 96.59
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.13
PF11710201 Git3: G protein-coupled glucose receptor regulatin 96.06
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 95.75
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 95.74
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 95.33
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 94.99
KOG3064|consensus303 92.97
PF00002242 7tm_2: 7 transmembrane receptor (Secretin family); 92.93
PF03839224 Sec62: Translocation protein Sec62; InterPro: IPR0 92.4
PF02724 622 CDC45: CDC45-like protein; InterPro: IPR003874 CDC 92.12
KOG1189|consensus960 91.95
PF10327 303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 90.55
PF03402 265 V1R: Vomeronasal organ pheromone receptor family, 87.62
KOG2927|consensus372 84.42
PF0988278 DUF2109: Predicted membrane protein (DUF2109); Int 84.2
PF10856118 DUF2678: Protein of unknown function (DUF2678); In 83.62
PF10326 307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 82.29
>KOG4219|consensus Back     alignment and domain information 
Probab=99.64  E-value=2.4e-16  Score=134.59  Aligned_cols=97  Identities=26%  Similarity=0.349  Sum_probs=84.0

Q ss_pred             CCCchhhHHHHHHHHHHHHhhhccchheeeeeeccCCCCchhHHHHHHHHHHHHHHhhhhcccceeeecccccccccccc
Q psy6892           8 GLDAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVL   87 (190)
Q Consensus         8 ~~~~~~~~~~~v~~~ii~vlgi~gN~lvi~vi~~~~~L~~~~~~fl~nLAvaDLl~~l~~lP~~l~~~l~~~~~~s~~lC   87 (190)
                      ..+...+.+++++|+++.+++++||++|+|++..+|++|+.+|+||+|||+||+++++++.|+.....+...|++|.++|
T Consensus        29 ~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f~C  108 (423)
T KOG4219|consen   29 VLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSFYC  108 (423)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhcccccccee
Confidence            33555677888999999999999999999999999999999999999999999999999999999988889999999999


Q ss_pred             eeeccchh---hhhhhhhcc
Q psy6892          88 RLKKNILC---ENQLFKAGA  104 (190)
Q Consensus        88 ~i~~~i~c---~~slfSl~s  104 (190)
                      ++..++.-   .++.|++.+
T Consensus       109 ~f~nf~~itav~vSVfTlvA  128 (423)
T KOG4219|consen  109 RFVNFFPITAVFVSVFTLVA  128 (423)
T ss_pred             eeccccchhhhhHhHHHHHH
Confidence            98765554   445555443

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>KOG3064|consensus Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03839 Sec62: Translocation protein Sec62; InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens Back     alignment and domain information
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46 Back     alignment and domain information
>KOG1189|consensus Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2927|consensus Back     alignment and domain information
>PF09882 DUF2109: Predicted membrane protein (DUF2109); InterPro: IPR019214 This entry is found in various hypothetical archaeal proteins and has no known function Back     alignment and domain information
>PF10856 DUF2678: Protein of unknown function (DUF2678); InterPro: IPR022564 This family of proteins has no known function Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
4eiy_A 447 Crystal Structure Of The Chimeric Protein Of A2aar- 4e-07
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 4e-07
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 4e-07
3pwh_A 329 Thermostabilised Adenosine A2a Receptor Length = 32 5e-07
3vg9_A 326 Crystal Structure Of Human Adenosine A2a Receptor W 1e-06
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-06
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 2e-06
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 2e-06
2ydo_A 325 Thermostabilised Human A2a Receptor With Adenosine 2e-06
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 2e-06
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 3e-06
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 3e-06
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-06
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 3e-06
2y00_B 315 Turkey Beta1 Adrenergic Receptor With Stabilising M 6e-06
4gbr_A 309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 6e-06
2vt4_A 313 Turkey Beta1 Adrenergic Receptor With Stabilising M 6e-06
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-05
3uon_A 467 Structure Of The Human M2 Muscarinic Acetylcholine 1e-04
3rze_A 452 Structure Of The Human Histamine H1 Receptor In Com 2e-04
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)
Query: 15 NIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGI 72
          +++  V L +      GN+LVC A+     LQNVTNYF++SLA  D+ V VL +P  I
Sbjct: 32 SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAI 89
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.51
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.46
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.45
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.45
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.45
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.43
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.43
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.42
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.42
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.42
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.41
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.4
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.39
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.37
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.37
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.35
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.34
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.34
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 97.27
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.51  E-value=2.5e-15  Score=132.50  Aligned_cols=93  Identities=23%  Similarity=0.288  Sum_probs=72.0

Q ss_pred             CchhhHHHHHHHHHHHHhhhccchheeeeeeccCCC---CchhHHHHHHHHHHHHHHhhhhcccceeeecc--ccccccc
Q psy6892          10 DAASWNIWAVVTLILVFCTATGNILVCLAISWEKRL---QNVTNYFLMSLAITDLMVAVLVMPLGILTLVR--VRTNLSG   84 (190)
Q Consensus        10 ~~~~~~~~~v~~~ii~vlgi~gN~lvi~vi~~~~~L---~~~~~~fl~nLAvaDLl~~l~~lP~~l~~~l~--~~~~~s~   84 (190)
                      ....+.++.++|++++++|++||++||+++++++++   |+++|+||+|||++||+++++++|+.++.++.  +.|.++.
T Consensus        28 ~~~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~  107 (510)
T 4grv_A           28 DIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGD  107 (510)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhH
Confidence            334456778889999999999999999999887654   47899999999999999999999998876553  5699999


Q ss_pred             ccceeeccc---hhhhhhhhh
Q psy6892          85 AVLRLKKNI---LCENQLFKA  102 (190)
Q Consensus        85 ~lC~i~~~i---~c~~slfSl  102 (190)
                      .+|++.+++   .+.++++++
T Consensus       108 ~~C~~~~~~~~~~~~~S~~~l  128 (510)
T 4grv_A          108 AGCRGYYFLRDACTYATALNV  128 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            999986543   334444443
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 3e-20
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 84.2 bits (207), Expect = 3e-20
 Identities = 13/61 (21%), Positives = 25/61 (40%)

Query: 10 DAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMP 69
          +   +++ A    +L+      N L        K+L+   NY L++LA+ DL +      
Sbjct: 33 EPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFT 92

Query: 70 L 70
           
Sbjct: 93 T 93

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.42
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.42  E-value=1.7e-14  Score=117.57  Aligned_cols=84  Identities=18%  Similarity=0.209  Sum_probs=73.1

Q ss_pred             CchhhHHHHHHHHHHHHhhhccchheeeeeeccCCCCchhHHHHHHHHHHHHHHhhhhcccceeeeccccccccccccee
Q psy6892          10 DAASWNIWAVVTLILVFCTATGNILVCLAISWEKRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVRVRTNLSGAVLRL   89 (190)
Q Consensus        10 ~~~~~~~~~v~~~ii~vlgi~gN~lvi~vi~~~~~L~~~~~~fl~nLAvaDLl~~l~~lP~~l~~~l~~~~~~s~~lC~i   89 (190)
                      .+..+.++++++++++++|++||+++++++++++++|+++|++++|||++|++++++.+|..+...+.+.|..+...|++
T Consensus        33 ~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~  112 (348)
T d1u19a_          33 EPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNL  112 (348)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhh
Confidence            34446677888999999999999999999999999999999999999999999999999988888888888888888877


Q ss_pred             eccc
Q psy6892          90 KKNI   93 (190)
Q Consensus        90 ~~~i   93 (190)
                      .+++
T Consensus       113 ~~~~  116 (348)
T d1u19a_         113 EGFF  116 (348)
T ss_dssp             HHHH
T ss_pred             hhhc
Confidence            5443