Psyllid ID: psy6980
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 760 | 2.2.26 [Sep-21-2011] | |||||||
| Q8WML3 | 1784 | Histone acetyltransferase | N/A | N/A | 0.538 | 0.229 | 0.501 | 1e-118 | |
| Q92794 | 2004 | Histone acetyltransferase | yes | N/A | 0.4 | 0.151 | 0.629 | 1e-117 | |
| Q5TKR9 | 1998 | Histone acetyltransferase | yes | N/A | 0.4 | 0.152 | 0.626 | 1e-117 | |
| Q8BZ21 | 2003 | Histone acetyltransferase | no | N/A | 0.4 | 0.151 | 0.626 | 1e-117 | |
| Q8BRB7 | 1872 | Histone acetyltransferase | no | N/A | 0.405 | 0.164 | 0.616 | 1e-114 | |
| Q8WYB5 | 2073 | Histone acetyltransferase | no | N/A | 0.4 | 0.146 | 0.613 | 1e-113 | |
| Q5SVQ0 | 613 | Histone acetyltransferase | no | N/A | 0.386 | 0.479 | 0.545 | 2e-95 | |
| Q810T5 | 612 | Histone acetyltransferase | no | N/A | 0.386 | 0.480 | 0.545 | 2e-95 | |
| O95251 | 611 | Histone acetyltransferase | no | N/A | 0.386 | 0.481 | 0.545 | 2e-95 | |
| Q9LXD7 | 445 | MYST-like histone acetylt | yes | N/A | 0.422 | 0.721 | 0.487 | 3e-84 |
| >sp|Q8WML3|KAT6B_MACFA Histone acetyltransferase KAT6B OS=Macaca fascicularis GN=KAT6B PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 427 bits (1097), Expect = e-118, Method: Compositional matrix adjust.
Identities = 210/419 (50%), Positives = 278/419 (66%), Gaps = 10/419 (2%)
Query: 141 LIKCCACNVYYHIICLQPPLERRLKVPWKCTSCESGTTEPSPAKTSPGRARASLTTSFRE 200
++ C +C+ +H+ C PPL R K W C C + +
Sbjct: 285 MLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGR 344
Query: 201 RKKQLKQQRLAA---KGTPQKRGKRASVDMMVSEDVVSKLLATDLAPG---VTRKDIDLY 254
K +LKQ+ L+ +G+ R S D + ++ + ++ VT +D+D++
Sbjct: 345 PKNKLKQRLLSVTSDEGSMNAFTGRGSPDTEIKINIKQESADVNVIGNKDVVTEEDLDVF 404
Query: 255 KQAHEEATKATPLLPLAVPEQINPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLK 314
KQA E + + P+ IEFG+YE++TWYSSP+PQEYARLPKL+LCEFCLK
Sbjct: 405 KQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLK 464
Query: 315 YTKSKAVLERHRDKCAWRHPPATEIYRKENLSVFEVDGNQNKFYCQNLCLLAKLFLDHKT 374
Y KSK +L RH KC W HPPA EIYR+++LSVFEVDGN +K YCQNLCLLAKLFLDHKT
Sbjct: 465 YMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKT 524
Query: 375 LYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFLIDF 434
LYYDVEPFLFYVLT+ND+KGCHLVGYFSKEK CQQKYNVSCIM +PQ+QR+G+GRFLIDF
Sbjct: 525 LYYDVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDF 584
Query: 435 SYLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYH 494
SYLLS++EGQ G+PEKPLSDLGR+SY AYWKSV+LEYL +++ I I + TG+
Sbjct: 585 SYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYL-YHHHERHISIKAISRATGMCP 643
Query: 495 HDVAETLELLGMLRTKHGDSSEPCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTPLV 553
HD+A TL+ L M+ + G I+ ++ +HM++L+ ++DP+ LRWTP++
Sbjct: 644 HDIATTLQHLHMIDKRDGGF---VIIRREKLILSHMEKLKTCSRANELDPDSLRWTPIL 699
|
Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Macaca fascicularis (taxid: 9541) EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8 |
| >sp|Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens GN=KAT6A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BZ21|KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus GN=Kat6a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens GN=KAT6B PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LXD7|MYST2_ARATH MYST-like histone acetyltransferase 2 OS=Arabidopsis thaliana GN=HAG5 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 760 | ||||||
| 91088841 | 2385 | PREDICTED: similar to enoki mushroom CG1 | 0.551 | 0.175 | 0.579 | 1e-146 | |
| 345493490 | 2181 | PREDICTED: hypothetical protein LOC10011 | 0.548 | 0.191 | 0.520 | 1e-139 | |
| 242018362 | 2199 | myst histone acetyltransferase, putative | 0.593 | 0.205 | 0.516 | 1e-136 | |
| 322797567 | 2490 | hypothetical protein SINV_14658 [Solenop | 0.478 | 0.146 | 0.588 | 1e-133 | |
| 383848388 | 2520 | PREDICTED: uncharacterized protein LOC10 | 0.630 | 0.190 | 0.484 | 1e-133 | |
| 332031359 | 2416 | Histone acetyltransferase MYST3 [Acromyr | 0.514 | 0.161 | 0.574 | 1e-132 | |
| 380021863 | 2641 | PREDICTED: uncharacterized protein LOC10 | 0.439 | 0.126 | 0.604 | 1e-132 | |
| 307187782 | 2367 | Histone acetyltransferase MYST4 [Campono | 0.418 | 0.134 | 0.646 | 1e-132 | |
| 357622278 | 2339 | hypothetical protein KGM_15998 [Danaus p | 0.55 | 0.178 | 0.549 | 1e-131 | |
| 427797307 | 2011 | Putative histone acetyltransferase myst | 0.548 | 0.207 | 0.549 | 1e-130 |
| >gi|91088841|ref|XP_970807.1| PREDICTED: similar to enoki mushroom CG11290-PA [Tribolium castaneum] gi|270012338|gb|EFA08786.1| hypothetical protein TcasGA2_TC006477 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 525 bits (1351), Expect = e-146, Method: Compositional matrix adjust.
Identities = 262/452 (57%), Positives = 320/452 (70%), Gaps = 33/452 (7%)
Query: 229 VSEDVVSKLLATDLAPGVTRKDIDLYKQAHEEATKATPLLPLAVPEQINP---------- 278
++ + ++ L PGVT+KD+DL+K+ E+A T LLP P +P
Sbjct: 743 IANNQTDEIKPPQLPPGVTQKDVDLFKETREKANATTALLPPGTPFVTSPSLVMSSQGRC 802
Query: 279 -AAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPAT 337
AAIEFG+YE++TWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERH+DKC WRHPPAT
Sbjct: 803 PAAIEFGKYEIQTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHQDKCTWRHPPAT 862
Query: 338 EIYRKENLSVFEVDGNQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCHL 397
EIYR +LSVFEVDGN NK YCQNLCLLAKLFLDHKTLYYDVEPFLFYVLT+ND KGCHL
Sbjct: 863 EIYRCGDLSVFEVDGNVNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDKKGCHL 922
Query: 398 VGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFLIDFSYLLSKKEGQRGTPEKPLSDLGR 457
VGYFSKEKHCQQKYNVSCIMT+PQYQR+G+GRFLIDFSYLLSK+EGQ GTPEKPLSDLGR
Sbjct: 923 VGYFSKEKHCQQKYNVSCIMTMPQYQRQGFGRFLIDFSYLLSKREGQPGTPEKPLSDLGR 982
Query: 458 VSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGMLRTKHGDSS-E 516
VSY+AYWKSV+LEYL RN KL D + +TG+Y HD+A L+LLG +R ++ +
Sbjct: 983 VSYYAYWKSVVLEYLHAHRNAKLKLTD-ISKETGMYCHDIALALQLLGFVRCVSTETGRK 1041
Query: 517 PCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTPLVSHIVNPYKTLTKESSKPSSGGNV 576
P + I+WA VD+H +R+ +SKTRIKID ECLRWTPL++ VNP++ + K S+
Sbjct: 1042 PVLCIDWAKVDSHAERVSKSKTRIKIDAECLRWTPLLTSTVNPFREEKSDGEKEST---- 1097
Query: 577 DAETTATETTEKEDEAETEEETVVKKTKRGRKRKLSLDTDAASPVVEVTPKKTRKESESK 636
AET + E ++ V K K+GRKRK+S TPK + E ++
Sbjct: 1098 PAETADIVIPQPEKIIIETQQGV--KLKKGRKRKIS--------TAPKTPKVAKSEPKTP 1147
Query: 637 NTTASETTASETPCTEELDVMTPSSRKESESK 668
T + P EE+++ + R+ SK
Sbjct: 1148 QVTPN------NPTKEEVEITSSGRRRTRPSK 1173
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345493490|ref|XP_001601199.2| PREDICTED: hypothetical protein LOC100116786 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242018362|ref|XP_002429646.1| myst histone acetyltransferase, putative [Pediculus humanus corporis] gi|212514631|gb|EEB16908.1| myst histone acetyltransferase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|322797567|gb|EFZ19611.1| hypothetical protein SINV_14658 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383848388|ref|XP_003699833.1| PREDICTED: uncharacterized protein LOC100883236 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332031359|gb|EGI70872.1| Histone acetyltransferase MYST3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380021863|ref|XP_003694776.1| PREDICTED: uncharacterized protein LOC100872339 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307187782|gb|EFN72748.1| Histone acetyltransferase MYST4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|357622278|gb|EHJ73824.1| hypothetical protein KGM_15998 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|427797307|gb|JAA64105.1| Putative histone acetyltransferase myst family, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 760 | ||||||
| FB|FBgn0034975 | 2291 | enok "enoki mushroom" [Drosoph | 0.411 | 0.136 | 0.6 | 7e-113 | |
| UNIPROTKB|A5PLL3 | 815 | MYST3 "MYST3 protein" [Homo sa | 0.4 | 0.373 | 0.629 | 4.3e-111 | |
| UNIPROTKB|E1BS85 | 813 | E1BS85 "Uncharacterized protei | 0.4 | 0.373 | 0.629 | 6.3e-110 | |
| MGI|MGI:2442415 | 2003 | Kat6a "K(lysine) acetyltransfe | 0.4 | 0.151 | 0.626 | 2.3e-109 | |
| UNIPROTKB|F1SE29 | 1580 | KAT6A "Uncharacterized protein | 0.4 | 0.192 | 0.626 | 3.6e-109 | |
| UNIPROTKB|Q92794 | 2004 | KAT6A "Histone acetyltransfera | 0.4 | 0.151 | 0.629 | 1.3e-108 | |
| UNIPROTKB|E1BEB3 | 2009 | KAT6A "Uncharacterized protein | 0.4 | 0.151 | 0.629 | 1.3e-108 | |
| UNIPROTKB|E2R922 | 2027 | KAT6A "Uncharacterized protein | 0.4 | 0.149 | 0.629 | 1.4e-108 | |
| RGD|1304892 | 1998 | Kat6a "K(lysine) acetyltransfe | 0.4 | 0.152 | 0.626 | 3.4e-108 | |
| ZFIN|ZDB-GENE-021022-3 | 2247 | kat6a "K(lysine) acetyltransfe | 0.406 | 0.137 | 0.623 | 5.4e-108 |
| FB|FBgn0034975 enok "enoki mushroom" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1045 (372.9 bits), Expect = 7.0e-113, Sum P(4) = 7.0e-113
Identities = 195/325 (60%), Positives = 242/325 (74%)
Query: 242 LAPGVTRKDIDLYKQAHEEAT---------KATPLLPLAVPEQINPAAIEFGQYEVKTWY 292
L PGVT D++LY++ +A K + + +P +I+ G+++++TWY
Sbjct: 667 LPPGVTATDVELYQEVLHKAVVQMSNNHIEKVNDVSLKSGQNTQSPKSIQIGKWDIETWY 726
Query: 293 SSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPATEIYRKENLSVFEVDG 352
SSPFPQEYARL KLFLCEFCLKYTKS++VL+RH++KC W+ PP TEI+R+ N+SVFEVDG
Sbjct: 727 SSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGNISVFEVDG 786
Query: 353 NQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYN 412
N NK YCQNLCLLAK FLDHKTLYYDVEPFLFY+LT+ND GCHLVGYFSKEKHC QKYN
Sbjct: 787 NVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKHCTQKYN 846
Query: 413 VSCIMTLPQYQRKGYGRFLIDFSYLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYL 472
VSCI+T+PQYQR+GYGRFLIDFSYLLS++EGQ GTPEKPLSDLGR+SY +YWKSV+LEYL
Sbjct: 847 VSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYL 906
Query: 473 DTIRNQKLICIDQMCADTGLYHHDVAETLELLGMLRTKHGDSS---EPCIVINWAIVDAH 529
RN I + TGL D+A ELL ++ + D + + I W V AH
Sbjct: 907 YKHRNYTKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEWKKVLAH 966
Query: 530 MKRLEQSKTRIKIDPECLRWTPLVS 554
++ SKTRI I+P+CLRW+PL+S
Sbjct: 967 HNKMANSKTRIIIEPDCLRWSPLLS 991
|
|
| UNIPROTKB|A5PLL3 MYST3 "MYST3 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS85 E1BS85 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442415 Kat6a "K(lysine) acetyltransferase 6A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SE29 KAT6A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92794 KAT6A "Histone acetyltransferase KAT6A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BEB3 KAT6A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R922 KAT6A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1304892 Kat6a "K(lysine) acetyltransferase 6A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-021022-3 kat6a "K(lysine) acetyltransferase 6A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8LI34 | MYST1_ORYSJ | 2, ., 3, ., 1, ., 4, 8 | 0.5218 | 0.3815 | 0.6444 | yes | N/A |
| P0CP02 | ESA1_CRYNJ | 2, ., 3, ., 1, ., 4, 8 | 0.5018 | 0.3552 | 0.4787 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.3.1 | 0.691 |
| 3rd Layer | 2.3.1.48 | 0.737 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 760 | |||
| PLN00104 | 450 | PLN00104, PLN00104, MYST -like histone acetyltrans | 1e-123 | |
| pfam01853 | 189 | pfam01853, MOZ_SAS, MOZ/SAS family | 1e-110 | |
| PLN03238 | 290 | PLN03238, PLN03238, probable histone acetyltransfe | 1e-109 | |
| COG5027 | 395 | COG5027, SAS2, Histone acetyltransferase (MYST fam | 1e-105 | |
| PTZ00064 | 552 | PTZ00064, PTZ00064, histone acetyltransferase; Pro | 1e-83 | |
| PLN03239 | 351 | PLN03239, PLN03239, histone acetyltransferase; Pro | 2e-80 | |
| PLN00104 | 450 | PLN00104, PLN00104, MYST -like histone acetyltrans | 3e-05 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 9e-05 | |
| PLN03238 | 290 | PLN03238, PLN03238, probable histone acetyltransfe | 2e-04 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 5e-04 | |
| PLN03239 | 351 | PLN03239, PLN03239, histone acetyltransferase; Pro | 0.001 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 0.004 |
| >gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
Score = 376 bits (966), Expect = e-123
Identities = 156/301 (51%), Positives = 198/301 (65%), Gaps = 22/301 (7%)
Query: 256 QAHEEATKATPLLPLAVPEQINPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKY 315
+ HEE TK N A IE G+YE+ TWY SPFP EY KL+ CEFCLK+
Sbjct: 159 REHEEFTKVK-----------NIATIELGRYEIDTWYFSPFPPEYNDCSKLYFCEFCLKF 207
Query: 316 TKSKAVLERHRDKCAWRHPPATEIYRK----ENLSVFEVDGNQNKFYCQNLCLLAKLFLD 371
K K L+RH KC +HPP EIYR E LS+FEVDG +NK YCQNLC LAKLFLD
Sbjct: 208 MKRKEQLQRHMKKCDLKHPPGDEIYRHPTRQEGLSMFEVDGKKNKVYCQNLCYLAKLFLD 267
Query: 372 HKTLYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFL 431
HKTLYYDV+ FLFYVL + DD+GCH+VGYFSKEKH ++ YN++CI+TLP YQRKGYG+FL
Sbjct: 268 HKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEEDYNLACILTLPPYQRKGYGKFL 327
Query: 432 IDFSYLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTG 491
I FSY LSK+EG+ GTPE+PLSDLG VSY YW VLLE L + I I ++ T
Sbjct: 328 IAFSYELSKREGKVGTPERPLSDLGLVSYRGYWTRVLLEILKKHKGN--ISIKELSDMTA 385
Query: 492 LYHHDVAETLELLGMLRTKHGDSSEPCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTP 551
+ D+ TL+ L +++ + G + I + +++ H+K + +++DP L WTP
Sbjct: 386 IKAEDIVSTLQSLNLIQYRKG---QHVICADPKVLEEHLK--AAGRGGLEVDPSKLIWTP 440
Query: 552 L 552
Sbjct: 441 Y 441
|
Length = 450 |
| >gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family | Back alignment and domain information |
|---|
| >gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 760 | |||
| KOG2747|consensus | 396 | 100.0 | ||
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 100.0 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 100.0 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 100.0 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 100.0 | |
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 100.0 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 100.0 | |
| KOG1244|consensus | 336 | 99.89 | ||
| KOG1512|consensus | 381 | 99.42 | ||
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 99.24 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 99.17 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 99.09 | |
| KOG2747|consensus | 396 | 98.97 | ||
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 98.93 | |
| KOG0825|consensus | 1134 | 98.69 | ||
| KOG4443|consensus | 694 | 98.51 | ||
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 98.46 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.2 | |
| KOG4299|consensus | 613 | 98.03 | ||
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.84 | |
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 97.82 | |
| KOG0957|consensus | 707 | 97.47 | ||
| KOG1245|consensus | 1404 | 97.35 | ||
| KOG1973|consensus | 274 | 96.48 | ||
| KOG0955|consensus | 1051 | 96.3 | ||
| KOG4323|consensus | 464 | 96.25 | ||
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.14 | |
| KOG0383|consensus | 696 | 95.78 | ||
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 95.48 | |
| KOG0954|consensus | 893 | 95.36 | ||
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 95.07 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 94.74 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 94.2 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 93.99 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 93.88 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 93.74 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 92.85 | |
| PHA01807 | 153 | hypothetical protein | 92.57 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 92.48 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 92.41 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 92.17 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.13 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 92.02 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 91.73 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 91.42 | |
| KOG1246|consensus | 904 | 91.41 | ||
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 91.36 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 90.84 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 90.81 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 90.77 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 90.43 | |
| KOG3216|consensus | 163 | 90.41 | ||
| PLN02825 | 515 | amino-acid N-acetyltransferase | 90.34 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 90.2 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 89.68 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 89.45 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 89.3 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 89.2 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 89.15 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 89.06 | |
| PF09756 | 188 | DDRGK: DDRGK domain; InterPro: IPR019153 This is a | 88.89 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 88.78 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 88.57 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 88.57 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 88.2 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 88.13 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 86.95 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 86.8 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 86.66 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 86.57 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 86.11 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 85.66 | |
| TIGR02010 | 135 | IscR iron-sulfur cluster assembly transcription fa | 85.43 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 85.06 | |
| PF12324 | 77 | HTH_15: Helix-turn-helix domain of alkylmercury ly | 84.11 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 83.64 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 83.42 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 83.02 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 82.79 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 82.38 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 81.4 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 81.39 | |
| COG1959 | 150 | Predicted transcriptional regulator [Transcription | 81.36 | |
| PF04760 | 54 | IF2_N: Translation initiation factor IF-2, N-termi | 81.35 | |
| PRK10857 | 164 | DNA-binding transcriptional regulator IscR; Provis | 80.94 | |
| KOG1473|consensus | 1414 | 80.11 | ||
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 80.02 |
| >KOG2747|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.7e-116 Score=936.77 Aligned_cols=277 Identities=57% Similarity=1.029 Sum_probs=264.5
Q ss_pred CCCCCCCCCCCCCEEEeCCeeEecccCCCChhhhcCCCcEeeecccccccCCHHHHHHHHhhCCCCCCCCceeeecCCeE
Q psy6980 267 LLPLAVPEQINPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPATEIYRKENLS 346 (760)
Q Consensus 267 ~~~~~~~~~r~~~~I~~G~y~i~tWY~SPyP~ey~~~~~LyiCE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR~~~is 346 (760)
......+.+|||..|+||+|+|+|||+||||+||+++++||||||||+||+++..|+||+.+|.++||||+||||+++||
T Consensus 119 ~~~~~~~~~r~i~~i~~G~yei~~WY~SPyP~e~~~~~~lYiCEfCLkY~~s~~~l~rH~~kC~~rhPPG~EIYR~~~iS 198 (396)
T KOG2747|consen 119 QEHEEVEKVRNIEKIEFGRYEIKTWYFSPYPEEYAKLDKLYICEFCLKYMKSRTSLQRHLKKCKLRHPPGNEIYRKGNIS 198 (396)
T ss_pred ccccccceecccceEEEcceeeeeeecCCCchhhccCCeEEEehHHHhHhchHHHHHHHHHhcCCCCCCcceeeecCCEE
Confidence 34445678999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEeCCcchhhHHHHHHhhhhcccccccccccCCceEEEEEEeCCCCceEEeeecccccCCCCceeEEEEecCcccccc
Q psy6980 347 VFEVDGNQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYNVSCIMTLPQYQRKG 426 (760)
Q Consensus 347 vfEVDG~~~k~YCQnLCLLaKLFLDhKTLyyDVepFlFYVLte~D~~G~h~VGYFSKEK~s~~~nNLSCIltLP~yQrkG 426 (760)
||||||+++++|||||||||||||||||||||||||||||||+.|+.|| ||||||||.|.++||||||||||||||+|
T Consensus 199 vfEVDG~~~k~YCQnLCLlaKLFLdhKTLYyDvdpFlFYVlte~d~~G~--VGYFSKEK~s~~~yNlaCILtLPpyQRkG 276 (396)
T KOG2747|consen 199 VFEVDGRKQKLYCQNLCLLAKLFLDHKTLYYDVDPFLFYVLTECDSYGC--VGYFSKEKESSENYNLACILTLPPYQRKG 276 (396)
T ss_pred EEEecCcchhHHHHHHHHHHHHHhcCceeEEeccceEEEEEEecCCcce--eeeeccccccccccceeeeeecChhhhcc
Confidence 9999999999999999999999999999999999999999999999996 99999999999999999999999999999
Q ss_pred cCccchhhhhhhhcccCCCCCCCCCCChhHHHHHHHhhHHHHHHHHHhccCCcceeHHHHHHhhCCChhHHHHHHHHcCc
Q psy6980 427 YGRFLIDFSYLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGM 506 (760)
Q Consensus 427 yG~~LIdfSY~LSr~Eg~~GtPEkPLSDLG~~sY~sYW~~~Il~~L~~~~~~~~isi~dIS~~TgI~~~DIi~tL~~l~~ 506 (760)
||+|||||||+|||+||++|||||||||||++|||+||+.+|+++|.++. +..|||++||++|||+++|||+|||+|||
T Consensus 277 YGklLIdFSYeLSr~E~~~GsPEKPLSDLGllsYrsYW~~~ll~~L~~~~-~~~isI~~iS~~Tgi~~~DIisTL~~L~m 355 (396)
T KOG2747|consen 277 YGKLLIDFSYELSRREGKIGSPEKPLSDLGLLSYRSYWRCVLLELLRKHR-GEHISIKEISKETGIRPDDIISTLQSLNM 355 (396)
T ss_pred cchhhhhhhhhhhcccCcCCCCCCCcchhhHHHHHHHHHHHHHHHHHhcC-CCcccHHHHHHhhCCCHHHHHHHHHhhCC
Confidence 99999999999999999999999999999999999999999999999988 44599999999999999999999999999
Q ss_pred eeeecCCCCCcEEEee-HHHHHHHHHHHHhCCCcceecCCCCeEe
Q psy6980 507 LRTKHGDSSEPCIVIN-WAIVDAHMKRLEQSKTRIKIDPECLRWT 550 (760)
Q Consensus 507 l~~~~~~~~~~~i~i~-~~~i~~~~~~~~~~~~~~~idp~~L~W~ 550 (760)
++++ ++++++++ +..|+.+...+...++...+||++|.|+
T Consensus 356 ~~y~----k~~~~~~~~~~~i~~~~~~~~~~k~~~~~~~~~l~W~ 396 (396)
T KOG2747|consen 356 IKYY----KGYIISICSDDKLEDHKRNWAKFKKPRLLDPDCLLWT 396 (396)
T ss_pred cccc----CCeeEEEechHHHHHHHHHhhccCCccccCchhcccC
Confidence 9999 33788888 6888888888777678889999999996
|
|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >KOG1244|consensus | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2747|consensus | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG1973|consensus | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >KOG1246|consensus | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >KOG3216|consensus | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG1959 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK10857 DNA-binding transcriptional regulator IscR; Provisional | Back alignment and domain information |
|---|
| >KOG1473|consensus | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 760 | ||||
| 2ozu_A | 284 | Crystal Structure Of Human Myst Histone Acetyltrans | 1e-109 | ||
| 2rc4_A | 287 | Crystal Structure Of The Hat Domain Of The Human Mo | 1e-108 | ||
| 3qah_A | 304 | Crystal Structure Of Apo-Form Human Mof Catalytic D | 4e-80 | ||
| 4dnc_A | 289 | Crystal Structure Of Human Mof In Complex With Msl1 | 6e-80 | ||
| 2pq8_A | 278 | Myst Histone Acetyltransferase 1 Length = 278 | 1e-79 | ||
| 2giv_A | 295 | Human Myst Histone Acetyltransferase 1 Length = 295 | 2e-79 | ||
| 2y0m_A | 287 | Crystal Structure Of The Complex Between Dosage Com | 4e-79 | ||
| 2ou2_A | 280 | Acetyltransferase Domain Of Human Hiv-1 Tat Interac | 1e-78 | ||
| 3tob_A | 270 | Human Mof E350q Crystal Structure With Active Site | 1e-77 | ||
| 3toa_A | 266 | Human Mof Crystal Structure With Active Site Lysine | 2e-76 | ||
| 1fy7_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 6e-73 | ||
| 3to6_A | 276 | Crystal Structure Of Yeast Esa1 Hat Domain Complexe | 3e-72 | ||
| 1mj9_A | 278 | Crystal Structure Of Yeast Esa1(C304s) Mutant Compl | 4e-72 | ||
| 1mja_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 6e-72 | ||
| 3to9_A | 276 | Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo | 7e-72 | ||
| 1mjb_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 2e-71 | ||
| 1m36_A | 33 | Solution Structure Of A Cchc Zinc Finger From Moz L | 3e-07 |
| >pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 | Back alignment and structure |
|
| >pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 | Back alignment and structure |
| >pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 | Back alignment and structure |
| >pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 | Back alignment and structure |
| >pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 | Back alignment and structure |
| >pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 | Back alignment and structure |
| >pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 | Back alignment and structure |
| >pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 | Back alignment and structure |
| >pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 | Back alignment and structure |
| >pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 | Back alignment and structure |
| >pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|1M36|A Chain A, Solution Structure Of A Cchc Zinc Finger From Moz Length = 33 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 | Back alignment and structure |
|---|
Score = 390 bits (1004), Expect = e-131
Identities = 185/277 (66%), Positives = 218/277 (78%), Gaps = 4/277 (1%)
Query: 277 NPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPA 336
P+ IEFG+YE+ TWYSSP+PQEY+RLPKL+LCEFCLKY KS+ +L++H KC W HPPA
Sbjct: 12 CPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPA 71
Query: 337 TEIYRKENLSVFEVDGNQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCH 396
EIYRK N+SVFEVDGN + YCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQND KGCH
Sbjct: 72 NEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCH 131
Query: 397 LVGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFLIDFSYLLSKKEGQRGTPEKPLSDLG 456
LVGYFSKEKHCQQKYNVSCIM LPQYQRKGYGRFLIDFSYLLSK+EGQ G+PEKPLSDLG
Sbjct: 132 LVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLG 191
Query: 457 RVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGMLRTKHGDSSE 516
R+SY AYWKSV+LE L + K I I ++ TG+ D+ TL L ML + +
Sbjct: 192 RLSYMAYWKSVILECLYHQND-KQISIKKLSKLTGICPQDITSTLHHLRMLDFRSD---Q 247
Query: 517 PCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTPLV 553
I+ ++ HM +L+ + + +DPECLRWTP++
Sbjct: 248 FVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI 284
|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 320 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 760 | |||
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 100.0 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 100.0 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 100.0 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 100.0 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 99.74 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.69 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.68 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.51 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.44 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.43 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.38 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.28 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.26 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.25 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.2 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.13 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.07 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.05 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.03 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.97 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.97 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.97 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 98.92 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.92 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 98.85 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.83 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 98.83 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 98.83 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.81 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.79 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 98.76 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.75 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.72 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.57 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.51 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.16 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.05 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.04 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.02 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.01 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.86 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.85 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 97.78 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.77 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.52 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.37 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.19 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.67 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.66 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 96.61 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 96.3 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.17 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.08 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 95.98 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 95.9 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 95.9 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 95.89 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 95.76 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 95.75 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 95.71 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 95.61 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 95.59 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 95.59 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 95.58 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 95.55 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 95.37 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 95.08 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 94.88 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 94.84 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 94.65 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 94.62 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 94.62 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 94.58 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 94.48 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 94.46 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 94.44 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 94.42 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 94.39 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 94.36 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 94.29 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 94.22 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 94.21 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 94.19 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 94.18 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 94.16 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 94.15 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 94.15 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 94.07 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 94.05 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 94.05 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 94.0 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 93.96 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 93.95 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 93.92 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 93.89 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 93.81 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 93.76 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 93.74 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 93.73 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 93.73 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 93.71 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 93.69 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 93.66 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 93.66 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 93.62 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 93.58 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 93.56 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 93.54 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 93.53 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 93.51 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 93.42 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 93.28 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 93.26 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 93.21 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 93.07 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 93.07 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 93.06 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 93.01 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 92.96 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 92.94 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 92.88 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 92.83 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 92.82 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 92.82 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 92.75 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 92.67 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 92.6 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 92.59 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 92.58 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 92.52 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 92.41 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 92.38 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 92.37 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 92.27 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 92.21 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 92.19 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 92.17 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 92.17 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 92.07 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 92.01 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 91.99 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 91.94 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 91.92 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 91.88 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 91.81 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 91.64 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 91.62 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 91.61 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 91.53 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 91.52 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 91.26 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 91.26 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 91.26 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 91.13 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 91.06 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 91.04 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 90.92 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 90.9 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 90.89 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 90.77 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 90.68 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 90.56 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 90.53 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 90.46 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 90.42 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 90.37 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 90.34 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 90.32 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 90.01 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 89.86 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 89.68 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 89.27 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 89.26 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 89.19 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 89.08 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 89.03 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 88.99 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 88.83 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 88.66 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 88.65 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 88.63 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 88.36 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 88.3 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 88.13 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 87.85 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 87.49 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 87.44 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 87.3 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 87.3 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 87.22 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 87.2 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 87.18 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 87.07 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 86.82 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.66 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 86.38 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.18 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 86.12 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.07 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 86.03 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.99 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 85.7 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.69 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 85.62 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 85.6 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 85.46 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 85.42 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 85.38 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 85.27 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 85.26 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 84.93 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 84.88 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 84.81 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.76 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 84.48 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 84.46 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 84.83 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 84.4 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 84.07 | |
| 1wi9_A | 72 | Protein C20ORF116 homolog; helix-turn-helix motif, | 84.02 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 83.95 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 83.73 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 83.51 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 83.44 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 83.43 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 83.41 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 83.4 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 83.33 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 83.33 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 83.13 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.91 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 82.72 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 83.03 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 82.2 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 82.11 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.07 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 82.02 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.01 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 82.0 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 81.94 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 82.62 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 81.74 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.71 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.68 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.58 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 81.52 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 81.41 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 81.39 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.34 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.33 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 81.33 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 81.25 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.17 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 81.16 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.06 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 80.93 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 80.91 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.85 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.82 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.7 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.68 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.64 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 80.59 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 80.58 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 80.5 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.48 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.44 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 80.42 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.34 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.14 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.08 |
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-118 Score=921.95 Aligned_cols=282 Identities=66% Similarity=1.182 Sum_probs=250.2
Q ss_pred CCCCCCCCCCCCEEEeCCeeEecccCCCChhhhcCCCcEeeecccccccCCHHHHHHHHhhCCCCCCCCceeeecCCeEE
Q psy6980 268 LPLAVPEQINPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPATEIYRKENLSV 347 (760)
Q Consensus 268 ~~~~~~~~r~~~~I~~G~y~i~tWY~SPyP~ey~~~~~LyiCE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR~~~isv 347 (760)
+.++++++|||+.|+||+|+|+|||+||||+||.++++||||||||+||+++..|.||+.+|.++||||+||||++++||
T Consensus 3 ~~~~~~~vr~i~~I~~G~y~i~tWY~SPYP~e~~~~~~lyiCe~Clky~~~~~~~~~H~~~C~~~hPPG~eIYR~~~~sv 82 (284)
T 2ozu_A 3 TGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISV 82 (284)
T ss_dssp --------CCSCEEEETTEEEECSSCCCCSTTSTTCSEEEECTTTCCEESSHHHHHHHHHHCCCSSCSSEEEEEETTEEE
T ss_pred CCCccccccCCCEEEECCEEEcccccCCCChhHcCCCcEEEchhhHhHhCCHHHHHHHhccCCCCCCCCceeEEeCCEEE
Confidence 44567789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEeCCcchhhHHHHHHhhhhcccccccccccCCceEEEEEEeCCCCceEEeeecccccCCCCceeEEEEecCccccccc
Q psy6980 348 FEVDGNQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYNVSCIMTLPQYQRKGY 427 (760)
Q Consensus 348 fEVDG~~~k~YCQnLCLLaKLFLDhKTLyyDVepFlFYVLte~D~~G~h~VGYFSKEK~s~~~nNLSCIltLP~yQrkGy 427 (760)
|||||+++++|||||||||||||||||||||||||+|||||+.|+.|+|+||||||||.|+++|||||||||||||||||
T Consensus 83 fEVDG~~~k~yCQnLCLlaKLFLdhKtlyyDV~~FlFYVl~~~d~~g~h~vGYFSKEK~s~~~~NLaCIltlP~yQrkGy 162 (284)
T 2ozu_A 83 FEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGY 162 (284)
T ss_dssp EEEETTTSHHHHHHHHHHHHTTCSCCCCTTCCTTEEEEEEEEEETTEEEEEEEEEEESSCTTCEEESEEEECGGGTTSSH
T ss_pred EEEeCcccHHHHHHHHHHHHHhhccceeeeccCceEEEEEEEecCCCceEEEeeeecccccccCcEEEEEecChhHhccH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccchhhhhhhhcccCCCCCCCCCCChhHHHHHHHhhHHHHHHHHHhccCCcceeHHHHHHhhCCChhHHHHHHHHcCce
Q psy6980 428 GRFLIDFSYLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGML 507 (760)
Q Consensus 428 G~~LIdfSY~LSr~Eg~~GtPEkPLSDLG~~sY~sYW~~~Il~~L~~~~~~~~isi~dIS~~TgI~~~DIi~tL~~l~~l 507 (760)
|+|||+|||+|||+||++|||||||||||++||++||+++|+++|.+.. +..|||+|||++|||+++||++||++||||
T Consensus 163 G~lLI~fSYeLSr~Eg~~GsPEkPLSDLG~~sYrsYW~~~il~~L~~~~-~~~isi~~is~~T~i~~~DIi~tL~~l~~l 241 (284)
T 2ozu_A 163 GRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQN-DKQISIKKLSKLTGICPQDITSTLHHLRML 241 (284)
T ss_dssp HHHHHHHHHHHHHHTTCCBEECSSCCHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHCBCHHHHHHHHHHTTCC
T ss_pred hHHHHHHHHHHhhhcCcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcC-CCcEeHHHHHHHhCCCHHHHHHHHHHCCCE
Confidence 9999999999999999999999999999999999999999999998764 578999999999999999999999999999
Q ss_pred eeecCCCCCcEEEeeHHHHHHHHHHHHhCCCcceecCCCCeEecCc
Q psy6980 508 RTKHGDSSEPCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTPLV 553 (760)
Q Consensus 508 ~~~~~~~~~~~i~i~~~~i~~~~~~~~~~~~~~~idp~~L~W~P~~ 553 (760)
+++ +++++|+++.++|++|.++.+.+++++.|||++|+|+|++
T Consensus 242 ~~~---~g~~~i~~~~~~i~~~~~~~~~~~~~~~idp~~L~W~P~~ 284 (284)
T 2ozu_A 242 DFR---SDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI 284 (284)
T ss_dssp ------------CCCHHHHHHHHHHTTC--CCSCCCGGGBCC----
T ss_pred Eee---CCeEEEEcCHHHHHHHHHhhcccCCCceEchhhceecCCC
Confidence 998 4677788889999999988766667789999999999975
|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 760 | ||||
| d2ozua1 | 270 | d.108.1.1 (A:507-776) Histone acetyltransferase MY | 1e-143 | |
| d2ozua1 | 270 | d.108.1.1 (A:507-776) Histone acetyltransferase MY | 5e-08 | |
| d2giva1 | 271 | d.108.1.1 (A:4-274) Probable histone acetyltransfe | 1e-141 | |
| d2giva1 | 271 | d.108.1.1 (A:4-274) Probable histone acetyltransfe | 3e-06 | |
| d1fy7a_ | 273 | d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak | 1e-136 | |
| d1fy7a_ | 273 | d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak | 4e-06 | |
| d1boba_ | 315 | d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak | 4e-26 | |
| d1m36a_ | 33 | g.37.1.2 (A:) Monocytic leukemia zinc finger prote | 8e-14 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 2e-06 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-05 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 6e-05 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 3e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 4e-04 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 5e-04 |
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Histone acetyltransferase MYST3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 418 bits (1075), Expect = e-143
Identities = 182/273 (66%), Positives = 215/273 (78%), Gaps = 4/273 (1%)
Query: 277 NPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPA 336
P+ IEFG+YE+ TWYSSP+PQEY+RLPKL+LCEFCLKY KS+ +L++H KC W HPPA
Sbjct: 2 CPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPA 61
Query: 337 TEIYRKENLSVFEVDGNQNKFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCH 396
EIYRK N+SVFEVDGN + YCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQND KGCH
Sbjct: 62 NEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCH 121
Query: 397 LVGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFLIDFSYLLSKKEGQRGTPEKPLSDLG 456
LVGYFSKEKHCQQKYNVSCIM LPQYQRKGYGRFLIDFSYLLSK+EGQ G+PEKPLSDLG
Sbjct: 122 LVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLG 181
Query: 457 RVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGMLRTKHGDSSE 516
R+SY AYWKSV+LE L +++ I I ++ TG+ D+ TL L ML + +
Sbjct: 182 RLSYMAYWKSVILECLYHQNDKQ-ISIKKLSKLTGICPQDITSTLHHLRMLDFRSD---Q 237
Query: 517 PCIVINWAIVDAHMKRLEQSKTRIKIDPECLRW 549
I+ ++ HM +L+ + + +DPECLRW
Sbjct: 238 FVIIRREKLIQDHMAKLQLNLRPVDVDPECLRW 270
|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 760 | |||
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 100.0 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 100.0 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 100.0 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 99.75 | |
| d1m36a_ | 33 | Monocytic leukemia zinc finger protein Moz {Human | 99.17 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.11 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.02 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 98.74 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 98.68 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 98.67 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.63 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.56 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.01 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.75 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.73 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.73 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.35 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.72 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 95.7 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 95.59 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.5 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 95.27 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 95.07 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 94.7 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 94.58 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 94.5 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 94.31 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 94.16 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 94.16 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 93.71 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 93.7 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 93.67 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 93.5 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 93.5 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 93.49 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 93.17 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 93.03 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 92.87 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 92.86 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 92.81 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 92.7 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 92.52 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 92.08 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 92.0 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 91.96 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 91.75 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 91.59 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 91.14 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 91.0 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 90.8 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 90.67 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 90.23 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 89.88 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 89.76 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 89.62 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.56 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 89.55 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 89.32 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 89.24 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.24 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 88.97 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 88.75 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 88.09 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 88.08 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 87.47 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 86.93 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 86.77 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 86.26 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 86.09 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 86.06 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 85.27 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 85.24 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 84.92 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 84.87 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 84.66 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 84.34 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 84.19 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 84.06 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 83.81 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 83.81 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 83.76 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 83.48 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 83.27 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 83.1 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 83.1 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 83.01 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 82.65 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 82.62 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 82.21 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 82.17 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 81.27 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 81.16 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 80.99 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 80.65 | |
| d1wi9a_ | 72 | Hypothetical protein C20orf116 homolog {Mouse (Mus | 80.59 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 80.39 |
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Probable histone acetyltransferase MYST1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.1e-116 Score=895.59 Aligned_cols=271 Identities=52% Similarity=0.998 Sum_probs=253.8
Q ss_pred CCCCEEEeCCeeEecccCCCChhhhcCCCcEeeecccccccCCHHHHHHHHhhCCCCCCCCceeeecCCeEEEEEeCCcc
Q psy6980 276 INPAAIEFGQYEVKTWYSSPFPQEYARLPKLFLCEFCLKYTKSKAVLERHRDKCAWRHPPATEIYRKENLSVFEVDGNQN 355 (760)
Q Consensus 276 r~~~~I~~G~y~i~tWY~SPyP~ey~~~~~LyiCE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR~~~isvfEVDG~~~ 355 (760)
+||++|+||+|+|+|||+||||+||.+.++||||||||+||+++..|.+|+.+|.++||||+||||++++|||||||+++
T Consensus 1 k~I~~i~~G~y~~~tWY~SPyP~e~~~~~~lyiCe~Cl~y~~~~~~~~~H~~~C~~~~PPG~eIYr~~~~si~EVDG~~~ 80 (271)
T d2giva1 1 KYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVHEVDGKDH 80 (271)
T ss_dssp CCCCEEEETTEEEECSSCCCCCGGGCSSSEEEECTTTCCEESSHHHHHHHHHHCCCCSCSSEEEEEETTEEEEEEETTTS
T ss_pred CCCCEEEECCEEEcCCcCCCCchHhcCCCeEEECcCcCcccCCHHHHHHHHHhCCCcCCCcceEeecCCEEEEEeeCccc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhHHHHHHhhhhcccccccccccCCceEEEEEEeCCCCceEEeeecccccCCCCceeEEEEecCcccccccCccchhhh
Q psy6980 356 KFYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDDKGCHLVGYFSKEKHCQQKYNVSCIMTLPQYQRKGYGRFLIDFS 435 (760)
Q Consensus 356 k~YCQnLCLLaKLFLDhKTLyyDVepFlFYVLte~D~~G~h~VGYFSKEK~s~~~nNLSCIltLP~yQrkGyG~~LIdfS 435 (760)
++|||||||||||||||||||||||||+|||||+.|+.|+||||||||||.|+++||||||||||||||||||+||||||
T Consensus 81 ~~yCqnLcLlaKLFLdhKtl~ydV~~F~FYVl~e~d~~g~h~vGYFSKEk~s~~~~NLsCIltlP~yQrkGyG~lLI~fS 160 (271)
T d2giva1 81 KIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFS 160 (271)
T ss_dssp HHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEECSSCEEEEEEEEEESSCTTCEEESCEEECGGGCSSSHHHHHHHHH
T ss_pred hhhhhHHHHHHHHhcccceeeecCCceEEEEEEEecCCCceEEEeeeeEeccCCCceeeeeeccCHHHhcCHhHhHHhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhcccCCCCCCCCCCChhHHHHHHHhhHHHHHHHHHhccCCcceeHHHHHHhhCCChhHHHHHHHHcCceeeecCCCC
Q psy6980 436 YLLSKKEGQRGTPEKPLSDLGRVSYHAYWKSVLLEYLDTIRNQKLICIDQMCADTGLYHHDVAETLELLGMLRTKHGDSS 515 (760)
Q Consensus 436 Y~LSr~Eg~~GtPEkPLSDLG~~sY~sYW~~~Il~~L~~~~~~~~isi~dIS~~TgI~~~DIi~tL~~l~~l~~~~~~~~ 515 (760)
|+|||+||++|||||||||||+++|++||+.+|+++|.++. ..|||+|||++|||.++||++||++||||+++ ++
T Consensus 161 YeLSr~E~~~G~PEkPLSdLG~~sY~~YW~~~il~~l~~~~--~~isI~~is~~T~i~~~Dii~tL~~l~~l~~~---~g 235 (271)
T d2giva1 161 YELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLENLRDFR--GTLSIKDLSQMTSITQNDIISTLQSLNMVKYW---KG 235 (271)
T ss_dssp HHHHHHTTCCBEECSSCCHHHHHHHHHHHHHHHHHHHC--------CHHHHHHHHCBCHHHHHHHHHHTTCEEEE---TT
T ss_pred hhhhhccCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcC--CCccHHHHHHHhCCCHHHHHHHHHHCCCEEEe---CC
Confidence 99999999999999999999999999999999999998765 58999999999999999999999999999999 47
Q ss_pred CcEEEeeHHHHHHHHHHHHhCCCcceecCCCCeEec
Q psy6980 516 EPCIVINWAIVDAHMKRLEQSKTRIKIDPECLRWTP 551 (760)
Q Consensus 516 ~~~i~i~~~~i~~~~~~~~~~~~~~~idp~~L~W~P 551 (760)
+++|+++++.|+++.++.+.+++++.|||++|+|+|
T Consensus 236 ~~~i~i~~~~~~~~~~~~~~~~~~~~idp~~L~W~P 271 (271)
T d2giva1 236 QHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAP 271 (271)
T ss_dssp EEEECCCTTCCCCCC-------CCSCCCGGGBCCCC
T ss_pred eEEEEeCHHHHHHHHHHHhccCCCceEcccccEeCC
Confidence 788899999999998876666678899999999998
|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|