Psyllid ID: psy6935
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1575 | 2.2.26 [Sep-21-2011] | |||||||
| P13395 | 2415 | Spectrin alpha chain OS=D | yes | N/A | 0.893 | 0.583 | 0.669 | 0.0 | |
| Q13813 | 2472 | Spectrin alpha chain, non | yes | N/A | 0.899 | 0.573 | 0.551 | 0.0 | |
| P16086 | 2472 | Spectrin alpha chain, non | yes | N/A | 0.899 | 0.573 | 0.548 | 0.0 | |
| P16546 | 2472 | Spectrin alpha chain, non | yes | N/A | 0.899 | 0.573 | 0.548 | 0.0 | |
| P07751 | 2477 | Spectrin alpha chain, non | yes | N/A | 0.895 | 0.569 | 0.547 | 0.0 | |
| P08032 | 2415 | Spectrin alpha chain, ery | no | N/A | 0.925 | 0.603 | 0.386 | 0.0 | |
| P02549 | 2419 | Spectrin alpha chain, ery | no | N/A | 0.886 | 0.577 | 0.395 | 0.0 | |
| Q62261 | 2363 | Spectrin beta chain, non- | no | N/A | 0.551 | 0.367 | 0.276 | 1e-80 | |
| Q01082 | 2364 | Spectrin beta chain, non- | no | N/A | 0.551 | 0.367 | 0.276 | 6e-80 | |
| Q00963 | 2291 | Spectrin beta chain OS=Dr | no | N/A | 0.594 | 0.408 | 0.246 | 8e-78 |
| >sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 1924 bits (4985), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 996/1487 (66%), Positives = 1157/1487 (77%), Gaps = 79/1487 (5%)
Query: 96 YGKDEDSSEALLKKHEALVSDLEAFGNTILGLREQAQSCRQQETPVIDVTGKECVIALYD 155
YGKDEDSSEALLKKHEALVSDLEAFGNTI L+EQA++CRQQETPV+D+TGKECV+ALYD
Sbjct: 921 YGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYD 980
Query: 156 YTEKSPREVSMKKSDVLTLLNSNNKDWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLAD 215
YTEKSPREVSMKK DVLTLLNSNNKDWWKVEVNDRQGFVPAAY+KK++AGL+ASQQNL D
Sbjct: 981 YTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVD 1040
Query: 216 VKEVKILETANDIQERREQVLNRYADFKSEARSKREKLEDITVKEVKILETANDIQE--R 273
+ I +R+ Q+ ++Y + + AR ++ KL + TVK ++ A D+ + R
Sbjct: 1041 ---------NHSIAKRQNQINSQYDNLLALARERQNKLNE-TVKAYVLVREAADLAQWIR 1090
Query: 274 REQVLNRYADFKSEARSKREKLEDSRRFQYFKRDADELESWIYEKLQAASDESYKETTNL 333
++ + AD E + E L+ ++F F D E + + A + T
Sbjct: 1091 DKENHAQIADVVGEDLEEVEVLQ--KKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEA 1148
Query: 334 QAKIQKH-----------QAFEAEVAAHSNAIVVLDNTGNDFYRDCEQAENWMSAREAFL 382
KIQ Q AE A+ + + F+RD ++ ++W++ + L
Sbjct: 1149 ALKIQTQMQDLNEKWNNLQTLTAEKASQLGSA----HEVQRFHRDIDETKDWIAEKANAL 1204
Query: 383 NAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQ 442
N +++ +V+ L +KHE ++ + A +KI L A++L+ + A+ K+K+
Sbjct: 1205 NNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKE 1264
Query: 443 VLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLAT-EESYKDPANIQS 501
+ + W + ++ +L +S LQ+F D ++ WI + L T +E D ++
Sbjct: 1265 INEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEA 1324
Query: 502 KHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKT 561
++HQ E+ A A + G L+ E ++ ++ +A E L +
Sbjct: 1325 LIERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPE--IKEKIEDLAKAREDLEKAW 1382
Query: 562 TEKSLKLKEANKQRTYIAAVKDLPYFSKKDCEQAENWMSAREAFLNAEEVDSKTDNVEAL 621
TE+ L+L++ + Y+ +DCE AE+WMSAREAFLNA++ + NVEAL
Sbjct: 1383 TERRLQLEQNLDLQLYM-----------RDCELAESWMSAREAFLNADDDANAGGNVEAL 1431
Query: 622 IKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEK 681
IKKHEDFDKAIN HE+KI ALQT+ADQLIA +HYA+ +D+KRKQVL+RWR LKE LIEK
Sbjct: 1432 IKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEK 1491
Query: 682 RSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANA 741
RSRLG+ QTLQQFSRDADE+ENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANA
Sbjct: 1492 RSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANA 1551
Query: 742 DRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTY 801
DRIQSVLAMG NLIDK+QC GSE+AVQ RL IADQWE+LT KTTEKSLKLKEANKQRTY
Sbjct: 1552 DRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTY 1611
Query: 802 IAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADS 861
IAAVKDLDFWLGEVESLLT+EDSGKDLASVQNL+KKHQLVEADI AH+DRIKDMN QADS
Sbjct: 1612 IAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADS 1671
Query: 862 LIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEK 921
L++SGQFD + IQEKRQSINERYERI NLAAHRQARLNEA TLHQFFRDIADEESWIKEK
Sbjct: 1672 LVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEK 1731
Query: 922 KLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQ 981
KLLVGSDDYGRDLTGVQNLKKKHKRLEAEL SH+PAIQ VQE GEKLMDVSNLGVPEIEQ
Sbjct: 1732 KLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQ 1791
Query: 982 RLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMA 1041
RLK LNQAW+ELK LAA RGQKLDESLTYQ FLA+VEEEEAWI+EKQQLLSVEDYGD+MA
Sbjct: 1792 RLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMA 1851
Query: 1042 AVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMA 1101
AVQGLLKKHDAFETDF+ H+DRC+ IC G++L+EAKNHH +SI QRCQQL+LKLDNL A
Sbjct: 1852 AVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSA 1911
Query: 1102 LATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDA 1161
LA +RK L+DNSAYLQFMWKADVVESWI DKE +V+S+E+GRDLSTVQTLLTKQETFDA
Sbjct: 1912 LAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDA 1971
Query: 1162 GLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQ 1221
GL+AFE EGI NIT LKDQL+ ++H Q+PAI+KRHGDVIARWQKL SN RK RLL MQ
Sbjct: 1972 GLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQ 2031
Query: 1222 EQFRQIEDLYLTFAKKASSFNKPQPLSRDMEMSLQDGRSYLEIPMPGNNVFSASSFNSWF 1281
EQFRQIE+LYLTFAKKAS+F NSWF
Sbjct: 2032 EQFRQIEELYLTFAKKASAF------------------------------------NSWF 2055
Query: 1282 ENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPY 1341
ENAEEDLTDPVRCNSIEEIRALR+AHAQFQASLSSA+ADF+ALAALDQ+IKSFNVGPNPY
Sbjct: 2056 ENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPY 2115
Query: 1342 TWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTS 1401
TWFTMEALE+TWRNLQKII+ERD ELAKEA RQ+END LRKEFAKHAN FHQWLTETRTS
Sbjct: 2116 TWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRTS 2175
Query: 1402 MMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQ 1461
MMEG+GSLEQQLEA++ KA EVR+RR DLKKIE+LGA+LEEHLILDNRYTEHSTVGLAQQ
Sbjct: 2176 MMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQ 2235
Query: 1462 WDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLR 1521
WDQLDQL MRMQHNLEQQIQARN SGVSED+LKEFSMMFKHFDKDKSGKLN EFKSCLR
Sbjct: 2236 WDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLR 2295
Query: 1522 ALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKET 1568
ALGYDLPMVEEGQPDPEFEAILD+VDPNRDG+VSLQEY+AFMISKET
Sbjct: 2296 ALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKET 2342
|
Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. Essential for larval survival and development. Stabilizes cell to cell interactions that are critical for the maintenance of cell shape and subcellular organization within embryonic tissues. Lva and spectrin may form a Golgi-based scaffold that mediates interaction of Golgi bodies with microtubules and facilitates Golgi-derived membrane secretion required for the formation of furrows during cellularization. Drosophila melanogaster (taxid: 7227) |
| >sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 | Back alignment and function description |
|---|
| >sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1575 | ||||||
| 242019111 | 2414 | Spectrin alpha chain, putative [Pediculu | 0.890 | 0.580 | 0.691 | 0.0 | |
| 383848574 | 2418 | PREDICTED: spectrin alpha chain-like iso | 0.890 | 0.580 | 0.689 | 0.0 | |
| 340711445 | 2433 | PREDICTED: spectrin alpha chain-like [Bo | 0.890 | 0.576 | 0.685 | 0.0 | |
| 383848576 | 2433 | PREDICTED: spectrin alpha chain-like iso | 0.890 | 0.576 | 0.683 | 0.0 | |
| 328777212 | 2433 | PREDICTED: spectrin alpha chain-like [Ap | 0.890 | 0.576 | 0.683 | 0.0 | |
| 380030028 | 2433 | PREDICTED: LOW QUALITY PROTEIN: spectrin | 0.890 | 0.576 | 0.683 | 0.0 | |
| 307169178 | 2418 | Spectrin alpha chain [Camponotus florida | 0.890 | 0.580 | 0.686 | 0.0 | |
| 322803122 | 2418 | hypothetical protein SINV_80128 [Solenop | 0.890 | 0.580 | 0.686 | 0.0 | |
| 189234352 | 2446 | PREDICTED: similar to spectrin [Triboliu | 0.890 | 0.573 | 0.688 | 0.0 | |
| 270002786 | 2415 | alpha spectrin [Tribolium castaneum] | 0.890 | 0.580 | 0.688 | 0.0 |
| >gi|242019111|ref|XP_002430009.1| Spectrin alpha chain, putative [Pediculus humanus corporis] gi|212515067|gb|EEB17271.1| Spectrin alpha chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 2004 bits (5192), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1032/1492 (69%), Positives = 1176/1492 (78%), Gaps = 90/1492 (6%)
Query: 96 YGKDEDSSEALLKKHEALVSDLEAFGNTILGLREQAQSCRQQETPVIDVTGKECVIALYD 155
YGKDEDSSEALLKKHEALVSDLEAF +TI L++QAQ+CRQQETPVIDVTGKECV+ALYD
Sbjct: 921 YGKDEDSSEALLKKHEALVSDLEAFDSTISALKKQAQACRQQETPVIDVTGKECVMALYD 980
Query: 156 YTEKSPREVSMKKSDVLTLLNSNNKDWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLAD 215
YTEKSPREVSMKK D+LTLLNSNN DWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLAD
Sbjct: 981 YTEKSPREVSMKKGDILTLLNSNNNDWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLAD 1040
Query: 216 VKEVKILETANDIQERREQVLNRYADFKSEARSKREKLEDITVKEVKILETAN------- 268
+ I R+ Q+ +Y+ A+ ++ KL++ V + E A
Sbjct: 1041 ---------NSSIAARQNQIEGQYSHLLGLAKERQNKLDETVKAYVLVREAAELANWIKD 1091
Query: 269 --------DIQERREQV---LNRYADFKSEARSKREKLEDSRRFQYFKRDADELESWIYE 317
D+ E EQV ++ DF+S+ ++ +L + + E+ +
Sbjct: 1092 KENYAEVEDVGEDLEQVEVLQKKFDDFQSDLKANEVRLAEMNEIAVQLMSIGQTEAAV-- 1149
Query: 318 KLQAASDESYKETTNLQAKIQKHQAFEAEVAAHSNAIVVLDNTGNDFYRDCEQAENWMSA 377
K+Q + +L K Q +E AA + + F+RD ++ ++W+
Sbjct: 1150 KIQT-------QIQDLNHKWASLQQLTSERAAQLGSA----HEVQRFHRDVDETKDWIQE 1198
Query: 378 REAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPID 437
++ LN +++ +V+AL +KHE ++ + A +KI L A++L+ A
Sbjct: 1199 KDQALNNDDLGKDLRSVQALQRKHEGLERDLAALGDKIRQLDETANRLMQTHPDTADQTF 1258
Query: 438 DKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQL-ATEESYKDP 496
K++++ + W L ++ +L +S LQ+F D ++ +WI + L ++EE D
Sbjct: 1259 AKQREINEEWTQLTAKANSRKEKLLDSYDLQRFLSDYRDLMSWITSMMGLVSSEELANDV 1318
Query: 497 ANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEF 556
++ ++HQ E+ A A Q+ GQ L+ E +Q +L S+ + +
Sbjct: 1319 TGAEALLERHQEHRTEIDARAGTFQAFELFGQQLLQAGHYASVE--IQEKLESMREARQE 1376
Query: 557 LTQKTTEKSLKLKEANKQRTYIAAVKDLPYFSKKDCEQAENWMSAREAFLNAEEVDSKTD 616
L + + ++L + + + + +DCEQAENWMSAREAFL +EEVDSK D
Sbjct: 1377 LEKAWVARRVQLDQNLELQLFY-----------RDCEQAENWMSAREAFLASEEVDSKGD 1425
Query: 617 NVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKE 676
NVEALIKKHEDFDKAINAHEEKI ALQTLADQL+AA+HYA+ ID+KRKQVLDRWR LKE
Sbjct: 1426 NVEALIKKHEDFDKAINAHEEKIAALQTLADQLMAANHYASNDIDEKRKQVLDRWRHLKE 1485
Query: 677 ALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAE 736
ALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAE
Sbjct: 1486 ALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAE 1545
Query: 737 LAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEAN 796
LAANADRIQSVLAMG NLIDK QC GSE+AVQAR+ASI +QWEFLTQKTTEK+LKLKEAN
Sbjct: 1546 LAANADRIQSVLAMGTNLIDKHQCAGSEDAVQARIASITEQWEFLTQKTTEKTLKLKEAN 1605
Query: 797 KQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMN 856
KQRTY+AAVKDLDFWLGEVESLLTSEDSGKDLASVQNL+KKHQLVEADI AH+DRIKDMN
Sbjct: 1606 KQRTYVAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLMKKHQLVEADISAHEDRIKDMN 1665
Query: 857 GQADSLIDSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEES 916
QADSLI+S QFD +SIQE+RQSINERYER+ NLAAHRQARLNEANTLHQFFRDIADEES
Sbjct: 1666 KQADSLIESQQFDTASIQERRQSINERYERVHNLAAHRQARLNEANTLHQFFRDIADEES 1725
Query: 917 WIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGV 976
WIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASH+PAIQ VQE GEKLMDVSNLGV
Sbjct: 1726 WIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHEPAIQAVQEAGEKLMDVSNLGV 1785
Query: 977 PEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDY 1036
PEIEQRLK LNQAW+ELKQLAA RGQKLDESLTYQ FLAKVEEEEAWISEKQQLLSVEDY
Sbjct: 1786 PEIEQRLKALNQAWAELKQLAATRGQKLDESLTYQQFLAKVEEEEAWISEKQQLLSVEDY 1845
Query: 1037 GDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKL 1096
GDTMAAVQGLLKKHDAFETDF+ H++RCADIC+AG++LIE +NHH+DSI QRCQQLQ KL
Sbjct: 1846 GDTMAAVQGLLKKHDAFETDFAAHKERCADICNAGSQLIEGENHHSDSIIQRCQQLQNKL 1905
Query: 1097 DNLMALATKRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQ 1156
D+L LA RK KLMDNSAYLQFMWKADVVESWIADKETHV+SEE+GRDLSTVQTLLTKQ
Sbjct: 1906 DHLSNLAAHRKAKLMDNSAYLQFMWKADVVESWIADKETHVRSEEFGRDLSTVQTLLTKQ 1965
Query: 1157 ETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQR 1216
ETFDAGLHAFEHEGIQNIT LKDQL+A+ HDQ+PAI+KRHG+VIARWQKLL DS+ARKQR
Sbjct: 1966 ETFDAGLHAFEHEGIQNITALKDQLIAAQHDQSPAILKRHGNVIARWQKLLADSDARKQR 2025
Query: 1217 LLRMQEQFRQIEDLYLTFAKKASSFNKPQPLSRDMEMSLQDGRSYLEIPMPGNNVFSASS 1276
LLRMQ+QFRQIE+LYLTFAKKAS+F
Sbjct: 2026 LLRMQDQFRQIEELYLTFAKKASAF----------------------------------- 2050
Query: 1277 FNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNV 1336
NSWFENAEEDLTDPVRCNSIEEIRALR+AHAQFQASLSSAQADFEALAALDQQIKSFNV
Sbjct: 2051 -NSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAQADFEALAALDQQIKSFNV 2109
Query: 1337 GPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAKHANAFHQWLT 1396
GPNPYTWFTMEALEDTWRNL+KIIKERD ELAKEA RQ+END LRKEFAKHANAFHQWLT
Sbjct: 2110 GPNPYTWFTMEALEDTWRNLKKIIKERDTELAKEAQRQEENDKLRKEFAKHANAFHQWLT 2169
Query: 1397 ETRTSMMEGTGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTV 1456
ETRTSMMEG+GSL+QQLEA K KA EVR+R+SDLK+IEDLGA+LEEHLILDNRYTEHSTV
Sbjct: 2170 ETRTSMMEGSGSLDQQLEATKSKATEVRARKSDLKRIEDLGALLEEHLILDNRYTEHSTV 2229
Query: 1457 GLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEF 1516
GLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSG+LN EF
Sbjct: 2230 GLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGRLNHQEF 2289
Query: 1517 KSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKET 1568
KSCLRALGYDLPM+EEGQPDPEFE ILD+VD NRDG VSL+EYM FMI KET
Sbjct: 2290 KSCLRALGYDLPMMEEGQPDPEFEDILDVVDRNRDGFVSLKEYMTFMIRKET 2341
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383848574|ref|XP_003699924.1| PREDICTED: spectrin alpha chain-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340711445|ref|XP_003394286.1| PREDICTED: spectrin alpha chain-like [Bombus terrestris] gi|350416216|ref|XP_003490877.1| PREDICTED: spectrin alpha chain-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383848576|ref|XP_003699925.1| PREDICTED: spectrin alpha chain-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328777212|ref|XP_623691.2| PREDICTED: spectrin alpha chain-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380030028|ref|XP_003698661.1| PREDICTED: LOW QUALITY PROTEIN: spectrin alpha chain-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307169178|gb|EFN61994.1| Spectrin alpha chain [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322803122|gb|EFZ23210.1| hypothetical protein SINV_80128 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|189234352|ref|XP_973750.2| PREDICTED: similar to spectrin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270002786|gb|EEZ99233.1| alpha spectrin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1575 | ||||||
| FB|FBgn0250789 | 2415 | alpha-Spec "alpha Spectrin" [D | 0.711 | 0.464 | 0.635 | 0.0 | |
| WB|WBGene00004951 | 2432 | spc-1 [Caenorhabditis elegans | 0.710 | 0.460 | 0.488 | 0.0 | |
| UNIPROTKB|F1NHT3 | 2465 | SPTAN1 "Spectrin alpha chain, | 0.774 | 0.494 | 0.449 | 0.0 | |
| UNIPROTKB|Q13813 | 2472 | SPTAN1 "Spectrin alpha chain, | 0.773 | 0.493 | 0.444 | 0.0 | |
| UNIPROTKB|F1NIU0 | 2470 | SPTAN1 "Spectrin alpha chain, | 0.774 | 0.493 | 0.447 | 0.0 | |
| UNIPROTKB|F1NHF0 | 2479 | SPTAN1 "Spectrin alpha chain, | 0.774 | 0.492 | 0.447 | 0.0 | |
| UNIPROTKB|E1BFB0 | 2472 | SPTAN1 "Uncharacterized protei | 0.773 | 0.493 | 0.444 | 0.0 | |
| RGD|621714 | 2472 | Sptan1 "spectrin, alpha, non-e | 0.773 | 0.493 | 0.441 | 0.0 | |
| MGI|MGI:98386 | 2472 | Sptan1 "spectrin alpha, non-er | 0.773 | 0.493 | 0.441 | 0.0 | |
| UNIPROTKB|A6NG51 | 2477 | SPTAN1 "Spectrin alpha chain, | 0.773 | 0.492 | 0.443 | 0.0 |
| FB|FBgn0250789 alpha-Spec "alpha Spectrin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 3571 (1262.1 bits), Expect = 0., Sum P(2) = 0.
Identities = 736/1158 (63%), Positives = 885/1158 (76%)
Query: 96 YGKDEDSSEALLKKHEALVSDLEAFGNTILGLREQAQSCRQQETPVIDVTGKECVIALYD 155
YGKDEDSSEALLKKHEALVSDLEAFGNTI L+EQA++CRQQETPV+D+TGKECV+ALYD
Sbjct: 921 YGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYD 980
Query: 156 YTEKSPREVSMKKSDVLTLLNSNNKDWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLAD 215
YTEKSPREVSMKK DVLTLLNSNNKDWWKVEVNDRQGFVPAAY+KK++AGL+ASQQNL D
Sbjct: 981 YTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVD 1040
Query: 216 VKEVKILETANDIQERREQVLNRYADFKSEARSKREKLEDITVKEVKILETANDIQE--R 273
+ I +R+ Q+ ++Y + + AR ++ KL + TVK ++ A D+ + R
Sbjct: 1041 ---------NHSIAKRQNQINSQYDNLLALARERQNKLNE-TVKAYVLVREAADLAQWIR 1090
Query: 274 REQVLNRYADFKSEARSKREKLEDSRRFQYFKRD--ADELE----SWIYEKLQAA--SDE 325
++ + AD E + E L+ ++F F D A+E+ + I +L + ++
Sbjct: 1091 DKENHAQIADVVGEDLEEVEVLQ--KKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEA 1148
Query: 326 SYKETTNLQAKIQKHQAFEAEVAAHSNAIVVLDNTGNDFYRDCEQAENWMSAREAFLNAE 385
+ K T +Q +K + A ++ + F+RD ++ ++W++ + LN +
Sbjct: 1149 ALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQR-FHRDIDETKDWIAEKANALNND 1207
Query: 386 EVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLD 445
++ +V+ L +KHE ++ + A +KI L A++L+ + A+ K+K++ +
Sbjct: 1208 DLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINE 1267
Query: 446 RWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLAT-EESYKDPANIQSKHQ 504
W + ++ +L +S LQ+F D ++ WI + L T +E D ++ +
Sbjct: 1268 MWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIE 1327
Query: 505 KHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEK 564
+HQ E+ A A + G L+ E ++ ++ +A E L + TE+
Sbjct: 1328 RHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPE--IKEKIEDLAKAREDLEKAWTER 1385
Query: 565 SLKLKEANKQRTYIAAVKDLPYFSKKDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKK 624
L+L E N DL + + DCE AE+WMSAREAFLNA++ + NVEALIKK
Sbjct: 1386 RLQL-EQNL---------DLQLYMR-DCELAESWMSAREAFLNADDDANAGGNVEALIKK 1434
Query: 625 HEDFDKAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSR 684
HEDFDKAIN HE+KI ALQT+ADQLIA +HYA+ +D+KRKQVL+RWR LKE LIEKRSR
Sbjct: 1435 HEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSR 1494
Query: 685 LGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRI 744
LG+ QTLQQFSRDADE+ENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRI
Sbjct: 1495 LGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRI 1554
Query: 745 QSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIAA 804
QSVLAMG NLIDK+QC GSE+AVQ RL IADQWE+LT KTTEKSLKLKEANKQRTYIAA
Sbjct: 1555 QSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAA 1614
Query: 805 VKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLID 864
VKDLDFWLGEVESLLT+EDSGKDLASVQNL+KKHQLVEADI AH+DRIKDMN QADSL++
Sbjct: 1615 VKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVE 1674
Query: 865 SGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLL 924
SGQFD + IQEKRQSINERYERI NLAAHRQARLNEA TLHQFFRDIADEESWIKEKKLL
Sbjct: 1675 SGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLL 1734
Query: 925 VGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGVPEIEQRLK 984
VGSDDYGRDLTGVQNLKKKHKRLEAEL SH+PAIQ VQE GEKLMDVSNLGVPEIEQRLK
Sbjct: 1735 VGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLK 1794
Query: 985 LLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQ 1044
LNQAW+ELK LAA RGQKLDESLTYQ FLA+VEEEEAWI+EKQQLLSVEDYGD+MAAVQ
Sbjct: 1795 ALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQ 1854
Query: 1045 GLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALAT 1104
GLLKKHDAFETDF+ H+DRC+ IC G++L+EAKNHH +SI QRCQQL+LKLDNL ALA
Sbjct: 1855 GLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAA 1914
Query: 1105 KRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLH 1164
+RK L+DNSAYLQFMWKADVVESWI DKE +V+S+E+GRDLSTVQTLLTKQETFDAGL+
Sbjct: 1915 RRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLN 1974
Query: 1165 AFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQF 1224
AFE EGI NIT LKDQL+ ++H Q+PAI+KRHGDVIARWQKL SN RK RLL MQEQF
Sbjct: 1975 AFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQF 2034
Query: 1225 RQIEDLYLTFAKKASSFN 1242
RQIE+LYLTFAKKAS+FN
Sbjct: 2035 RQIEELYLTFAKKASAFN 2052
|
|
| WB|WBGene00004951 spc-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHT3 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13813 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIU0 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHF0 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BFB0 SPTAN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|621714 Sptan1 "spectrin, alpha, non-erythrocytic 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98386 Sptan1 "spectrin alpha, non-erythrocytic 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NG51 SPTAN1 "Spectrin alpha chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P13395 | SPTCA_DROME | No assigned EC number | 0.6698 | 0.8939 | 0.5830 | yes | N/A |
| P16546 | SPTN1_MOUSE | No assigned EC number | 0.5484 | 0.8996 | 0.5732 | yes | N/A |
| P16086 | SPTN1_RAT | No assigned EC number | 0.5484 | 0.8996 | 0.5732 | yes | N/A |
| P07751 | SPTN1_CHICK | No assigned EC number | 0.5473 | 0.8952 | 0.5692 | yes | N/A |
| Q13813 | SPTN1_HUMAN | No assigned EC number | 0.5516 | 0.8996 | 0.5732 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1575 | |||
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 5e-43 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 7e-40 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 1e-35 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 4e-35 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 3e-34 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 3e-30 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 1e-29 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 2e-29 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 2e-23 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 1e-22 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 7e-19 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 3e-18 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 8e-18 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 2e-17 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-17 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-16 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 5e-16 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 7e-16 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 9e-16 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 9e-16 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 6e-15 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 2e-14 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-14 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-14 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 6e-14 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 9e-14 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 3e-13 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 5e-13 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 1e-12 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 4e-12 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 5e-12 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 2e-11 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-11 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 4e-11 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 2e-10 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 3e-10 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 4e-10 | |
| cd00176 | 213 | cd00176, SPEC, Spectrin repeats, found in several | 5e-10 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 1e-09 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 1e-09 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 2e-09 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 3e-09 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 3e-09 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 4e-09 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 6e-09 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 7e-09 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 7e-09 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 1e-08 | |
| cd11888 | 54 | cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o | 1e-08 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 1e-08 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 2e-08 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 3e-08 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 4e-08 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 5e-08 | |
| cd11869 | 54 | cd11869, SH3_p40phox, Src Homology 3 domain of the | 6e-08 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 8e-08 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 8e-08 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 9e-08 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 1e-07 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 2e-07 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 2e-07 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 2e-07 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 2e-07 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 4e-07 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 5e-07 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 6e-07 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 6e-07 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 6e-07 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 7e-07 | |
| pfam00435 | 105 | pfam00435, Spectrin, Spectrin repeat | 1e-06 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 1e-06 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 1e-06 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 1e-06 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 1e-06 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 2e-06 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 2e-06 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 2e-06 | |
| cd12141 | 57 | cd12141, SH3_DNMBP_C2, Second C-terminal Src homol | 2e-06 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 2e-06 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 3e-06 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 3e-06 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 4e-06 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 4e-06 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 4e-06 | |
| cd11941 | 57 | cd11941, SH3_ARHGEF37_C2, Second C-terminal Src ho | 4e-06 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 4e-06 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 5e-06 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 5e-06 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 6e-06 | |
| cd12003 | 62 | cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr | 6e-06 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 7e-06 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 7e-06 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 7e-06 | |
| cd11973 | 73 | cd11973, SH3_ASEF, Src homology 3 domain of APC-St | 7e-06 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 7e-06 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 8e-06 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 9e-06 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 9e-06 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 9e-06 | |
| cd12015 | 53 | cd12015, SH3_Tks_1, First Src homology 3 domain of | 9e-06 | |
| cd11974 | 54 | cd11974, SH3_ASEF2, Src homology 3 domain of APC-S | 1e-05 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 1e-05 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 1e-05 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 1e-05 | |
| cd12002 | 57 | cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( | 1e-05 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 1e-05 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 1e-05 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 1e-05 | |
| smart00150 | 101 | smart00150, SPEC, Spectrin repeats | 2e-05 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 2e-05 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 2e-05 | |
| cd11897 | 55 | cd11897, SH3_SNX18, Src Homology 3 domain of Sorti | 2e-05 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 2e-05 | |
| cd12000 | 57 | cd12000, SH3_CASS4, Src homology 3 domain of CAS ( | 3e-05 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 3e-05 | |
| cd12008 | 56 | cd12008, SH3_Src, Src homology 3 domain of Src Pro | 4e-05 | |
| cd11848 | 55 | cd11848, SH3_SLAP-like, Src homology 3 domain of S | 5e-05 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 5e-05 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 6e-05 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 6e-05 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 7e-05 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 7e-05 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 1e-04 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 1e-04 | |
| cd12011 | 55 | cd12011, SH3_SLAP2, Src homology 3 domain of Src-L | 1e-04 | |
| cd12016 | 54 | cd12016, SH3_Tks_2, Second Src homology 3 domain o | 1e-04 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 2e-04 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 2e-04 | |
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 2e-04 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 2e-04 | |
| cd11757 | 52 | cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 | 2e-04 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 2e-04 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 2e-04 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 2e-04 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 3e-04 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 3e-04 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 3e-04 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 3e-04 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 3e-04 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 3e-04 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 3e-04 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 4e-04 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 4e-04 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 5e-04 | |
| cd11864 | 58 | cd11864, SH3_PEX13_eumet, Src Homology 3 domain of | 5e-04 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 5e-04 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 6e-04 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 6e-04 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 6e-04 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 7e-04 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 7e-04 | |
| cd12021 | 53 | cd12021, SH3_p47phox_1, First or N-terminal Src ho | 7e-04 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 8e-04 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 8e-04 | |
| cd11850 | 56 | cd11850, SH3_Abl, Src homology 3 domain of the Pro | 8e-04 | |
| cd12143 | 57 | cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho | 9e-04 | |
| cd12024 | 53 | cd12024, SH3_NoxO1_2, Second or C-terminal Src hom | 9e-04 | |
| cd11899 | 58 | cd11899, SH3_Nck2_1, First Src Homology 3 domain o | 0.001 | |
| cd11957 | 52 | cd11957, SH3_RUSC2, Src homology 3 domain of RUN a | 0.001 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 0.001 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 0.001 | |
| cd12069 | 57 | cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rh | 0.001 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 0.001 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 0.002 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 0.002 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 0.002 | |
| cd12077 | 54 | cd12077, SH3_Tks5_2, Second Src homology 3 domain | 0.002 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 0.002 | |
| cd11900 | 59 | cd11900, SH3_Nck1_1, First Src Homology 3 domain o | 0.002 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 0.002 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 0.003 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 0.003 | |
| pfam13833 | 53 | pfam13833, EF_hand_6, EF-hand domain pair | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 0.004 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 0.004 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 0.004 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 0.004 | |
| cd12074 | 53 | cd12074, SH3_Tks5_1, First Src homology 3 domain o | 0.004 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 0.004 |
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 156 bits (395), Expect = 5e-43
Identities = 89/206 (43%), Positives = 138/206 (66%), Gaps = 1/206 (0%)
Query: 804 AVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLI 863
+L+ WL E E LL+S D G DL SV+ L+KKH+ +EA++ AH++R++ +N + LI
Sbjct: 8 DADELEAWLSEKEELLSSTDYGDDLESVEALLKKHEALEAELAAHEERVEALNELGEQLI 67
Query: 864 DSGQFDASSIQEKRQSINERYERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKL 923
+ G DA IQE+ + +N+R+E ++ LA R+ RL EA L QFFRD D E W++EK+
Sbjct: 68 EEGHPDAEEIQERLEELNQRWEELRELAEERRQRLEEALDLQQFFRDADDLEQWLEEKEA 127
Query: 924 LVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETGEKLMDVSNLGV-PEIEQR 982
+ S+D G+DL V+ L KKHK LE EL +H+P ++++ E E+L++ + EIE++
Sbjct: 128 ALASEDLGKDLESVEELLKKHKELEEELEAHEPRLKSLNELAEELLEEGHPDADEEIEEK 187
Query: 983 LKLLNQAWSELKQLAANRGQKLDESL 1008
L+ LN+ W EL +LA R +KL+E+L
Sbjct: 188 LEELNERWEELLELAEERQKKLEEAL 213
|
Length = 213 |
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212874 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37 | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|197544 smart00150, SPEC, Spectrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18 | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor Protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|213019 cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|213002 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rho GTPase-activating protein 27 | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1575 | |||
| KOG0040|consensus | 2399 | 100.0 | ||
| KOG0517|consensus | 2473 | 100.0 | ||
| KOG0517|consensus | 2473 | 100.0 | ||
| KOG0040|consensus | 2399 | 100.0 | ||
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 99.74 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 99.74 | |
| KOG0035|consensus | 890 | 99.65 | ||
| KOG4286|consensus | 966 | 99.57 | ||
| KOG4286|consensus | 966 | 99.54 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.17 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.08 | |
| smart00150 | 101 | SPEC Spectrin repeats. | 99.06 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 99.04 | |
| smart00150 | 101 | SPEC Spectrin repeats. | 99.03 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 98.98 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 98.98 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.96 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.91 | |
| KOG0027|consensus | 151 | 98.89 | ||
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.8 | |
| KOG0027|consensus | 151 | 98.79 | ||
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 98.78 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.75 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.73 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.73 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.71 | |
| KOG0028|consensus | 172 | 98.68 | ||
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.66 | |
| KOG0037|consensus | 221 | 98.66 | ||
| KOG0030|consensus | 152 | 98.6 | ||
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.59 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.57 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.56 | |
| KOG0028|consensus | 172 | 98.55 | ||
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.53 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.53 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.35 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.26 | |
| PTZ00183 | 158 | centrin; Provisional | 98.23 | |
| PTZ00183 | 158 | centrin; Provisional | 98.23 | |
| KOG0030|consensus | 152 | 98.23 | ||
| KOG0031|consensus | 171 | 98.2 | ||
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.2 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.19 | |
| KOG0041|consensus | 244 | 98.18 | ||
| PTZ00184 | 149 | calmodulin; Provisional | 98.16 | |
| KOG0031|consensus | 171 | 98.12 | ||
| KOG4240|consensus | 1025 | 98.11 | ||
| KOG0044|consensus | 193 | 98.04 | ||
| KOG0034|consensus | 187 | 98.03 | ||
| KOG0036|consensus | 463 | 98.03 | ||
| KOG4240|consensus | 1025 | 98.0 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.91 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 97.84 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.83 | |
| KOG0994|consensus | 1758 | 97.81 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.74 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.69 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 97.67 | |
| KOG0044|consensus | 193 | 97.66 | ||
| KOG0994|consensus | 1758 | 97.6 | ||
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 97.58 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 97.54 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.54 | |
| KOG0036|consensus | 463 | 97.47 | ||
| KOG0038|consensus | 189 | 97.3 | ||
| KOG0377|consensus | 631 | 97.28 | ||
| KOG0046|consensus | 627 | 97.24 | ||
| KOG0161|consensus | 1930 | 97.15 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.95 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.94 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.89 | |
| KOG4065|consensus | 144 | 96.72 | ||
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 96.69 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.62 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.61 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.58 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 96.44 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 96.44 | |
| KOG0037|consensus | 221 | 96.39 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.31 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.21 | |
| KOG0034|consensus | 187 | 96.2 | ||
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 95.64 | |
| KOG0035|consensus | 890 | 95.55 | ||
| KOG4223|consensus | 325 | 95.29 | ||
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 95.11 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 95.02 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.89 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 94.33 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 94.11 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 93.74 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 93.72 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.38 | |
| KOG1955|consensus | 737 | 93.17 | ||
| KOG4251|consensus | 362 | 93.09 | ||
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 92.98 | |
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 92.62 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 92.27 | |
| PF14643 | 473 | DUF4455: Domain of unknown function (DUF4455) | 92.06 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 91.95 | |
| KOG4223|consensus | 325 | 91.72 | ||
| KOG2643|consensus | 489 | 91.6 | ||
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 91.14 | |
| KOG0042|consensus | 680 | 90.23 | ||
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 90.18 | |
| KOG0161|consensus | 1930 | 89.87 | ||
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 89.19 | |
| KOG2243|consensus | 5019 | 88.38 | ||
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 88.11 | |
| KOG0971|consensus | 1243 | 87.69 | ||
| KOG4673|consensus | 961 | 87.12 | ||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 86.56 | |
| KOG0377|consensus | 631 | 85.76 | ||
| KOG1029|consensus | 1118 | 85.31 | ||
| KOG2562|consensus | 493 | 85.21 | ||
| KOG4674|consensus | 1822 | 85.11 | ||
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 84.27 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 84.02 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 83.92 | |
| KOG4666|consensus | 412 | 83.02 | ||
| KOG3866|consensus | 442 | 82.9 | ||
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 81.7 | |
| COG5069 | 612 | SAC6 Ca2+-binding actin-bundling protein fimbrin/p | 81.03 | |
| KOG4578|consensus | 421 | 80.92 | ||
| KOG3555|consensus | 434 | 80.86 |
| >KOG0040|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-142 Score=1259.26 Aligned_cols=1494 Identities=59% Similarity=0.902 Sum_probs=1427.9
Q ss_pred hHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhccccccCChHhHHHHHHHHHHHHHHHHhhHHH
Q psy6935 2 EQIVHLWESLATATEKKGNKLQEASQQQGFNRTIEDIELWLSEIEGQLMSEDYGKDLTSVQNLQKKHALLEADVASHLDR 81 (1575)
Q Consensus 2 ~~l~~~w~~L~~~~~~r~~~L~~~~~~~~f~~~~~~~~~Wl~e~~~~l~s~~~g~dl~~v~~~l~kh~~le~ei~~~~~~ 81 (1575)
++|..+|+.|-+....|+.+|-++++..+.|++.++...|+.|+++...|+..|+|+-++..++.+|..+-++|.+|.++
T Consensus 760 e~L~~r~eal~dp~a~rk~Kl~d~l~~~~l~rd~edE~awi~E~E~~a~st~~gkdlI~~qnl~~k~q~~~~~ia~he~r 839 (2399)
T KOG0040|consen 760 ENLVARYEALKEPLATRKQKLLDSLQLQQLFRDTEDEEAWIREKEPIAASTNRGKDLIGVQNLLKKHQALLAEIANHEPR 839 (2399)
T ss_pred HHHHHHHhhhhchhHHHHHHHHHHhhhhhhhhchHHHHHHHhhcchhccchhcchhHHHHHHHHHHHHHHHHHHhcccHH
Confidence 47889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHH----------------------------------------------------------------HhhC
Q psy6935 82 IESVKAATEQFL----------------------------------------------------------------EHYG 97 (1575)
Q Consensus 82 ~~~~~~~~~~l~----------------------------------------------------------------~~~g 97 (1575)
+.+|.+.|..|+ .+||
T Consensus 840 i~~i~~r~~~m~~~~~f~aedvk~~~~~L~~~~~slk~ka~~r~~dle~s~q~~qy~ad~~eae~w~~ekEpi~~stdyg 919 (2399)
T KOG0040|consen 840 IQEVTSRGNKMVEEGHFAAEDVRSRLKSLNQNWESLKAKASQRRQDLEDSLQAQQYLADANEAESWMREKEPIVGSTDYG 919 (2399)
T ss_pred HHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHhcccchhhHHHHHHHHHHHhhHHHHhhccCccccccccc
Confidence 999999999776 4699
Q ss_pred CCcccHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhccCCccccchhHHHHHHhhhccccchhhhhcchhhHHHHHhh
Q psy6935 98 KDEDSSEALLKKHEALVSDLEAFGNTILGLREQAQSCRQQETPVIDVTGKECVIALYDYTEKSPREVSMKKSDVLTLLNS 177 (1575)
Q Consensus 98 ~~~~~~~~ll~~~~~~~~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~l~~ 177 (1575)
+|++++.+++++|.++..++.+|...|++|+.++..|+.|..|+... .+.+++++|+|...||+|+.++++++..++++
T Consensus 920 Kdedsa~allkkhea~~~dl~af~~~i~~lr~qa~~cq~Q~tpv~~~-g~~~v~alyd~q~kSprev~mKkgDvltll~s 998 (2399)
T KOG0040|consen 920 KDEDSAEALLKKHEALLSDLEAFGDSIQALREQANACRQQEAPVEDV-GKECVLALYDYQEKSPREVTMKKGDVLTLLNS 998 (2399)
T ss_pred chhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhhccCCchhhH-HHHHHHHHHHHHhcCHHHHHHhhhhHHHHHhh
Confidence 99999999999999999999999999999999999999888888887 88999999999999999999999999999999
Q ss_pred cCcchhHHhhccccccchhhHHHhhhhhhhhhhhhhhhHHHHHhhhccccHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy6935 178 NNKDWWKVEVNDRQGFVPAAYVKKMEAGLTASQQNLADVKEVKILETANDIQERREQVLNRYADFKSEARSKREKLEDIT 257 (1575)
Q Consensus 178 ~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~~~~~l~~~~~~r~~~L~~~~ 257 (1575)
.++.||+++++.+.+|+|..|++.+.+. ....+.+.+ ..+|..++.++..+|.++.....+|+++|.. .
T Consensus 999 ~nkdwwkve~~d~qg~vpa~yvk~~~~~-~~~~~~l~~---------~~~i~~rq~qi~~qyr~lld~~~er~~~l~k-~ 1067 (2399)
T KOG0040|consen 999 INKDWWKVEVNDRQGFVPAAYVKRLDPG-SASQPNLRR---------EESIAQRQEQIENQYRSLLDLAEERKRKLEE-R 1067 (2399)
T ss_pred cccccccchhhhhcCcchHHHHHHhccC-CcchHHHHH---------HHHHHhhHHHHHHHHHHHHhchHHHHHHHHH-H
Confidence 9999999999999999999999999988 444443333 2488899999999999999999999999999 9
Q ss_pred HhHHHHHhhhhhHHHHHHHHHhHHhhhHHHHHHhcCChhhhHHHH-HhHhhHHHHHhhH-----------HHHHhhcccc
Q psy6935 258 VKEVKILETANDIQERREQVLNRYADFKSEARSKREKLEDSRRFQ-YFKRDADELESWI-----------YEKLQAASDE 325 (1575)
Q Consensus 258 ~~~~~~~~~~~~~~~~~~Wl~~~~~~l~~~~~~~~~~l~~~~~l~-~~~~~~~el~~~~-----------~l~~~~~~~~ 325 (1575)
+..|.+.++ ..++..||.+++... . +.+++.|..++ +|.+|..++.+++ .|.+.|.+..
T Consensus 1068 ~ke~~l~~e---a~dl~~wi~ekE~~~----~--~vdle~V~~lqkKfddf~~dlkane~rLre~n~vAd~l~~~g~t~~ 1138 (2399)
T KOG0040|consen 1068 CKEFLLARE---ANDLAEWIQEKEAEN----T--EVDLEQVEVLQKKFDDFQKDLKANEVRLRDINKVADDLTSEGQTEE 1138 (2399)
T ss_pred HHHHHHHHH---hhhhHHHHHHHHHHh----c--cccHHHHHHHHHHHHHhhhhhccChHHHHHHHHHHHhccccccCHH
Confidence 999988777 889999998877221 1 55899999999 9999999999872 2222333334
Q ss_pred chHhHHHHHHHHHHHHHHHHHHHHHhHhhHhhhhhHhHHHHhHHHHHHHHHHHHHhhccccCCCCHHHHHHHHHHHHHHH
Q psy6935 326 SYKETTNLQAKIQKHQAFEAEVAAHSNAIVVLDNTGNDFYRDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFD 405 (1575)
Q Consensus 326 ~~~i~~~L~~~w~~L~~~~~~r~~~L~~~l~~~~~~~~f~~~~~~l~~WL~~~e~~l~~~~~~~~~~~~~~~l~~~~~l~ 405 (1575)
+..|++.++.+|..|.....+|.+.|..+ ..++.|+.+.+....|+.++-..|...++|.++.+++...++|.+|.
T Consensus 1139 ~~~irqqln~rw~~Lqr~~~E~~q~lgsa----hevq~fhrd~detk~~i~ek~~al~~~d~g~dl~svQalqrkheg~e 1214 (2399)
T KOG0040|consen 1139 AAQIRQQLNARWRSLQRLAEERRQLLGSA----HEVQRFHRDADETKEWIEEKCQALNADDPGSDLRSVQALQRKHEGFE 1214 (2399)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhhH----HHHHHHHHhhHHHHHHHHHHHHhhccccccchHHHHHHHHHHhccch
Confidence 45688899999999999999999999999 99999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhHHHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhHHHHHHHHHHHHHHHHHHH
Q psy6935 406 KAINAHEEKIGALQTLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKL 485 (1575)
Q Consensus 406 ~~l~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~l~~L~~rw~~l~~~~~~r~~~L~~~~~~~~f~~~~~el~~Wl~~~~ 485 (1575)
+++.+...+|..|...+..|.+++|..+..++.+..+++..|..|......|..+|..+..++.|..+..++..|+..+.
T Consensus 1215 rdla~L~Dkvt~l~e~a~rLtqshp~~aeq~q~qk~elne~w~dl~s~~~~Rkekl~ds~d~~rfLs~~rdl~~wi~sm~ 1294 (2399)
T KOG0040|consen 1215 RDLAALGDKVTSLGETAERLSQSHPDAAEDLQRKQMELNEAWEDLQGRAKDRKEKLLDSYDLQRFLSDYRDLMNWINSIG 1294 (2399)
T ss_pred hchHHHhhHHHHHHHHHHHhhhcCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhc-cccCCChhHHHHHHHHHHHHHHHHHhcHHHHHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6935 486 QLAT-EESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEK 564 (1575)
Q Consensus 486 ~~l~-~~~~~d~~~~~~~l~~~~~l~~el~~~~~~l~~l~~~g~~L~~~~~~~~~~~~i~~~l~~l~~~w~~L~~~~~~r 564 (1575)
.... .+.+.|+..+...+..|+....++..+.+.+..+...|..++.+++.++|+ |..++.. +.....
T Consensus 1295 ~lvss~ela~d~tg~eAllerhqe~rte~daRa~tfqA~eqf~~~ll~~~h~As~e--ie~kl~~-------~~l~r~-- 1363 (2399)
T KOG0040|consen 1295 GLVSSQELANDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGNELLDSGHYASPE--IEKKLQA-------VKLERD-- 1363 (2399)
T ss_pred chhhhHHHhhhhhhHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhccCcCCHH--HHHHHHH-------HHhhcc--
Confidence 8888 888999999999999999999999999999999999999999999999998 8888876 333333
Q ss_pred HHHHHHHHHHH-HHHHHhhccchhchhhHHHHHHHHHHHHHhhccccCCCCHHHHHHHHHHHHHHHHHHHHhHHHHHHHH
Q psy6935 565 SLKLKEANKQR-TYIAAVKDLPYFSKKDCEQAENWMSAREAFLNAEEVDSKTDNVEALIKKHEDFDKAINAHEEKIGALQ 643 (1575)
Q Consensus 565 ~~~L~~~~~~r-~~L~q~~~~~~f~~~~~~~l~~wL~~~E~~L~~~~~~~~~~~~~~~l~~~~~l~~~l~~~~~~~~~l~ 643 (1575)
.++.+|..| ..+++|++++.|. +++.+...|+..-|.++ ..+.+ +.+.+.+++++|.+|...+..+..++..+.
T Consensus 1364 --~le~awv~rr~~ldq~lelqLf~-~dceq~e~~maare~~l-~dD~~-s~D~veAl~kk~edfdkAi~~qeqkit~l~ 1438 (2399)
T KOG0040|consen 1364 --DLEKAWVKRRKILDQCLELQLFQ-RDCEQAESWMSAREAFL-ADDKS-SLDSVEALIKKHEDFDKAINAQEEKIAALQ 1438 (2399)
T ss_pred --chHHHHHHHHHHHHhhhhHHHHH-hhhHHHHHHHHHHHHhh-ccccc-ccchHHHHHHHHHHHHHhhhhhHHHHHHHH
Confidence 889999999 9999999999999 99999999999999999 66666 899999999999999999999999999999
Q ss_pred HhHHHhhhcCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHhHhhHHHHHHHhhHHHHHHHHHHHHhhhhccCCCChhhH
Q psy6935 644 TLADQLIAADHYAAKPIDDKRKQVLDRWRLLKEALIEKRSRLGESQTLQQFSRDADEMENWIAEKLQLATEESYKDPANI 723 (1575)
Q Consensus 644 ~~a~~L~~~~~~~~~~i~~~~~~l~~r~~~l~~~~~~r~~~Le~~~~l~~f~~~~~el~~Wl~e~~~~~~~~~~~d~~~l 723 (1575)
..+..|+..+||+.+.|..+...+..||..+...+.+.+..|-.+..+++|..++.++..|+.|+.+.+.+++|.||+++
T Consensus 1439 ~~a~~lia~~hya~e~i~~~R~~vlDrwr~lk~~Li~krtklg~~qTlqqf~rd~deiE~wi~Ek~~~a~eesykD~tni 1518 (2399)
T KOG0040|consen 1439 HFAESLIADNHYAKEEIATRRQQVLDRWRALKAQLIEKRSKLGDSQTLQQFSRDADEIENWISEKLQTACDESYKDPTNI 1518 (2399)
T ss_pred HHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHhhHHHHHHHHHHHHHHhhhhcccCcHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhHhccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6935 724 QSKHQKHQAFEAELAANADRIQSVLAMGQNLIDKRQCVGSEEAVQARLASIADQWEFLTQKTTEKSLKLKEANKQRTYIA 803 (1575)
Q Consensus 724 ~~~l~~~q~l~~el~~~~~~l~~l~~~g~~L~~~~~~~~~~~~i~~~l~~l~~~w~~L~~~~~~r~~~L~~~~~~~~f~~ 803 (1575)
+..-++|++|.++|.++...+..++..|..+++. .|.+....+..++..+...|+-+.....++..+|.++.....|..
T Consensus 1519 q~k~qk~qaf~~el~~~sd~i~~vi~~gN~lie~-~c~g~e~a~~~~l~~l~d~w~~l~~~t~ek~~klKea~kq~~f~t 1597 (2399)
T KOG0040|consen 1519 QSKHQKHQAFEAELHANSDRIHGVINMGNSLIER-SCDGNEDAVKARLEQLADQWDHLVEKTTEKSKKLKEANKQQRFNT 1597 (2399)
T ss_pred HHHHHHHHHHHHHHHhhHHHHHHHHHhccccchh-hhcccHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999998 677888999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhhcCCCChHHHHHHHHHHHHH
Q psy6935 804 AVKDLDFWLGEVESLLTSEDSGKDLASVQNLIKKHQLVEADIQAHDDRIKDMNGQADSLIDSGQFDASSIQEKRQSINER 883 (1575)
Q Consensus 804 ~l~~l~~WL~~~e~~L~~~~~~~d~~~~~~~l~~~~~l~~ei~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~~~~l~~r 883 (1575)
.+.++.-|+.+++..|.+.++|.|+.++..+|++|+.++.++.++.+.+..++..+..++.++.++...|.++...++.|
T Consensus 1598 ~Ikd~~fwl~eve~ll~~ed~~kdLasv~nlLkkhqlle~di~a~ed~~kd~n~qadSll~s~~f~~~~i~dkr~~i~~r 1677 (2399)
T KOG0040|consen 1598 AIKDLEFWLSEVETLLASEDYGKDLASVGNLLKKHQLLEADIVAHEDRLKDLNTQADSLLESGQFDTDQIVEKRDNINKR 1677 (2399)
T ss_pred HHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHhhcccchhhHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCCCCHHHHHHHHHHHHHHHHHHhhchhhHHHHHH
Q psy6935 884 YERIKNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQE 963 (1575)
Q Consensus 884 ~~~L~~~~~~R~~~Le~~~~~~~f~~~~~~~~~Wl~e~~~~~~~~~~~~~~~~~~~~l~k~~~l~~el~~~~~~~~~l~~ 963 (1575)
|.++...+..|+..|.+++.+++|++++.+...||.++...+++.+||.++..|+.+.++|+.+..++.+|+|.++.|..
T Consensus 1678 ~~~V~~laa~~r~kl~ea~~L~qff~d~~Deeswikek~l~V~sedygrdl~gVqnl~kkhkrle~el~~hepaiQ~v~~ 1757 (2399)
T KOG0040|consen 1678 FLNVKELAAARRAKLNEALALHQFFRDIDDEESWIKEKKLLVSSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQNVLD 1757 (2399)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccchhhcccchhhHHHHHHhchhhhhhhhccHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhccCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCHHHH
Q psy6935 964 TGEKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAV 1043 (1575)
Q Consensus 964 ~~~~L~~~~~~~~~~i~~~l~~L~~~w~~L~~~~~~r~~~L~~~~~~~~f~~~~~el~~Wl~e~e~~l~~~~~~~d~~~~ 1043 (1575)
.|+.|...+..+..+|+.++..+...|..|......|...|...+.++.|....++.+.|++++...+...++|..+..+
T Consensus 1758 ~~ekl~d~a~vg~~ei~~rl~~~~~~w~~lk~la~~r~~~l~es~~~Q~f~~~~eeeEaWinek~~l~~~~d~gd~laai 1837 (2399)
T KOG0040|consen 1758 MGEKLKDKAAVGVEEIQQRLAQFVEHWEELKELAAARGQKLEESLEYQQFLANVEEEEAWINEKQQLLVSEDYGDTLAAV 1837 (2399)
T ss_pred HHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhHhHHHHH
Confidence 99999866666788899999999999999999999999999999999999999999999999999999899999999999
Q ss_pred HHHHHHHHHHHHHHHHhHHHHHHHHHhhhHhHhccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6935 1044 QGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAKNHHADSITQRCQQLQLKLDNLMALATKRKTKLMDNSAYLQFMWKA 1123 (1575)
Q Consensus 1044 ~~~l~~~~~l~~el~~~~~~v~~l~~~~~~L~~~~~~~~~~i~~~l~~L~~~w~~L~~~~~~r~~~Le~~~~~~~f~~~~ 1123 (1575)
+.++.+|.+|.-+...++.+|..+...|..++.......+.|..++..++.+-..+..++..|..++.....+.+|.-.+
T Consensus 1838 q~Ll~kh~a~e~d~~~hK~rV~~~~~~g~dll~~~~h~~~~I~sk~~~l~~k~~~l~~~~~~~k~kl~dn~a~~qf~wk~ 1917 (2399)
T KOG0040|consen 1838 QGLLKKHEAFETDFTVHKDRVQDVCAQGEDLINKVNHHEEQISSKCEQLNEKLPSLEKAAAARKAQLEDNSAFLQFNWKA 1917 (2399)
T ss_pred HHHHhcCchHHHHHHHHHHHHHHHHhchHHHHHHhhhhhhHHHHHHHHHhhcchhHHHHHHhHHHhhhhhHHHHHhhhhh
Confidence 99999999999999999999999999999999986666677999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhhhhcccccCCCHHHHHHHHHHHHHHHHhhhhhccccHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHH
Q psy6935 1124 DVVESWIADKETHVKSEEYGRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARW 1203 (1575)
Q Consensus 1124 ~~l~~Wl~~~e~~l~~~~~~~d~~~~~~l~~~~~~f~~el~~~~~~~~~~~~~~~~~L~~~~~~~~~~i~~~~~~l~~~w 1203 (1575)
+-+..|+..++..+.+.++|.++.+++.++.+..+|-..+..+.++.+..+..+-+.|+..-|..++.|..+-..+..+|
T Consensus 1918 dVveswi~~ke~~~k~e~~G~dl~~~q~ll~kQ~T~dasl~aF~QE~~~~itelkdql~~a~hnQSdAi~kr~l~l~~rw 1997 (2399)
T KOG0040|consen 1918 DVVESWIADKENSLKTDDFGRDLSSVQTLLTKQETFDAGLQAFQQEGIPNITALKDQLISAQHNQSKAIEKRHAALIKRW 1997 (2399)
T ss_pred hhhHHhhhhHHHHHHhhhhhhhHHhhhhHhhHHHHHHhhhhhhHHHhHhhHHHHHHHHHHHHhcccHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999998888999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCcchhhhhhhhccccccccCCCCCCcCchhhHhHHHHh
Q psy6935 1204 QKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNKPQPLSRDMEMSLQDGRSYLEIPMPGNNVFSASSFNSWFEN 1283 (1575)
Q Consensus 1204 ~~L~~~~~~r~~~L~~a~~~~~~~~~l~~~f~~~~~~~~~~~~~~~d~~~~l~~~r~~~~~~~~~~~~~~~~~l~~WL~~ 1283 (1575)
..+......|++.|-++...++.+.++...|+.+++ .|+.|...
T Consensus 1998 ~~l~~~s~~~~kkLLe~Q~~fkk~ee~~l~faKkaS------------------------------------afNwwfen 2041 (2399)
T KOG0040|consen 1998 QQLLAASAARRQKLLEMQSQFRKIEDLFLTFAKKAS------------------------------------AFNSWFEN 2041 (2399)
T ss_pred HHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------------------------hhhHHHHh
Confidence 999999999999999999999999999999999999 99999999
Q ss_pred hhhccCCccccCCHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhhccccCCCCCCcccHHHHHHHHHHHHHHHHHH
Q psy6935 1284 AEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQADFEALAALDQQIKSFNVGPNPYTWFTMEALEDTWRNLQKIIKER 1363 (1575)
Q Consensus 1284 ~e~~L~~~~~~~~~~~v~~ll~~~~~~~~~l~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~l~~~w~~l~~~~~~r 1363 (1575)
+|..+..|..+.+.+++..+-..|..|...++..+..+..+..+...+.+.+.+++||++..+..|.++|.+|...+.+|
T Consensus 2042 aEE~l~~~~~~ns~~Ei~~l~~~h~~f~~sls~a~~df~~l~~ld~~iks~~v~~~pytw~t~e~Le~tw~~L~~iI~eR 2121 (2399)
T KOG0040|consen 2042 AEEDLTDPVRCNSLEEIRALRDAHEDFQASLSSAQADFKQLAELDQQIKSFNVGSNPYTWFTMEALEETWRNLQQIISER 2121 (2399)
T ss_pred hHhcccccccccchHHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHhcCCCCCCceeehHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhhhhHHHHHHHHHHHhHHHHHHHHHHHhhhcC-CCCHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHH
Q psy6935 1364 DIELAKEATRQDENDALRKEFAKHANAFHQWLTETRTSMMEG-TGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEE 1442 (1575)
Q Consensus 1364 ~~~Le~a~~~~~~~~~~~~~f~~~~~~l~~Wl~~~~~~~~~~-~~~l~~ql~~lk~l~~ei~~~~~~l~~l~~l~~~l~~ 1442 (1575)
.+.|..+..+|.+|+.+|++|+..++.|..||.+++..+..+ +++|++|++.++.+..+|..++..+..|+.+|..+++
T Consensus 2122 ~~el~~E~~Rq~~N~klc~efa~~a~tfh~wi~etr~el~~~~sgtLE~Qleal~~k~~evqa~rg~l~~ie~~g~lmE~ 2201 (2399)
T KOG0040|consen 2122 ERELDKEISRQEENDKLCEEFACTANTFHQWIVETRKELEDGESGTLEDQLEALKRKIKEVQAMRGQLQKIEKLGALMES 2201 (2399)
T ss_pred HHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 999999999999999999999999999999999999998887 9999999999999999999999999999999999999
Q ss_pred hhhhcccCCcchhhhhhhhHHHHHHHHHhhccchHHhHhhhhcCCCCHHHHHHHHHHhcccCCCCCCcccHHHHHHHHHH
Q psy6935 1443 HLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRA 1522 (1575)
Q Consensus 1443 ~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~~~~g~i~~~el~~~l~~ 1522 (1575)
++|++|+|+.+|+.+|-+.|+.+..++.+|..+++.+|..++.+|+|++++.+|.-+|++||++.+|++++.+|+.||++
T Consensus 2202 ~lIldnkyt~~st~GlaqqwdQl~qL~~rMqhnlEQqIqarn~~GVtEe~L~EFs~~fkhFDkek~G~Ldhq~F~sCLrs 2281 (2399)
T KOG0040|consen 2202 RLILDNKYTEHSTVGLAQQWDQLDQLMMRMQHNLEQQIQARNHNGVTEEQLKEFSMMFKHFDKEKNGRLDHQHFKSCLRS 2281 (2399)
T ss_pred hHhhcccccccCchHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCHHHHHHHHHHHHHhchhhccCCcHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCCCCCChHHHHHHHHHhCCCCCCcccHHHHHHHHhhhhhhhcCC
Q psy6935 1523 LGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMISKETRQNSS 1573 (1575)
Q Consensus 1523 ~g~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~ 1573 (1575)
+||++|++++|.|++++++++..+||+.+|+|+..+|+.||+++.++||.+
T Consensus 2282 lgY~lpmvEe~~~~p~fe~~ld~vDP~r~G~Vsl~dY~afmi~~ETeNI~s 2332 (2399)
T KOG0040|consen 2282 LGYDLPMVEEGEPEPEFEEILDLVDPNRDGYVSLQDYMAFMISKETENILS 2332 (2399)
T ss_pred cCCCCcccccCCCChhHHHHHHhcCCCCcCcccHHHHHHHHHhcccccccc
Confidence 999999999999999999999999999999999999999999999998865
|
|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG0035|consensus | Back alignment and domain information |
|---|
| >KOG4286|consensus | Back alignment and domain information |
|---|
| >KOG4286|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >smart00150 SPEC Spectrin repeats | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >smart00150 SPEC Spectrin repeats | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0027|consensus | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG0027|consensus | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0028|consensus | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0037|consensus | Back alignment and domain information |
|---|
| >KOG0030|consensus | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0028|consensus | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0030|consensus | Back alignment and domain information |
|---|
| >KOG0031|consensus | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0041|consensus | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031|consensus | Back alignment and domain information |
|---|
| >KOG4240|consensus | Back alignment and domain information |
|---|
| >KOG0044|consensus | Back alignment and domain information |
|---|
| >KOG0034|consensus | Back alignment and domain information |
|---|
| >KOG0036|consensus | Back alignment and domain information |
|---|
| >KOG4240|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0044|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0036|consensus | Back alignment and domain information |
|---|
| >KOG0038|consensus | Back alignment and domain information |
|---|
| >KOG0377|consensus | Back alignment and domain information |
|---|
| >KOG0046|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4065|consensus | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0037|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG0034|consensus | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0035|consensus | Back alignment and domain information |
|---|
| >KOG4223|consensus | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG1955|consensus | Back alignment and domain information |
|---|
| >KOG4251|consensus | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >PF14643 DUF4455: Domain of unknown function (DUF4455) | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG4223|consensus | Back alignment and domain information |
|---|
| >KOG2643|consensus | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0042|consensus | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG2243|consensus | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0377|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG2562|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG4666|consensus | Back alignment and domain information |
|---|
| >KOG3866|consensus | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4578|consensus | Back alignment and domain information |
|---|
| >KOG3555|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1575 | ||||
| 1u4q_A | 322 | Crystal Structure Of Repeats 15, 16 And 17 Of Chick | 1e-119 | ||
| 1u4q_A | 322 | Crystal Structure Of Repeats 15, 16 And 17 Of Chick | 7e-37 | ||
| 1u5p_A | 216 | Crystal Structure Of Repeats 15 And 16 Of Chicken B | 6e-80 | ||
| 1u5p_A | 216 | Crystal Structure Of Repeats 15 And 16 Of Chicken B | 1e-26 | ||
| 1u5p_A | 216 | Crystal Structure Of Repeats 15 And 16 Of Chicken B | 4e-23 | ||
| 1cun_A | 213 | Crystal Structure Of Repeats 16 And 17 Of Chicken B | 9e-76 | ||
| 1cun_A | 213 | Crystal Structure Of Repeats 16 And 17 Of Chicken B | 7e-18 | ||
| 1cun_A | 213 | Crystal Structure Of Repeats 16 And 17 Of Chicken B | 2e-06 | ||
| 1sjj_A | 863 | Cryo-Em Structure Of Chicken Gizzard Smooth Muscle | 2e-46 | ||
| 1aj3_A | 110 | Solution Structure Of The Spectrin Repeat, Nmr, 20 | 4e-38 | ||
| 1aj3_A | 110 | Solution Structure Of The Spectrin Repeat, Nmr, 20 | 3e-09 | ||
| 1aj3_A | 110 | Solution Structure Of The Spectrin Repeat, Nmr, 20 | 2e-06 | ||
| 2spc_A | 107 | Crystal Structure Of The Repetitive Segments Of Spe | 2e-36 | ||
| 2spc_A | 107 | Crystal Structure Of The Repetitive Segments Of Spe | 1e-35 | ||
| 2spc_A | 107 | Crystal Structure Of The Repetitive Segments Of Spe | 3e-05 | ||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 1e-34 | ||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 7e-25 | ||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 7e-25 | ||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 4e-12 | ||
| 3f31_A | 149 | Crystal Structure Of The N-Terminal Region Of Alpha | 1e-09 | ||
| 3fb2_A | 218 | Crystal Structure Of The Human Brain Alpha Spectrin | 1e-32 | ||
| 3fb2_A | 218 | Crystal Structure Of The Human Brain Alpha Spectrin | 5e-21 | ||
| 3fb2_A | 218 | Crystal Structure Of The Human Brain Alpha Spectrin | 3e-10 | ||
| 3thk_A | 73 | Structure Of Sh3 Chimera With A Type Ii Ligand Link | 3e-27 | ||
| 1hci_A | 476 | Crystal Structure Of The Rod Domain Of Alpha-Actini | 4e-26 | ||
| 1neg_A | 83 | Crystal Structure Analysis Of N-And C-Terminal Labe | 1e-25 | ||
| 2lj3_A | 63 | Pfbd: High-Throughput Strategy Of Backbone Fold Det | 4e-25 | ||
| 1m8m_A | 62 | Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 | 4e-25 | ||
| 2cdt_A | 62 | Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | 8e-25 | ||
| 1hd3_A | 62 | A-Spectrin Sh3 Domain F52y Mutant Length = 62 | 1e-24 | ||
| 2f2w_A | 62 | Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | 3e-24 | ||
| 1qkw_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47g Mutant I | 3e-24 | ||
| 2f2x_A | 62 | Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | 3e-24 | ||
| 3m0p_A | 62 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 4e-24 | ||
| 1qkx_A | 62 | Alpha-Spectrin Src Homology 3 Domain, N47a Mutant I | 5e-24 | ||
| 1uue_A | 62 | A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = | 6e-24 | ||
| 1e6h_A | 62 | A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutant | 1e-23 | ||
| 1e6g_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l | 3e-23 | ||
| 1e7o_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l | 3e-23 | ||
| 1h8k_A | 62 | A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l | 6e-23 | ||
| 1bk2_A | 57 | A-Spectrin Sh3 Domain D48g Mutant Length = 57 | 1e-22 | ||
| 1pwt_A | 61 | Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw | 1e-22 | ||
| 3ngp_A | 62 | High Resolution Structure Of Alpha-Spectrin Sh3 Dom | 2e-22 | ||
| 3m0s_A | 57 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 2e-22 | ||
| 2f2v_A | 62 | Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | 5e-22 | ||
| 2kr3_A | 70 | Solution Structure Of Sha-D Length = 70 | 8e-22 | ||
| 2rmo_A | 70 | Solution Structure Of Alpha-Spectrin_sh3-Bergerac F | 9e-22 | ||
| 3lbx_A | 161 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 1e-21 | ||
| 3lbx_A | 161 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 3e-15 | ||
| 3lbx_A | 161 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 3e-15 | ||
| 3lbx_A | 161 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 2e-05 | ||
| 1owa_A | 156 | Solution Structural Studies On Human Erythrocyte Al | 2e-21 | ||
| 1owa_A | 156 | Solution Structural Studies On Human Erythrocyte Al | 3e-15 | ||
| 1owa_A | 156 | Solution Structural Studies On Human Erythrocyte Al | 3e-15 | ||
| 1owa_A | 156 | Solution Structural Studies On Human Erythrocyte Al | 2e-05 | ||
| 3i9q_A | 57 | Crystal Structure Of The Triple Mutant S19g-P20d-R2 | 7e-21 | ||
| 2rot_A | 70 | Structure Of Chimeric Variant Of Sh3 Domain- Shh Le | 3e-19 | ||
| 3kbu_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 6e-18 | ||
| 3kbu_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 3e-12 | ||
| 3kbt_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 1e-17 | ||
| 3kbt_A | 326 | Crystal Structure Of The Ankyrin Binding Domain Of | 4e-12 | ||
| 2oaw_A | 65 | Structure Of Shh Variant Of "bergerac" Chimera Of S | 1e-17 | ||
| 2kxd_A | 73 | The Structure Of Sh3-F2 Length = 73 | 1e-16 | ||
| 2jmc_A | 77 | Chimer Between Spc-Sh3 And P41 Length = 77 | 1e-16 | ||
| 1tuc_A | 63 | Alpha-Spectrin Src Homology 3 Domain, Circular Perm | 3e-16 | ||
| 3edv_A | 323 | Crystal Structure Of Repeats 14-16 Of Beta2-Spectri | 1e-14 | ||
| 3edv_A | 323 | Crystal Structure Of Repeats 14-16 Of Beta2-Spectri | 1e-12 | ||
| 3edv_A | 323 | Crystal Structure Of Repeats 14-16 Of Beta2-Spectri | 4e-11 | ||
| 3edv_A | 323 | Crystal Structure Of Repeats 14-16 Of Beta2-Spectri | 3e-05 | ||
| 1s35_A | 214 | Crystal Structure Of Repeats 8 And 9 Of Human Eryth | 2e-14 | ||
| 1g2b_A | 62 | Alpha-Spectrin Src Homology 3 Domain, Circular Perm | 2e-14 | ||
| 1quu_A | 250 | Crystal Structure Of Two Central Spectrin-Like Repe | 2e-13 | ||
| 3lbx_B | 185 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 1e-08 | ||
| 3lbx_B | 185 | Crystal Structure Of The Erythrocyte Spectrin Tetra | 6e-08 | ||
| 3f57_A | 225 | Crystal Structure Of Human Erythroid Beta Spectrin | 1e-08 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 2e-08 | ||
| 3edu_A | 218 | Crystal Structure Of The Ankyrin-Binding Domain Of | 2e-08 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 6e-08 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 1e-07 | ||
| 2dl4_A | 68 | Solution Structure Of The First Sh3 Domain Of Stac | 1e-07 | ||
| 2dil_A | 69 | Solution Structure Of The Sh3 Domain Of The Human P | 6e-07 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 7e-07 | ||
| 1wlx_A | 129 | Solution Structure Of The Third Spectrin Repeat Of | 1e-06 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 2e-06 | ||
| 2ysq_A | 81 | Solution Structure Of The Sh3 Domain From Rho Guani | 2e-06 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 2e-06 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 3e-06 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 4e-06 | ||
| 2iak_A | 224 | Crystal Structure Of A Protease Resistant Fragment | 7e-06 | ||
| 1uhc_A | 79 | Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of | 8e-06 | ||
| 2lmj_A | 66 | Itk-Sh3 Length = 66 | 3e-05 | ||
| 2pz1_A | 466 | Crystal Structure Of Auto-Inhibited Asef Length = 4 | 4e-05 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 4e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 1e-04 | ||
| 2dx1_A | 482 | Crystal Structure Of Rhogef Protein Asef Length = 4 | 1e-04 | ||
| 2yuq_A | 85 | Solution Structure Of The Sh3 Domain Of Human Tyros | 1e-04 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 1e-04 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-04 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 2e-04 | ||
| 2lv7_A | 100 | Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D | 2e-04 | ||
| 2gnc_A | 60 | Crystal Structure Of Srgap1 Sh3 Domain In The Slit- | 2e-04 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 2e-04 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 2e-04 | ||
| 3sg5_A | 448 | Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke | 2e-04 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 2e-04 | ||
| 4tnc_A | 162 | Refined Structure Of Chicken Skeletal Muscle Tropon | 2e-04 | ||
| 3sg4_A | 448 | Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len | 3e-04 | ||
| 3nmz_D | 116 | Crytal Structure Of Apc Complexed With Asef Length | 3e-04 | ||
| 2epd_A | 76 | Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti | 3e-04 | ||
| 1awj_A | 77 | Intramolecular Itk-Proline Complex, Nmr, Minimized | 3e-04 | ||
| 1tcf_A | 159 | Crystal Structure Of Calcium-Saturated Rabbit Skele | 4e-04 | ||
| 3reb_B | 90 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 4e-04 | ||
| 1wyx_A | 69 | The Crystal Structure Of The P130cas Sh3 Domain At | 4e-04 | ||
| 1avs_A | 90 | X-Ray Crystallographic Study Of Calcium-Saturated N | 4e-04 | ||
| 1a2x_A | 159 | Complex Of Troponin C With A 47 Residue (1-47) Frag | 4e-04 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 4e-04 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 4e-04 | ||
| 1ytz_C | 162 | Crystal Structure Of Skeletal Muscle Troponin In Th | 5e-04 | ||
| 2w49_0 | 159 | Isometrically Contracting Insect Asynchronous Fligh | 5e-04 | ||
| 1tnw_A | 162 | Nmr Solution Structure Of Calcium Saturated Skeleta | 5e-04 | ||
| 5tnc_A | 162 | Refined Crystal Structure Of Troponin C From Turkey | 5e-04 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 5e-04 | ||
| 3qrx_A | 169 | Chlamydomonas Reinhardtii Centrin Bound To Melittin | 5e-04 | ||
| 3fj5_A | 57 | Crystal Structure Of The C-Src-Sh3 Domain Length = | 6e-04 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 7e-04 | ||
| 3pdy_A | 210 | Structure Of The Third And Fourth Spectrin Repeats | 7e-04 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 7e-04 | ||
| 2hda_A | 64 | Yes Sh3 Domain Length = 64 | 7e-04 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 7e-04 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 7e-04 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 8e-04 | ||
| 3iql_A | 71 | Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma | 8e-04 | ||
| 3sg7_A | 448 | Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 | 8e-04 | ||
| 3sg3_A | 449 | Crystal Structure Of Gcamp3-D380y Length = 449 | 8e-04 | ||
| 1qwe_A | 64 | C-Src Sh3 Domain Complexed With Ligand App12 Length | 9e-04 |
| >pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 | Back alignment and structure |
|
| >pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 | Back alignment and structure |
| >pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 | Back alignment and structure |
| >pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 | Back alignment and structure |
| >pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 | Back alignment and structure |
| >pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 | Back alignment and structure |
| >pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 | Back alignment and structure |
| >pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 | Back alignment and structure |
| >pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 | Back alignment and structure |
| >pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 | Back alignment and structure |
| >pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 | Back alignment and structure |
| >pdb|1AJ3|A Chain A, Solution Structure Of The Spectrin Repeat, Nmr, 20 Structures Length = 110 | Back alignment and structure |
| >pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 | Back alignment and structure |
| >pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 | Back alignment and structure |
| >pdb|2SPC|A Chain A, Crystal Structure Of The Repetitive Segments Of Spectrin Length = 107 | Back alignment and structure |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
| >pdb|3F31|A Chain A, Crystal Structure Of The N-Terminal Region Of Alphaii-Spectr Tetramerization Domain Length = 149 | Back alignment and structure |
| >pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 | Back alignment and structure |
| >pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 | Back alignment and structure |
| >pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin Repeats 15 And 16. Northeast Structural Genomics Consortium Target Hr5563a. Length = 218 | Back alignment and structure |
| >pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 | Back alignment and structure |
| >pdb|1HCI|A Chain A, Crystal Structure Of The Rod Domain Of Alpha-Actinin Length = 476 | Back alignment and structure |
| >pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 | Back alignment and structure |
| >pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 | Back alignment and structure |
| >pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 | Back alignment and structure |
| >pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | Back alignment and structure |
| >pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 | Back alignment and structure |
| >pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | Back alignment and structure |
| >pdb|1QKW|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47g Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | Back alignment and structure |
| >pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 | Back alignment and structure |
| >pdb|1QKX|A Chain A, Alpha-Spectrin Src Homology 3 Domain, N47a Mutant In The Distal Loop Length = 62 | Back alignment and structure |
| >pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 | Back alignment and structure |
| >pdb|1E6H|A Chain A, A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutants Length = 62 | Back alignment and structure |
| >pdb|1E6G|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|1E7O|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l Mutations Length = 62 | Back alignment and structure |
| >pdb|1H8K|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V53i, V58l Mutant Length = 62 | Back alignment and structure |
| >pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 | Back alignment and structure |
| >pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 | Back alignment and structure |
| >pdb|3NGP|A Chain A, High Resolution Structure Of Alpha-Spectrin Sh3 Domain Mutant With A Redesigned Core Length = 62 | Back alignment and structure |
| >pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 | Back alignment and structure |
| >pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | Back alignment and structure |
| >pdb|2KR3|A Chain A, Solution Structure Of Sha-D Length = 70 | Back alignment and structure |
| >pdb|2RMO|A Chain A, Solution Structure Of Alpha-Spectrin_sh3-Bergerac From Chicken Length = 70 | Back alignment and structure |
| >pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 | Back alignment and structure |
| >pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 | Back alignment and structure |
| >pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 | Back alignment and structure |
| >pdb|3LBX|A Chain A, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 161 | Back alignment and structure |
| >pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 | Back alignment and structure |
| >pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 | Back alignment and structure |
| >pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 | Back alignment and structure |
| >pdb|1OWA|A Chain A, Solution Structural Studies On Human Erythrocyte Alpha Spectrin N Terminal Tetramerization Domain Length = 156 | Back alignment and structure |
| >pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|2ROT|A Chain A, Structure Of Chimeric Variant Of Sh3 Domain- Shh Length = 70 | Back alignment and structure |
| >pdb|3KBU|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank), Emts Derivative Length = 326 | Back alignment and structure |
| >pdb|3KBU|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank), Emts Derivative Length = 326 | Back alignment and structure |
| >pdb|3KBT|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank) Length = 326 | Back alignment and structure |
| >pdb|3KBT|A Chain A, Crystal Structure Of The Ankyrin Binding Domain Of Human Erythroid Beta Spectrin (Repeats 13-15) In Complex With The Spectrin Binding Domain Of Human Erythroid Ankyrin (Zu5-Ank) Length = 326 | Back alignment and structure |
| >pdb|2OAW|A Chain A, Structure Of Shh Variant Of "bergerac" Chimera Of Spectrin Sh3 Length = 65 | Back alignment and structure |
| >pdb|2KXD|A Chain A, The Structure Of Sh3-F2 Length = 73 | Back alignment and structure |
| >pdb|2JMC|A Chain A, Chimer Between Spc-Sh3 And P41 Length = 77 | Back alignment and structure |
| >pdb|1TUC|A Chain A, Alpha-Spectrin Src Homology 3 Domain, Circular Permutant, Cut At S19-P20 Length = 63 | Back alignment and structure |
| >pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 | Back alignment and structure |
| >pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 | Back alignment and structure |
| >pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 | Back alignment and structure |
| >pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin Length = 323 | Back alignment and structure |
| >pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 And 9 Of Human Erythroid Spectrin Length = 214 | Back alignment and structure |
| >pdb|1G2B|A Chain A, Alpha-Spectrin Src Homology 3 Domain, Circular Permutant, Cut At N47-D48 Length = 62 | Back alignment and structure |
| >pdb|1QUU|A Chain A, Crystal Structure Of Two Central Spectrin-Like Repeats From Alpha-Actinin Length = 250 | Back alignment and structure |
| >pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 185 | Back alignment and structure |
| >pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin Tetramerization Domain Complex Length = 185 | Back alignment and structure |
| >pdb|3F57|A Chain A, Crystal Structure Of Human Erythroid Beta Spectrin Repeats 14 And 15 (Ankyrin Binding Domain) Length = 225 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|3EDU|A Chain A, Crystal Structure Of The Ankyrin-Binding Domain Of Human Erythroid Spectrin Length = 218 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 | Back alignment and structure |
| >pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|1WLX|A Chain A, Solution Structure Of The Third Spectrin Repeat Of Alpha- Actinin-4 Length = 129 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|2IAK|A Chain A, Crystal Structure Of A Protease Resistant Fragment Of The Plakin Domain Of Bullous Pemphigoid Antigen1 (Bpag1) Length = 224 | Back alignment and structure |
| >pdb|1UHC|A Chain A, Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of Kiaa1010 Protein [homo Sapiens] Length = 79 | Back alignment and structure |
| >pdb|2LMJ|A Chain A, Itk-Sh3 Length = 66 | Back alignment and structure |
| >pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 | Back alignment and structure |
| >pdb|2YUQ|A Chain A, Solution Structure Of The Sh3 Domain Of Human Tyrosine- Protein Kinase ItkTSK Length = 85 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 | Back alignment and structure |
| >pdb|2GNC|A Chain A, Crystal Structure Of Srgap1 Sh3 Domain In The Slit-Robo Signaling Pathway Length = 60 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 | Back alignment and structure |
| >pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 | Back alignment and structure |
| >pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 | Back alignment and structure |
| >pdb|1AWJ|A Chain A, Intramolecular Itk-Proline Complex, Nmr, Minimized Average Structure Length = 77 | Back alignment and structure |
| >pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 | Back alignment and structure |
| >pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 | Back alignment and structure |
| >pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 | Back alignment and structure |
| >pdb|1AVS|A Chain A, X-Ray Crystallographic Study Of Calcium-Saturated N- Terminal Domain Of Troponin C Length = 90 | Back alignment and structure |
| >pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 | Back alignment and structure |
| >pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 | Back alignment and structure |
| >pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 | Back alignment and structure |
| >pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 | Back alignment and structure |
| >pdb|3FJ5|A Chain A, Crystal Structure Of The C-Src-Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|3PDY|A Chain A, Structure Of The Third And Fourth Spectrin Repeats Of The Plakin Domain Of Plectin Length = 210 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 | Back alignment and structure |
| >pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 | Back alignment and structure |
| >pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 | Back alignment and structure |
| >pdb|1QWE|A Chain A, C-Src Sh3 Domain Complexed With Ligand App12 Length = 64 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
Score = 301 bits (770), Expect = 4e-86
Identities = 140/624 (22%), Positives = 266/624 (42%), Gaps = 70/624 (11%)
Query: 976 VPEIEQRLKLLNQAWSELKQLAANRGQKLDESLTYQHFLAKVEEEEAWISEKQQLLSVED 1035
V +A + ++ + + + + WI L
Sbjct: 218 VSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRA 277
Query: 1036 YGDTMAAVQGLLKKHDAFETDFSVHRDRCADICSAGNKLIEAK------NHHADSITQRC 1089
+TM A+Q L+ + + + ++ K S +
Sbjct: 278 PENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMV 337
Query: 1090 QQLQLKLDNLMALATKRKTKLMD--------NSAYLQFMWKADVVESWIADKETHVKSEE 1141
+ L + L++ + +F KA + ESW KE ++ ++
Sbjct: 338 SDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKD 397
Query: 1142 Y-GRDLSTVQTLLTKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVI 1200
Y LS ++ LL K E F++ L A + + ++ I + +L ++ +P++ R +
Sbjct: 398 YETATLSEIKALLKKHEAFESDLAAHQ-DRVEQIAAIAQELNELDYYDSPSVNARCQKIC 456
Query: 1201 ARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLTFAKKASSFNKPQPLSRDMEMSLQDGRS 1260
+W L + R++ L R ++ I+ LYL +AK+A+ FN
Sbjct: 457 DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFN------------------ 498
Query: 1261 YLEIPMPGNNVFSASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQASLSSAQAD 1320
+W E A EDL D ++IEEI+ L AH QF+A+L A +
Sbjct: 499 ------------------NWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKE 540
Query: 1321 FEALAALDQQIKSF-------NVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATR 1373
+A+ + ++ G NPYT T + + W ++++++ RD L +E R
Sbjct: 541 RQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWEHVRQLVPRRDQALMEEHAR 600
Query: 1374 QDENDALRKEFAKHANAFHQWLTETR----TSMMEGTGSLEQQLEAIKRKAAEVRSRRSD 1429
Q +N+ LRK+F AN W+ +E G+LE QL +++ + + +
Sbjct: 601 QQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYEKSIVNYKPK 660
Query: 1430 LKKIEDLGAILEEHLILDNRYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNQSGVS 1489
+ ++E ++E LI DN++T ++ + W+QL R + +E QI R+ G+S
Sbjct: 661 IDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGIS 720
Query: 1490 EDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPN 1549
++ + EF F HFD+ K+G ++ +F++CL ++GY++ + EF I+ +VDPN
Sbjct: 721 QEQMNEFRASFNHFDRKKTGMMDCEDFRACLISMGYNM-------GEAEFARIMSIVDPN 773
Query: 1550 RDGHVSLQEYMAFMISKETRQNSS 1573
R G V+ Q ++ FM + +++
Sbjct: 774 RMGVVTFQAFIDFMSRETADTDTA 797
|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Length = 76 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Length = 74 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1575 | |||
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 100.0 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 100.0 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 100.0 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 100.0 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 100.0 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 100.0 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 100.0 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 100.0 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 100.0 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 100.0 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 99.96 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 99.93 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 99.92 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 99.91 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 99.91 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.91 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 99.9 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.9 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.89 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.88 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 99.87 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 99.87 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 99.87 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 99.86 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 99.86 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 99.85 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 99.84 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 99.79 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.76 | |
| 3lbx_B | 185 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 99.73 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 99.72 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 99.67 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 99.65 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 99.65 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 99.61 | |
| 1wlx_A | 129 | Alpha-actinin 4; three-helix bundle, protein bindi | 99.5 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.33 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.31 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.28 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 99.23 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 99.22 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 99.21 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 99.2 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 99.18 | |
| 2spc_A | 107 | Spectrin; cytoskeleton; 1.80A {Drosophila melanoga | 99.12 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 99.12 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 99.09 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.09 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.08 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.07 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.06 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.05 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.04 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.03 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.03 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.03 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.0 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.0 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.97 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.96 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.96 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.96 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.95 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.95 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.94 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.93 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 98.93 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.93 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 98.93 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.92 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 98.92 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.92 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.91 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.91 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.91 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.9 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.89 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.87 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.87 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.86 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.86 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.85 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.84 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.84 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.84 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.84 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.83 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.82 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 98.81 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.81 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 98.81 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.8 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.8 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.8 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.8 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.79 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.79 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.79 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.78 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.78 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.77 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.77 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.77 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.77 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.77 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.76 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.75 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.75 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.74 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.73 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.71 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.71 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.7 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.7 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.68 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.66 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.66 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.66 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 98.63 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.63 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.63 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.62 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 98.62 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.61 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.61 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.61 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.61 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.6 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.6 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.6 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.6 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 98.6 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.59 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.59 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.58 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.58 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.58 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.57 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.57 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 98.57 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.57 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.54 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.54 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.54 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.53 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.52 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.52 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.52 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.52 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.52 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.51 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.51 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.48 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.48 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.47 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.47 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.46 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.46 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.45 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.45 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.44 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.44 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.44 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.44 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.43 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.43 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.43 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.43 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.43 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.42 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.41 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.41 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.41 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.41 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.4 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.4 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.39 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.38 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.37 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.34 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 98.34 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 98.34 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.33 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.33 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.32 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.32 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.32 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.32 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.3 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.3 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.29 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 98.29 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.29 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.29 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.28 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 98.28 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.28 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.28 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.28 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.27 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.26 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.26 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.26 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.24 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 98.24 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.24 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.23 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.23 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.22 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.22 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 98.22 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.21 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.21 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 98.21 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.21 | |
| 1wlx_A | 129 | Alpha-actinin 4; three-helix bundle, protein bindi | 98.19 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 98.19 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.19 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.18 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.17 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 98.17 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 98.17 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.17 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.16 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 98.16 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.15 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.14 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.14 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.14 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.13 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.13 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.13 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 98.12 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.12 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 98.11 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 98.11 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.11 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 98.11 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.11 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 98.11 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.1 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.1 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 98.08 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.08 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 98.07 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 98.07 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.07 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.06 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.06 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.05 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 98.04 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.04 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 98.03 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.02 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.02 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 98.01 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 98.01 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 97.97 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 97.97 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 97.96 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 97.96 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 97.96 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 97.95 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 97.94 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 97.93 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 97.92 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.92 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 97.91 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 97.9 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 97.88 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.87 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 97.86 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 97.83 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 97.83 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 97.82 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 97.77 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 97.76 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 97.67 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 97.66 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 97.6 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 97.54 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 97.53 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.53 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 97.51 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 97.48 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 97.38 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.32 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 97.21 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 97.09 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 96.95 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 96.95 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.94 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 96.9 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 96.83 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 96.81 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 96.78 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 96.78 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.64 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 96.62 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 96.61 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 96.12 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 95.86 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 95.6 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 95.16 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 94.77 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 92.92 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 92.8 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 91.52 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 90.77 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 90.48 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 90.12 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 89.39 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 89.32 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 89.06 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 88.87 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 88.83 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 88.06 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 87.94 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 87.78 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 87.42 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 87.36 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 87.21 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 86.66 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 86.59 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 86.58 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 86.39 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 86.37 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 86.09 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 86.09 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 85.92 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 85.72 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 85.64 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 84.77 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 83.64 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 83.51 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 83.34 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 83.27 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 82.72 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 82.37 | |
| 1ydi_B | 26 | Alpha-actinin 4; cell adhesion, structural protein | 81.91 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 81.75 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 81.69 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 81.13 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 80.25 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 80.25 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 80.23 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 80.15 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 80.15 |
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-41 Score=454.02 Aligned_cols=510 Identities=27% Similarity=0.499 Sum_probs=452.2
Q ss_pred HHHHHHHHHHHHHHHHHHhhccCCCCCCCHHHHHHHHHHHHHHHHHHHH-hHHHHHHHHHh----hhHhHhcc-CCCchh
Q psy6935 1011 QHFLAKVEEEEAWISEKQQLLSVEDYGDTMAAVQGLLKKHDAFETDFSV-HRDRCADICSA----GNKLIEAK-NHHADS 1084 (1575)
Q Consensus 1011 ~~f~~~~~el~~Wl~e~e~~l~~~~~~~d~~~~~~~l~~~~~l~~el~~-~~~~v~~l~~~----~~~L~~~~-~~~~~~ 1084 (1575)
..|...+.++..||.++...+.+.++|.++..++.++.+|..++..... .......+... +..+...+ ++-.+.
T Consensus 253 ~~y~~~~~el~~Wi~~~~~~l~~~~~~~~l~~v~~~l~~~~~~~~~~k~~~~~e~~~le~~~~~l~~~l~~~~~~~~~~~ 332 (863)
T 1sjj_A 253 EDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPS 332 (863)
T ss_dssp HHHHHHHHHHHHHHHHHGGGSSCCCCCSSHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHTTTHHHHHTTTTSSCCCCCS
T ss_pred HHHHHHHHHHHHHHHHHHHHHhccCcCCCHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Confidence 6899999999999999999999999999999999999999999986531 11111222211 12222111 111112
Q ss_pred HHHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccccCC-CHHHHHHHH
Q psy6935 1085 ITQRCQQLQLKLDNLMALAT----------KRKTKLMDNSAYLQFMWKADVVESWIADKETHVKSEEYGR-DLSTVQTLL 1153 (1575)
Q Consensus 1085 i~~~l~~L~~~w~~L~~~~~----------~r~~~Le~~~~~~~f~~~~~~l~~Wl~~~e~~l~~~~~~~-d~~~~~~l~ 1153 (1575)
....+..|+.+|..|..... .|..+|+. .+.+|.+.+.++..||.+++..+.+.++|. |+++++.++
T Consensus 333 ~~~~~~~i~~~w~~L~~~~~~r~~~l~~~~~R~~~Le~--l~~~F~~~~~~~~~Wl~~~e~~l~~~~~g~~dl~~v~~ll 410 (863)
T 1sjj_A 333 EGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDH--LAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALL 410 (863)
T ss_dssp TTSCGGGHHHHHHHHHHHHTTTHHHHHHHHEEHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHSCTTTSSCHHHHHHHH
T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHhhcccccCCCHHHHHHHH
Confidence 23345556666666666544 55666665 347999999999999999999999888887 999999999
Q ss_pred HHHHHHHHhhhhhccccHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6935 1154 TKQETFDAGLHAFEHEGIQNITTLKDQLVASNHDQTPAIVKRHGDVIARWQKLLGDSNARKQRLLRMQEQFRQIEDLYLT 1233 (1575)
Q Consensus 1154 ~~~~~f~~el~~~~~~~~~~~~~~~~~L~~~~~~~~~~i~~~~~~l~~~w~~L~~~~~~r~~~L~~a~~~~~~~~~l~~~ 1233 (1575)
++|+.|..+|..+. .++..+...|+.|+..+|++++.|..+++.|+.+|+.|...+..|+..|+.++..++.+++++.+
T Consensus 411 ~kh~~f~~el~~~~-~~v~~l~~~~~~L~~~~~~~~~~I~~~~~~l~~~W~~L~~~~~~R~~~L~~~l~~~q~~~~l~~~ 489 (863)
T 1sjj_A 411 KKHEAFESDLAAHQ-DRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLE 489 (863)
T ss_dssp HHHHHHHHHHTTHH-HHHHHHHHHHHHHHHTCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHH-HHHHHHHHHHHHHHhCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999976 89999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCCCCcchhhhhhhhccccccccCCCCCCcCchhhHhHHHHhhhhccCCccccCCHHHHHHHHHHHHHHHHh
Q psy6935 1234 FAKKASSFNKPQPLSRDMEMSLQDGRSYLEIPMPGNNVFSASSFNSWFENAEEDLTDPVRCNSIEEIRALREAHAQFQAS 1313 (1575)
Q Consensus 1234 f~~~~~~~~~~~~~~~d~~~~l~~~r~~~~~~~~~~~~~~~~~l~~WL~~~e~~L~~~~~~~~~~~v~~ll~~~~~~~~~ 1313 (1575)
|..+++ .+.+||..++..|.++.++.++++|+.++.+|+.|+.+
T Consensus 490 f~~~a~------------------------------------~~~~Wl~~~e~~l~~~~~g~dl~~ve~ll~kh~~~~~~ 533 (863)
T 1sjj_A 490 YAKRAA------------------------------------PFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKAT 533 (863)
T ss_dssp HHHHTT------------------------------------TTHHHHHHHHHHHHCCCCCSSSGGGHHHHHHHHHHHTT
T ss_pred HHHHHH------------------------------------HHHHHHHHHHHHhcchHhhccHHHHHHHHHHHHHHHhH
Confidence 999999 99999999999999888899999999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHhhcc-------ccCCCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHH
Q psy6935 1314 LSSAQADFEALAALDQQIKSF-------NVGPNPYTWFTMEALEDTWRNLQKIIKERDIELAKEATRQDENDALRKEFAK 1386 (1575)
Q Consensus 1314 l~~~~~~~~~l~~~~~~l~~~-------~~~~~~~~~~~~~~l~~~w~~l~~~~~~r~~~Le~a~~~~~~~~~~~~~f~~ 1386 (1575)
+..+++.+..+..++..+... +.+++|++..+++.|..+|+.|+..+..|+..|+.++.+|..++.+++.|..
T Consensus 534 l~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~rw~~L~~~~~~R~~~L~~~l~~~~~~~~l~~~F~~ 613 (863)
T 1sjj_A 534 LPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGA 613 (863)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHTTTCCCCSCCSSSSCCHHHHHHHHHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHH
Confidence 999999999999888887663 3456788888999999999999999999999999999999999999999999
Q ss_pred HHhHHHHHHHHHHHhhhcC----CCCHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHhhhhcccCCcchhhhhhhhH
Q psy6935 1387 HANAFHQWLTETRTSMMEG----TGSLEQQLEAIKRKAAEVRSRRSDLKKIEDLGAILEEHLILDNRYTEHSTVGLAQQW 1462 (1575)
Q Consensus 1387 ~~~~l~~Wl~~~~~~~~~~----~~~l~~ql~~lk~l~~ei~~~~~~l~~l~~l~~~l~~~~~~~~~~~~~~~~~l~~~~ 1462 (1575)
.++.+..||.+....+.+. ++++++++..|+.+..++....+.++.+..+++.+.......++++.+++.++...|
T Consensus 614 ~a~~~~~Wi~e~e~~l~~~~~~~~~~le~~l~~~~~~~~el~~~~~~i~~l~~l~~~L~~~~~~~~~~~~~s~e~l~i~~ 693 (863)
T 1sjj_A 614 QANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGW 693 (863)
T ss_dssp HHHHHHHHHHHHHHHTTSCTTCTTTSSHHHHHHHHHHHHHHHTTGGGHHHHHHHHHHHHTTTCCCCTTCSSTTHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhcCCCCCcccccHHHHHHHH
Confidence 9999999999999887652 678999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhccchHHhHhhhhcCCCCHHHHHHHHHHhcccCCCCCCcccHHHHHHHHHHcCCCCCCCCCCCChHHHHHH
Q psy6935 1463 DQLDQLGMRMQHNLEQQIQARNQSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAI 1542 (1575)
Q Consensus 1463 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~~~~g~i~~~el~~~l~~~g~~~~~~~~~~~~~~~~~~ 1542 (1575)
+.+...+.......++.+..+...+++++++..++.+|+.||+|++|+|+..||..+|..+|.++ ++.++..+
T Consensus 694 ~eF~~~~~~~~~~~e~~~l~~~~~~l~~~~~~~~~~~F~~~D~d~~G~I~~~El~~~l~~~g~~~-------~~~~~~~~ 766 (863)
T 1sjj_A 694 EQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRACLISMGYNM-------GEAEFARI 766 (863)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCCCCCSSHHHHHHHHHHHTTTCSSSSSEEESTTHHHHHHHHTCCC-------CTHHHHHH
T ss_pred HHHHHHHHHHHhhHHHHHHHhhccCCCHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHcCCCC-------CHHHHHHH
Confidence 99999999999999999988889999999999999999999999999999999999999999998 88999999
Q ss_pred HHHhCCCCCCcccHHHHHHHHhhh
Q psy6935 1543 LDLVDPNRDGHVSLQEYMAFMISK 1566 (1575)
Q Consensus 1543 ~~~~d~~~~g~i~~~ef~~~~~~~ 1566 (1575)
+..+|.|++|.|+|+||+.+|...
T Consensus 767 ~~~~D~d~dG~I~~~EF~~~~~~~ 790 (863)
T 1sjj_A 767 MSIVDPNRMGVVTFQAFIDFMSRE 790 (863)
T ss_dssp HHHHCTTSCSEEETTHHHHTHHHH
T ss_pred HHHhCCCCCCcCcHHHHHHHHHHH
Confidence 999999999999999999998754
|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1575 | ||||
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 3e-22 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 9e-19 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 2e-17 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 8e-17 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 4e-15 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 3e-13 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 3e-13 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 3e-13 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 1e-09 | |
| d1cuna2 | 104 | a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken | 7e-06 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 5e-22 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 3e-16 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 4e-16 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 9e-16 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 4e-14 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 6e-13 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 6e-13 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 8e-13 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 3e-09 | |
| d1u5pa2 | 101 | a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke | 2e-05 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 4e-21 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 3e-19 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 2e-16 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 8e-16 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 2e-14 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 7e-13 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 7e-13 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 4e-12 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 2e-11 | |
| d1u5pa1 | 110 | a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke | 5e-06 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 2e-20 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 3e-18 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 4e-18 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 9e-17 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 1e-16 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 2e-14 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 2e-14 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 7e-13 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 3e-09 | |
| d2spca_ | 107 | a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. | 1e-06 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 3e-19 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 9e-18 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 4e-16 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 2e-15 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 2e-15 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 2e-15 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 6e-14 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 4e-11 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 3e-09 | |
| d1quua1 | 124 | a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie | 6e-08 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 7e-19 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 1e-17 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 1e-16 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 1e-16 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 2e-14 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 1e-12 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 6e-11 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 5e-09 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 3e-07 | |
| d1owaa_ | 156 | a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap | 9e-07 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 7e-18 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 9e-16 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 3e-14 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 8e-14 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 1e-12 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 1e-12 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 6e-12 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 6e-12 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 3e-07 | |
| d1s35a2 | 105 | a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( | 2e-05 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 8e-17 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-16 | |
| d1hcia1 | 125 | a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sap | 4e-16 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-15 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 2e-15 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 2e-15 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 2e-15 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 6e-15 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 8e-15 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 1e-14 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 2e-13 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 2e-13 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 5e-13 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 2e-11 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 4e-11 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 4e-10 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 3e-09 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 6e-08 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 1e-07 | |
| d1hcia4 | 114 | a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap | 3e-06 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 2e-14 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 6e-12 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 6e-11 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 3e-10 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 3e-10 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 3e-09 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 6e-09 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 9e-08 | |
| d1s35a1 | 106 | a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( | 1e-06 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 2e-14 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 5e-14 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 6e-14 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 8e-14 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 9e-14 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 1e-13 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 1e-13 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 3e-13 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 4e-13 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 4e-13 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 5e-10 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 9e-10 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 1e-09 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 1e-09 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 8e-09 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 2e-08 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 8e-08 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 1e-07 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 5e-04 | |
| d1quua2 | 124 | a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap | 6e-04 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 1e-12 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 1e-12 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-12 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 2e-12 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 2e-12 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 3e-12 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 5e-12 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 5e-12 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 6e-12 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 6e-12 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 7e-12 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 9e-12 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 1e-11 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 7e-11 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 8e-11 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 2e-10 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-10 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 3e-10 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 4e-10 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 7e-10 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 1e-09 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-09 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 2e-09 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 3e-09 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 3e-09 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 5e-09 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 9e-09 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 9e-09 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 3e-08 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 4e-08 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 4e-08 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 7e-08 | |
| d1psra_ | 100 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 8e-08 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 9e-08 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 9e-08 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 1e-07 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 1e-07 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 1e-07 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 1e-07 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 2e-07 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 2e-07 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 2e-07 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 3e-07 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 3e-07 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 5e-07 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 6e-07 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 7e-07 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 9e-07 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 1e-06 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 3e-06 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 4e-06 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 5e-06 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 5e-06 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 6e-06 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 8e-06 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.001 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 9e-06 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 0.002 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 9e-06 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 3e-05 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-05 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 1e-05 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 2e-04 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 2e-05 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 2e-05 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 3e-05 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 3e-05 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 3e-05 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 5e-05 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 7e-05 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 8e-05 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-04 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 1e-04 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 4e-04 | |
| d1k8ua_ | 89 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 1e-04 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 1e-04 | |
| d2hf5a1 | 33 | a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien | 1e-04 | |
| d1e8aa_ | 87 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 1e-04 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 2e-04 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 4e-04 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 5e-04 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 6e-04 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 6e-04 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 6e-04 | |
| d1j55a_ | 94 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 6e-04 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 9e-04 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 0.001 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 0.001 | |
| d1qlsa_ | 95 | a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), | 0.001 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 0.001 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 0.001 | |
| d3cr5x1 | 90 | a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru | 0.001 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 0.001 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 0.002 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 0.003 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 0.003 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 0.004 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 0.004 |
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Spectrin repeat-like superfamily: Spectrin repeat family: Spectrin repeat domain: Spectrin alpha chain species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 90.8 bits (225), Expect = 3e-22
Identities = 40/103 (38%), Positives = 59/103 (57%)
Query: 906 QFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHQPAIQNVQETG 965
QF ++ +EE+WI EK LV S+DYG L +Q L KKH+ E + H+ + +V G
Sbjct: 1 QFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANG 60
Query: 966 EKLMDVSNLGVPEIEQRLKLLNQAWSELKQLAANRGQKLDESL 1008
E L+ +N V I ++K L S+L++ AA R KLDE+
Sbjct: 61 EDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENS 103
|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1575 | |||
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.44 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.44 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.43 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.41 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 99.37 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.35 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.34 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.33 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.32 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.31 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.31 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.3 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.29 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.29 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.29 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 99.25 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.23 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.22 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.21 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.2 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.2 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.2 | |
| d1quua2 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1s35a1 | 106 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.17 | |
| d1s35a1 | 106 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 99.17 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 99.13 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 99.1 | |
| d1quua2 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.04 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.0 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.99 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.92 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.92 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.92 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.91 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.91 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.85 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.82 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.8 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.78 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.74 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.73 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.7 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.7 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.7 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.69 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.68 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.68 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.66 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.65 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.65 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.64 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.61 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.59 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 98.58 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.58 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.57 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.57 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 98.57 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.55 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.51 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.48 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.47 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 98.46 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.45 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.45 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.43 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 98.42 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.41 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.38 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.37 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 98.37 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.36 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.36 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.35 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.28 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.25 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.23 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.22 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.22 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 98.21 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 98.21 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.21 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.21 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.21 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.2 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 98.18 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 98.18 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.16 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 98.15 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.13 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.12 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.12 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.1 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.09 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.07 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 98.07 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.03 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.02 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.99 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.98 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 97.95 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.92 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 97.91 | |
| d1hcia1 | 125 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 97.87 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 97.86 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.84 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 97.83 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.73 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.71 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 97.63 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.57 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.47 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.44 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 97.35 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 97.3 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 97.24 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 97.11 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 97.09 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 96.96 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 96.9 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 96.83 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 96.79 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 96.44 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 96.43 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 95.93 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 95.87 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 95.85 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 95.75 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.55 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 95.54 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 95.48 | |
| d1hcia1 | 125 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 95.07 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 95.06 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 94.51 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 94.49 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 94.35 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 94.34 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 92.74 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 92.55 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 92.13 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 91.99 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 91.54 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 91.33 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 91.29 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 90.07 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 90.0 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 88.82 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 87.9 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 87.42 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 86.9 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 85.97 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 85.96 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 85.52 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 84.16 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 83.92 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 83.64 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 83.07 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 81.31 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 81.27 |
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calmodulin species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.44 E-value=6.8e-14 Score=120.85 Aligned_cols=75 Identities=25% Similarity=0.587 Sum_probs=71.5
Q ss_pred cCCCCHHHHHHHHHHhcccCCCCCCcccHHHHHHHHHHcCCCCCCCCCCCChHHHHHHHHHhCCCCCCcccHHHHHHHHh
Q psy6935 1485 QSGVSEDALKEFSMMFKHFDKDKSGKLNQTEFKSCLRALGYDLPMVEEGQPDPEFEAILDLVDPNRDGHVSLQEYMAFMI 1564 (1575)
Q Consensus 1485 ~~~~~~~~~~~~~~~F~~~D~~~~g~i~~~el~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~ 1564 (1575)
++++|++++.+++.+|+.||+|++|+|+..||+.+|+.+|+.+ ++.++..++..+|++++|.|+|+||+.+|.
T Consensus 1 ~~~lt~eqi~el~~~F~~~D~d~~G~I~~~el~~~l~~~g~~~-------t~~e~~~~~~~~D~~~~g~I~~~eF~~~m~ 73 (77)
T d1f54a_ 1 SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSP-------SEAEVNDLMNEIDVDGNHQIEFSEFLALMS 73 (77)
T ss_dssp CCCCCHHHHHHHHHHHHHTCTTCSSEEEHHHHHHHHHHHTCCC-------CHHHHHHHHHTTCCSSCCEEEHHHHHHHHT
T ss_pred CCCCCHHHHHHHHHHHHHHcCCCCCeEChHHHHHHHHHhCCCC-------CHHHHHHHHHHhCCCCCCeEeHHHHHHHHH
Confidence 3579999999999999999999999999999999999999999 999999999999999999999999999997
Q ss_pred hh
Q psy6935 1565 SK 1566 (1575)
Q Consensus 1565 ~~ 1566 (1575)
.+
T Consensus 74 ~~ 75 (77)
T d1f54a_ 74 RQ 75 (77)
T ss_dssp TS
T ss_pred Hh
Confidence 54
|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|