Psyllid ID: psy7018


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSMVCQSCTDHKVSTEDRAGNSAGWSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
ccEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccEEEEEcccEEEEEEcccccccccEEEEEEEEccccccEEEEcccEEEEcccccccEEEEEEEEEEccccccccccEEEEEcccccccccccccccccccEEEEEEEcccccccccEEEEccccccEEEEEEcccEEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEccccEEEEEccccccccccccEEEEEEEEccccccEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEEEEcccccccccccccccEEEEEEEEcccEEEEEEcc
cccccccccccEEEEEEEEEEcccccccccEEEEEccccccccccccEEEEEcccEEEEEEcccccccccEEEEEEEEEccccEEEEEccEEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEccccEEEEEEccccccccEEEEEEEccccEEEEEEEcccEEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEccccEEEEEEcccccccccEEEEEEEEEEcccccEEEEEEccccEEEEEcccccccEEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEEEcEEEEEEEc
msmvcqsctdhkvstedragnsagwspfsetsvittppgppgsltlrktsvttptsltvswsepanhgspilhyvletsdpaqpsitcdttsyqltglsphttyKSVCQVYLISdkhtqkvdltfesdqlylsglpnsewpsLRTIILTLYFRtaqvpgvppyvsdkgrdgkyksiyngeaqscriqdlkpgtdyAVCVQVHLEEIvgiaseptlfttppcepdqpnppklvtkTRTSLALKWNAAVDNGAHVMHYILEsdqgnatgdfkeisksknknftlskltpstcFRFRLAAVnqhgksadatSVAEWLSYsvytpevkgsvpgGVKVFAALFECALSLVRTIE
msmvcqsctdhkvstedragnsagwspfsetsVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLsglpnsewpSLRTIILTLYFRtaqvpgvppyvsdkgrdGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFttppcepdqpnpPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISksknknftlskltPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
MSMVCQSCTDHKVSTEDRAGNSAGWSPFSETSVIttppgppgSLTLRKtsvttptsltvswsEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
********************************************************************SPILHYVLETS****PSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFT*****************TRTSLALKWNAAVDNGAHVMHYILES*******************FTLSKLTPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVR***
MSMVCQSCTDHKVSTEDRAGNSAGWSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDK**************************LRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSV**********************VFAALFECALSLVRTIE
************************WSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVN********TSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
**MVCQSCTDHKVSTEDRAGNSAGWSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMVCQSCTDHKVSTEDRAGNSAGWSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSEWPSLRTIILTLYFRTAQVPGVPPYVSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSVAEWLSYSVYTPEVKGSVPGGVKVFAALFECALSLVRTIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query349 2.2.26 [Sep-21-2011]
Q5RBN1 1142 Fibronectin type-III doma yes N/A 0.375 0.114 0.421 6e-32
Q9Y2H6 1198 Fibronectin type-III doma yes N/A 0.375 0.109 0.414 3e-31
Q53EP0 1204 Fibronectin type III doma no N/A 0.289 0.083 0.442 5e-31
Q6NWW9 1207 Fibronectin type III doma yes N/A 0.289 0.083 0.442 2e-30
Q5ZJP5 1198 Fibronectin type-III doma yes N/A 0.441 0.128 0.414 2e-30
Q8BX90 1198 Fibronectin type-III doma no N/A 0.375 0.109 0.427 5e-30
Q6DFV6 1356 Fibronectin type III doma no N/A 0.401 0.103 0.404 3e-21
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.767 0.007 0.241 1e-08
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.765 0.007 0.241 2e-07
O75445 5202 Usherin OS=Homo sapiens G no N/A 0.369 0.024 0.328 2e-07
>sp|Q5RBN1|FND3A_PONAB Fibronectin type-III domain-containing protein 3A OS=Pongo abelii GN=FNDC3A PE=2 SV=1 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 92/152 (60%)

Query: 164 VSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEP 223
           +S  G+DGKYKS+Y GE  +  + DLKP TDY   VQ     I G  SE  +FTT  CEP
Sbjct: 256 ISSTGKDGKYKSVYIGEETNITLNDLKPATDYHAKVQAEYNSIKGTPSEAEIFTTLSCEP 315

Query: 224 DQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLS 283
           D PNPP++  +T+ SL L+W A  DNG+ + +++LE D+G   G+F +      K F ++
Sbjct: 316 DIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFYQCYMGSQKQFKIT 375

Query: 284 KLTPSTCFRFRLAAVNQHGKSADATSVAEWLS 315
           KL+P+   +FRL+A N +G S  +  V  + S
Sbjct: 376 KLSPAMGCKFRLSARNDYGTSGFSEEVLYYTS 407




Mediates spermatid-Sertoli adhesion during spermatogenesis.
Pongo abelii (taxid: 9601)
>sp|Q9Y2H6|FND3A_HUMAN Fibronectin type-III domain-containing protein 3A OS=Homo sapiens GN=FNDC3A PE=1 SV=4 Back     alignment and function description
>sp|Q53EP0|FND3B_HUMAN Fibronectin type III domain-containing protein 3B OS=Homo sapiens GN=FNDC3B PE=1 SV=2 Back     alignment and function description
>sp|Q6NWW9|FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus GN=Fndc3b PE=1 SV=1 Back     alignment and function description
>sp|Q5ZJP5|FND3A_CHICK Fibronectin type-III domain-containing protein 3a OS=Gallus gallus GN=FNDC3A PE=2 SV=2 Back     alignment and function description
>sp|Q8BX90|FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus GN=Fndc3a PE=1 SV=3 Back     alignment and function description
>sp|Q6DFV6|FN3C1_MOUSE Fibronectin type III domain containing protein 3C1 OS=Mus musculus GN=Fndc3c1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|O75445|USH2A_HUMAN Usherin OS=Homo sapiens GN=USH2A PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
91094911 965 PREDICTED: similar to AGAP009522-PA [Tri 0.404 0.146 0.563 4e-42
270006595 1059 hypothetical protein TcasGA2_TC010469 [T 0.404 0.133 0.563 5e-42
170057553 1185 fibronectin type-III domain-containing p 0.406 0.119 0.5 5e-39
157111961 895 factor for adipocyte differentiation [Ae 0.352 0.137 0.521 7e-38
158288288 1415 AGAP009522-PA [Anopheles gambiae str. PE 0.406 0.100 0.465 2e-37
195484071 1688 GE12750 [Drosophila yakuba] gi|194176643 0.398 0.082 0.514 1e-36
195115352 1774 GI17266 [Drosophila mojavensis] gi|19391 0.406 0.080 0.510 3e-36
195063830 1450 GH25197 [Drosophila grimshawi] gi|193895 0.446 0.107 0.459 1e-35
195387117 1712 GJ22725 [Drosophila virilis] gi|19414870 0.455 0.092 0.435 1e-35
194762369 1761 GF14002 [Drosophila ananassae] gi|190617 0.461 0.091 0.458 4e-35
>gi|91094911|ref|XP_973615.1| PREDICTED: similar to AGAP009522-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  178 bits (451), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 108/142 (76%), Gaps = 1/142 (0%)

Query: 164 VSDKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEP 223
           +SDK ++ K+KSIY+G + SCRI+DLKPG +Y+VC+QVH +E+ G A++P  FTTPPCEP
Sbjct: 95  LSDKSKEMKFKSIYSGTSLSCRIRDLKPGQEYSVCLQVHYDELQGAATDPVKFTTPPCEP 154

Query: 224 DQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLS 283
           DQP PPKL  + +TSL LKWN+  DNG+H+  YILE D+G   GDF E  + + K +T+ 
Sbjct: 155 DQPQPPKLHQRQKTSLQLKWNSVNDNGSHITCYILEYDEGKG-GDFVEFHRGRVKQYTIH 213

Query: 284 KLTPSTCFRFRLAAVNQHGKSA 305
           KL P+T +RFRLAA+N+ GKS 
Sbjct: 214 KLQPATPYRFRLAAMNEIGKSG 235




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270006595|gb|EFA03043.1| hypothetical protein TcasGA2_TC010469 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170057553|ref|XP_001864534.1| fibronectin type-III domain-containing protein 3a [Culex quinquefasciatus] gi|167876932|gb|EDS40315.1| fibronectin type-III domain-containing protein 3a [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157111961|ref|XP_001651769.1| factor for adipocyte differentiation [Aedes aegypti] gi|108878240|gb|EAT42465.1| AAEL006012-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|158288288|ref|XP_310164.4| AGAP009522-PA [Anopheles gambiae str. PEST] gi|157019177|gb|EAA05921.4| AGAP009522-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195484071|ref|XP_002090542.1| GE12750 [Drosophila yakuba] gi|194176643|gb|EDW90254.1| GE12750 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195115352|ref|XP_002002225.1| GI17266 [Drosophila mojavensis] gi|193912800|gb|EDW11667.1| GI17266 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195063830|ref|XP_001996455.1| GH25197 [Drosophila grimshawi] gi|193895320|gb|EDV94186.1| GH25197 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195387117|ref|XP_002052246.1| GJ22725 [Drosophila virilis] gi|194148703|gb|EDW64401.1| GJ22725 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194762369|ref|XP_001963317.1| GF14002 [Drosophila ananassae] gi|190617014|gb|EDV32538.1| GF14002 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
FB|FBgn0259735 2064 CG42389 [Drosophila melanogast 0.398 0.067 0.521 2.5e-36
UNIPROTKB|I3LTV3 845 LOC100620938 "Uncharacterized 0.567 0.234 0.390 3.8e-30
UNIPROTKB|F1MPN0 1207 FNDC3B "Uncharacterized protei 0.564 0.163 0.373 1.2e-29
UNIPROTKB|Q9Y2H6 1198 FNDC3A "Fibronectin type-III d 0.449 0.131 0.407 1.9e-29
RGD|1311673 1182 Fndc3b "fibronectin type III d 0.561 0.165 0.376 2.4e-29
UNIPROTKB|Q53EP0 1204 FNDC3B "Fibronectin type III d 0.564 0.163 0.368 3.2e-29
UNIPROTKB|F1NAY5 1198 FNDC3A "Fibronectin type-III d 0.446 0.130 0.408 4.1e-29
UNIPROTKB|F1NV82 1199 FNDC3A "Fibronectin type-III d 0.446 0.130 0.408 4.1e-29
MGI|MGI:1919257 1207 Fndc3b "fibronectin type III d 0.564 0.163 0.373 4.1e-29
UNIPROTKB|Q5ZJP5 1198 FNDC3A "Fibronectin type-III d 0.441 0.128 0.414 5.2e-29
FB|FBgn0259735 CG42389 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 2.5e-36, P = 2.5e-36
 Identities = 74/142 (52%), Positives = 100/142 (70%)

Query:   166 DKGRDGKYKSIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEPDQ 225
             D G+  KYKS+Y GEA  C +QDL+PG DY V +QVH +++ G  S+PT F TPPCEPDQ
Sbjct:   973 DSGKQCKYKSLYQGEAYECIVQDLQPGQDYLVRLQVHYQKLTGTVSDPTEFRTPPCEPDQ 1032

Query:   226 PNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGD---FKEISKSKNKNFTL 282
             P PPKLV++T+ S+ L+W A   NGA + HY+LE D+G   G    F E++K K K++ +
Sbjct:  1033 PPPPKLVSRTKNSINLRWAAPAANGASIQHYLLEYDEGRMPGQPQKFVELAKIKAKHYVI 1092

Query:   283 SKLTPSTCFRFRLAAVNQHGKS 304
              KL P+T + FRLAAVN+ G+S
Sbjct:  1093 GKLQPTTVYSFRLAAVNEAGQS 1114


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|I3LTV3 LOC100620938 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPN0 FNDC3B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2H6 FNDC3A "Fibronectin type-III domain-containing protein 3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311673 Fndc3b "fibronectin type III domain containing 3B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q53EP0 FNDC3B "Fibronectin type III domain-containing protein 3B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAY5 FNDC3A "Fibronectin type-III domain-containing protein 3a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV82 FNDC3A "Fibronectin type-III domain-containing protein 3a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1919257 Fndc3b "fibronectin type III domain containing 3B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJP5 FNDC3A "Fibronectin type-III domain-containing protein 3a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-11
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-09
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 1e-08
pfam0004184 pfam00041, fn3, Fibronectin type III domain 3e-07
smart0006083 smart00060, FN3, Fibronectin type 3 domain 9e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-06
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 58.3 bits (141), Expect = 5e-11
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 38  PGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSDPAQPSIT------CDTT 91
           P PP +L +   +  T TS+T+SW+ P + G PI  YV+E  +                T
Sbjct: 1   PSPPTNLRV---TDVTSTSVTLSWTPPEDDGGPITGYVVEYREKGSGDWKEVEVTPGSET 57

Query: 92  SYQLTGLSPHTTYK 105
           SY LTGL P T Y+
Sbjct: 58  SYTLTGLKPGTEYE 71


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 349
KOG4221|consensus 1381 100.0
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 99.97
KOG3513|consensus1051 99.94
KOG0196|consensus 996 99.89
KOG4222|consensus 1281 99.76
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.45
KOG4258|consensus1025 99.44
KOG0196|consensus 996 99.15
cd0006393 FN3 Fibronectin type 3 domain; One of three types 99.04
KOG4222|consensus 1281 99.01
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.0
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.91
KOG4802|consensus 516 98.88
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.53
KOG4802|consensus516 98.39
KOG4367|consensus 699 98.33
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.3
KOG4258|consensus 1025 98.22
COG3401343 Fibronectin type 3 domain-containing protein [Gene 98.05
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.98
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.87
KOG4152|consensus830 97.85
KOG3632|consensus 1335 97.83
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.49
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.39
COG3401343 Fibronectin type 3 domain-containing protein [Gene 97.2
KOG4152|consensus830 97.14
KOG4367|consensus699 96.66
COG4733 952 Phage-related protein, tail component [Function un 96.56
KOG4806|consensus454 96.56
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.46
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 95.26
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.13
KOG4228|consensus 1087 95.08
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 94.57
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.15
PLN02533 427 probable purple acid phosphatase 94.12
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.08
KOG3632|consensus 1335 93.89
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 93.64
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.26
KOG1948|consensus1165 91.72
KOG0613|consensus 1205 90.95
KOG4228|consensus 1087 90.14
KOG4806|consensus454 90.06
COG4733952 Phage-related protein, tail component [Function un 89.84
KOG1948|consensus1165 89.58
KOG1225|consensus525 88.99
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 87.87
PLN02533427 probable purple acid phosphatase 87.42
PF14292122 SusE: SusE outer membrane protein 84.96
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 83.92
PHA02579 1030 7 baseplate wedge subunit; Provisional 83.09
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 82.79
PF08329133 ChitinaseA_N: Chitinase A, N-terminal domain; Inte 82.57
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 82.37
PF14292122 SusE: SusE outer membrane protein 81.83
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 80.48
>KOG4221|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-31  Score=245.45  Aligned_cols=296  Identities=22%  Similarity=0.282  Sum_probs=239.3

Q ss_pred             CCCceEEEEeeecCCCCCCCCcceeeeCCCCCCCCCccccccccCCCeeEEEecCCCCCCCCceeEEEEecC---CCCCc
Q psy7018           9 TDHKVSTEDRAGNSAGWSPFSETSVITTPPGPPGSLTLRKTSVTTPTSLTVSWSEPANHGSPILHYVLETSD---PAQPS   85 (349)
Q Consensus         9 p~~~y~~~v~a~n~~G~~~~s~~~~~~t~~~~P~~~~~~~~~~~~~~si~l~W~~~~~~~~~~~~Y~v~~~~---~~~~~   85 (349)
                      |.+.|.|||+|.|..|.+..+.++.+++.+..|..   +++...+..++.+.|++|.-+++++++|.+.|..   +.+..
T Consensus       492 p~t~Y~~rv~A~n~~g~g~sS~pLkV~t~pEgp~~---~~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~~~~~~~~  568 (1381)
T KOG4221|consen  492 PLTMYFFRVRAKNEAGSGESSAPLKVTTQPEGPVQ---LQAYATSPTTILVTWEPPPFGNGPITGYKLFYSEDDTGKELR  568 (1381)
T ss_pred             cceeEEEEEeccCcccCCccCCceEEecCCCCCcc---ccccccCcceEEEEecCCCCCCCCceEEEEEEEcCCCCceEE
Confidence            67899999999999999999999999998885543   6666789999999999998888999999998865   34556


Q ss_pred             eeecccEEEEcCCCCCCEEEEEEEEEeecCCcccceeeeeeecccccCCCCCCC---ccccceEEEEEEec-----CCCC
Q psy7018          86 ITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQKVDLTFESDQLYLSGLPNSE---WPSLRTIILTLYFR-----TAQV  157 (349)
Q Consensus        86 ~~~~~~~~~i~~L~p~t~Y~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~---~~~~~~~~l~w~~~-----~~~~  157 (349)
                      ...+..+++|.+|.+.++|.|+|.+++..+.|.....+.+.+....|..+|...   ..+.++..+.|..+     ++.+
T Consensus       569 ~~~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~i  648 (1381)
T KOG4221|consen  569 VENNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQI  648 (1381)
T ss_pred             EecCccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceE
Confidence            677899999999999999999999999888888888888888887777666622   24556778888754     3778


Q ss_pred             CeeeEEEeeCCCCCceE-EEecCCceEEEecCCCCCCeEEEEEEEEecccccCCCCcEEEecCCCCC-----CCCCCCeE
Q psy7018         158 PGVPPYVSDKGRDGKYK-SIYNGEAQSCRIQDLKPGTDYAVCVQVHLEEIVGIASEPTLFTTPPCEP-----DQPNPPKL  231 (349)
Q Consensus       158 ~~Y~v~~~~~~~~~~~~-~~~~~~~~~~~i~~L~p~~~Y~~~V~a~~~~g~~~~s~~~~~~t~~~~P-----~~p~~~~~  231 (349)
                      .+|.|+|+......... ....++...+.+.+|+|++.|.|+|.|.+..|.|++|++..+.|....+     .+|..+.+
T Consensus       649 tgYkIRy~~~~~~~~~~~t~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~l~~  728 (1381)
T KOG4221|consen  649 TGYKIRYRKLSREDEVNETVVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSELHV  728 (1381)
T ss_pred             EEEEEEecccCcccccceeecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCCCceeee
Confidence            99999998755444432 3445688899999999999999999999999999999999998875433     33333332


Q ss_pred             EeecCCeEEEEeecCCCCCCcccEEEEEEecCCCCCCcEEe-ecCCcceEEEcCCCCCCeEEEEEEEecCCCCCCCCc
Q psy7018         232 VTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEI-SKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADAT  308 (349)
Q Consensus       232 ~~~~~~sv~l~W~~~~~~~~~i~~Y~v~~~~~~~~~~~~~~-~~~~~~~~~~~~L~p~t~Y~~~V~A~~~~G~~~~s~  308 (349)
                      . ...++|.+.|.++++.+-.+.+|+|.|+...+.+.-..+ .....++|.++.|.++..|.++++|+|..|+|.+..
T Consensus       729 ~-~g~~si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~~~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~gdG~p~y  805 (1381)
T KOG4221|consen  729 H-PGSNSIVVSWTPPPHPNIVVRGYKIGYRPGSGIPDTGTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNHGDGNPIY  805 (1381)
T ss_pred             c-cCceeEEEEeCCCCChhhhhcceEEeeecccCCCCCccEEecceeeEEEEEecccCceEEEEEEEeccCCCCccee
Confidence            2 346799999999998777888999999765543323333 445667999999999999999999999999997653



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF14292 SusE: SusE outer membrane protein Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PHA02579 7 baseplate wedge subunit; Provisional Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>PF08329 ChitinaseA_N: Chitinase A, N-terminal domain; InterPro: IPR013540 This domain is found in a number of bacterial chitinases and similar viral proteins Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>PF14292 SusE: SusE outer membrane protein Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
1x3d_A118 Solution Structure Of The Fibronectin Type-Iii Doma 2e-19
1wk0_A137 Solution Structure Of Fibronectin Type Iii Domain D 7e-14
2crm_A120 Solution Structure Of The Forth Fniii Domain Of Hum 7e-05
1x4x_A106 Solution Structure Of The 6th Fibronectin Type Iii 4e-04
1wf5_A121 Solution Structure Of The First Fn3 Domain Of Sidek 6e-04
2dju_A106 Solution Structures Of The Fn3 Domain Of Human Rece 8e-04
>pdb|1X3D|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Fibronectin Type-Iii Domain Containing Protein 3a Length = 118 Back     alignment and structure

Iteration: 1

Score = 92.8 bits (229), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/101 (39%), Positives = 63/101 (62%) Query: 210 ASEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDF 269 +S +FTT CEPD PNPP++ +T+ SL L+W A DNG+ + +++LE D+G G+F Sbjct: 5 SSGAEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEF 64 Query: 270 KEISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSV 310 + K F ++KL+P+ +FRL+A N +G S + V Sbjct: 65 CQCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEV 105
>pdb|1WK0|A Chain A, Solution Structure Of Fibronectin Type Iii Domain Derived From Human Kiaa0970 Protein Length = 137 Back     alignment and structure
>pdb|2CRM|A Chain A, Solution Structure Of The Forth Fniii Domain Of Human Length = 120 Back     alignment and structure
>pdb|1X4X|A Chain A, Solution Structure Of The 6th Fibronectin Type Iii Domain From Human Fibronectin Type Iii Domain Containing Protein 3 Length = 106 Back     alignment and structure
>pdb|1WF5|A Chain A, Solution Structure Of The First Fn3 Domain Of Sidekick-2 Protein Length = 121 Back     alignment and structure
>pdb|2DJU|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
1x3d_A118 Fibronectin type-III domain containing protein 3A; 5e-25
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-16
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-24
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-19
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-10
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-08
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-04
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-23
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-18
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-12
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-22
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-14
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-11
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 8e-09
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-20
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-20
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-13
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 2e-18
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 4e-08
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 8e-06
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 3e-18
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-09
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-18
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 8e-10
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-09
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-06
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-17
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-15
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 6e-12
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-10
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-17
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-15
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-17
2crm_A120 Fibronectin type-III domain containing protein 3A; 4e-14
2crm_A120 Fibronectin type-III domain containing protein 3A; 4e-04
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 3e-17
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-13
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-12
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-17
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-16
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 6e-11
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 7e-09
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 5e-17
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 7e-17
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-13
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-11
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-16
1x5x_A109 Fibronectin type-III domain containing protein 3A; 1e-11
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 4e-16
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 4e-08
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-15
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-13
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 5e-11
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-04
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-15
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-10
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-15
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-10
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 6e-15
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-13
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 7e-15
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 9e-15
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-14
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-07
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 6e-04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 4e-14
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-13
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-14
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-13
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 7e-10
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-09
2crz_A110 Fibronectin type-III domain containing protein 3A; 5e-14
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-12
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 7e-14
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 9e-13
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-13
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 4e-10
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 9e-10
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-13
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 7e-13
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-11
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-05
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-13
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-12
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-13
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 6e-06
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 4e-13
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-13
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 3e-10
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 9e-13
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 7e-11
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 4e-09
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 9e-07
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-12
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 3e-10
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-12
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-12
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-10
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-12
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 7e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-12
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 4e-12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-11
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 3e-12
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-08
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-12
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 9e-12
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 9e-11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 7e-09
3t04_D103 Monobody 7C12; engineered binding protein, antibod 6e-12
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-07
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 6e-12
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-12
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 9e-12
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 1e-09
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-11
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 4e-06
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-11
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-11
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-10
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 8e-10
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-11
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-06
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-11
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 1e-10
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 4e-11
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 6e-10
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-11
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 7e-10
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 6e-11
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 8e-11
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 9e-11
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-10
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-10
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-05
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 1e-10
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-10
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-07
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 1e-10
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 8e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 1e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-10
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-10
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-10
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 7e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 3e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 7e-08
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-10
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-06
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-10
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-08
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-04
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 7e-10
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-06
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 7e-10
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 5e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-09
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-04
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 5e-07
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-05
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-09
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 6e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-09
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-09
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-09
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 3e-09
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 7e-05
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 7e-09
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 9e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-09
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 8e-09
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 9e-09
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 8e-05
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-08
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 5e-08
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-05
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-08
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 6e-07
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-08
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 8e-05
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-04
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 3e-08
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 4e-08
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-05
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 5e-08
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-05
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 5e-08
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 7e-05
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 6e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 7e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 3e-05
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 8e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 9e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-07
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-07
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 4e-07
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 3e-07
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 3e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 4e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 7e-04
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 4e-07
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 6e-07
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 3e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 5e-05
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-06
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-06
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 7e-04
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 9e-06
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-05
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-05
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 7e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-05
2gys_A419 Cytokine receptor common beta chain; dimer of inte 8e-05
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-05
2erj_C247 Cytokine receptor common gamma chain; immune syste 3e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 4e-05
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 5e-05
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-04
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 5e-05
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 6e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 6e-05
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 7e-05
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 7e-04
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 7e-05
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 9e-05
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-04
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 1e-04
1oww_A98 FN, fibronectin first type III module, CIG; fibron 5e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-04
1eer_B227 Epobp, erythropoietin receptor; signal transductio 9e-04
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
 Score = 97.1 bits (242), Expect = 5e-25
 Identities = 39/94 (41%), Positives = 60/94 (63%)

Query: 211 SEPTLFTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFK 270
           S   +FTT  CEPD PNPP++  +T+ SL L+W A  DNG+ + +++LE D+G   G+F 
Sbjct: 6   SGAEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFC 65

Query: 271 EISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKS 304
           +      K F ++KL+P+   +FRL+A N +G S
Sbjct: 66  QCYMGSQKQFKITKLSPAMGCKFRLSARNDYGTS 99


>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.98
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.97
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.97
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.97
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.97
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.96
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.96
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.96
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.94
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.94
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.94
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.94
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.93
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.93
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.93
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.92
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.92
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.92
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.91
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.9
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.9
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.88
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.88
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.88
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.87
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.87
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.87
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.87
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.86
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.86
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.86
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.85
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.85
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.85
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.85
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.84
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.83
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.82
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.81
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.81
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.81
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.8
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.8
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.8
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.8
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.8
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.79
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.78
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.77
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.77
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.77
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.76
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.76
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.76
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.76
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.75
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.74
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.74
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.74
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.74
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.74
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.74
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.73
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.72
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.72
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.72
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.71
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.71
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.71
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.7
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.7
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.7
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.69
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.69
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.69
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.69
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.69
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.69
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.68
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.68
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.68
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.68
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.67
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.67
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.67
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.67
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.67
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.66
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.66
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.66
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.66
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.65
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.65
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.64
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.64
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.63
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.63
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.62
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.62
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.61
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.61
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.61
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.61
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.61
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.61
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.6
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.59
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.59
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.58
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.58
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.58
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.58
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.57
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.57
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.56
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.56
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.56
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.54
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.54
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.54
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.53
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.53
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.53
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.52
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.52
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.52
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.51
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.51
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.5
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.5
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.5
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.5
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.49
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.49
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.48
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.48
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.47
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.47
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.47
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.47
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.47
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.47
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.47
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.46
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.46
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.46
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.46
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.45
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.45
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.44
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.43
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.43
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.43
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.43
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.43
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.43
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.43
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.42
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.42
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.42
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.42
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.41
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.41
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.41
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.4
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.39
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.39
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.39
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.39
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.38
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.38
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.38
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.38
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.37
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.37
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.37
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.36
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.35
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.34
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.34
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.33
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.33
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.33
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.33
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.33
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.33
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.32
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.32
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.32
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.32
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.31
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.31
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.3
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.3
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.29
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.29
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.29
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.29
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.29
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.28
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.27
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.26
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.26
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.23
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.23
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.23
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.23
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.22
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.21
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.21
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.21
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.21
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.21
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.21
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.2
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.2
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.2
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.19
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.18
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.16
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.16
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.16
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.16
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.14
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.14
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.13
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.13
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.08
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.08
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.06
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.06
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.05
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.02
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.01
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.01
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.0
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.98
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.97
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.96
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.9
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.9
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.86
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.84
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.83
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.82
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.8
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.77
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.74
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.69
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.67
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.66
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.58
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.55
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.54
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.52
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.45
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.44
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.43
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.37
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.34
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.29
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 98.25
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.24
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.23
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.23
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.22
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.22
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.11
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.05
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 97.94
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.86
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 97.76
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.68
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.66
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 97.36
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.32
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.15
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 97.06
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 96.99
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 96.93
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 96.41
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 96.39
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 96.38
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 96.19
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.95
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 95.94
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 95.82
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 95.22
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 94.79
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 94.74
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 94.73
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 94.04
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 93.32
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 93.17
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 92.77
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 90.93
4a2l_A795 BT_4663, two-component system sensor histidine kin 89.82
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 89.62
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 89.53
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 89.11
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 89.07
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 88.88
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 88.87
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 88.45
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 88.02
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 87.74
3ott_A758 Two-component system sensor histidine kinase; beta 86.32
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 86.11
2vtf_A626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 84.95
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 84.46
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 84.36
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 84.34
3v9f_A781 Two-component system sensor histidine kinase/RESP 84.14
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 80.97
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.3e-33  Score=262.41  Aligned_cols=316  Identities=17%  Similarity=0.124  Sum_probs=211.9

Q ss_pred             CCCceEEEEeeecCCC-CCCCCcceeeeCC--CCCCCCCcccccccc--CCC---eeEEEecCCCCCCCCceeEEEEec-
Q psy7018           9 TDHKVSTEDRAGNSAG-WSPFSETSVITTP--PGPPGSLTLRKTSVT--TPT---SLTVSWSEPANHGSPILHYVLETS-   79 (349)
Q Consensus         9 p~~~y~~~v~a~n~~G-~~~~s~~~~~~t~--~~~P~~~~~~~~~~~--~~~---si~l~W~~~~~~~~~~~~Y~v~~~-   79 (349)
                      |++.|.|||+|.|..| .+..+....+++.  +.+|.+|..+++...  +.+   ++.|+|++|...++++.+|.|+|+ 
T Consensus       232 P~t~Y~frV~A~n~~G~~~~ss~s~~~~t~~~~~pp~~P~~l~~~~~~~~~~g~~sv~l~W~pP~~~~g~i~~Y~V~~~~  311 (680)
T 1zlg_A          232 PSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPDIPVHHYKVFWSW  311 (680)
T ss_pred             CCCEEEEEEEEEeCCCCCCCCCCccceEcCCCCCCCCCCCceEeeeeeecCCCceEEEEEecCCCCCCCceeEEEEEEEe
Confidence            7899999999999999 4455555556654  357788888887777  777   999999998777789999999997 


Q ss_pred             C----CC-----CCc--eeecccEEEEcCCCCCCEEEEEEEEEeecCCcccc---eeeeeeecccccCCCCCCCcc--cc
Q psy7018          80 D----PA-----QPS--ITCDTTSYQLTGLSPHTTYKSVCQVYLISDKHTQK---VDLTFESDQLYLSGLPNSEWP--SL  143 (349)
Q Consensus        80 ~----~~-----~~~--~~~~~~~~~i~~L~p~t~Y~~~v~~~~~~~~~~~~---~~~~~~~~~~~~~~~p~~~~~--~~  143 (349)
                      .    ..     +..  .....++++|.+|.|++.|.|+|++.+..+.+...   ..+.+.+....+. +......  ..
T Consensus       312 ~~~~~~~~~~~~~~~~~v~~~~~~~~l~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~v~~~T~~~~P~-p~~l~~~~~s~  390 (680)
T 1zlg_A          312 MVSSKSLVPTKKKRRKTTDGFQNSVILEKLQPDCDYVVELQAITYWGQTRLKSAKVSLHFTSTHATNN-KEQLVKTRKGG  390 (680)
T ss_pred             cccccccCCccceEEEEEcCCeeEEEeCCCCCCCEEEEEEEEEECCCcCCCCCCceeEEEECCCCCCC-ccccccccccC
Confidence            2    11     111  22235789999999999999999987754443222   2355555544332 1111111  11


Q ss_pred             ceEE-----------EEEEec--CCCCCeeeEEEeeCCCCC------------------ce--EEEecCCceEEEecCCC
Q psy7018         144 RTII-----------LTLYFR--TAQVPGVPPYVSDKGRDG------------------KY--KSIYNGEAQSCRIQDLK  190 (349)
Q Consensus       144 ~~~~-----------l~w~~~--~~~~~~Y~v~~~~~~~~~------------------~~--~~~~~~~~~~~~i~~L~  190 (349)
                      ++..           |.|..+  .+.+.+|.|.|...+...                  .+  .........++.|.+|.
T Consensus       391 tsi~lp~~~~~~~~~l~W~~P~~~~~~~~y~v~w~~~~~~~v~~Y~V~w~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~  470 (680)
T 1zlg_A          391 IQTQLPFQRRRPTRPLEVGAPFYQDGQLQVKVYWKKTEDPTVNRYHVRWFPEACAHNRTTGSEASSGMTHENYIILQDLS  470 (680)
T ss_pred             ccccccccccCCCccccccCCcccCCcceEEEEEeCCCCCccceEEEEEeeeecccCCCCcceeeeeeccCceEEecCCC
Confidence            2222           256543  134556777776543211                  00  11124456789999999


Q ss_pred             CCCeEEEEEEEEecccccCCCCcEEEecCC-----------------------CCCCCCCC----CeEEeecCCeEEEEe
Q psy7018         191 PGTDYAVCVQVHLEEIVGIASEPTLFTTPP-----------------------CEPDQPNP----PKLVTKTRTSLALKW  243 (349)
Q Consensus       191 p~~~Y~~~V~a~~~~g~~~~s~~~~~~t~~-----------------------~~P~~p~~----~~~~~~~~~sv~l~W  243 (349)
                      |++.|.|+|+|.|..|.+... ...|.+..                       ..+.+|.+    +.+...+.+ |.|+|
T Consensus       471 p~t~Y~~~V~A~n~~G~s~~~-~~~f~T~~~~~~~~~~~~~v~~~~~~~P~~~~v~~~P~~l~~~v~v~~~~~t-i~lsW  548 (680)
T 1zlg_A          471 FSCKYKVTVQPIRPKSHSKAE-AVFFTTPPCSALKGKSHKPIGCLGEAGHVLSKVLAKPENLSASFIVQDVNIT-GHFSW  548 (680)
T ss_pred             CCCeEEEEEEEecCCCCCCcc-ccceeCCCccccccCCccccccCCCCccccccccCCccccceeEEEeccCce-EEEEe
Confidence            999999999999998865421 11111110                       11256777    445545555 99999


Q ss_pred             ecCC-CCCCcccEEEEEEecCCCCC---CcEE-------eecCCcceEEEcCCCCCCeEEEEEEEecCCCCCCCCceEEe
Q psy7018         244 NAAV-DNGAHVMHYILESDQGNATG---DFKE-------ISKSKNKNFTLSKLTPSTCFRFRLAAVNQHGKSADATSVAE  312 (349)
Q Consensus       244 ~~~~-~~~~~i~~Y~v~~~~~~~~~---~~~~-------~~~~~~~~~~~~~L~p~t~Y~~~V~A~~~~G~~~~s~~~~~  312 (349)
                      ++|. +.++.|.+|.|+|+......   .+..       ...++.+.+.|.+|+|++.|.|+|+|.|..|.|++ ..+.+
T Consensus       549 ~pP~~~~ng~I~gY~V~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~A~n~~G~G~~-~~~~~  627 (680)
T 1zlg_A          549 KMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPA-TIKTF  627 (680)
T ss_pred             cCCCCCCCCCceeEEEEEEEccCCCccccccceeeecccccCCcccEEEecCCCCCceEEEEEEEEcCCCcCCC-cceEE
Confidence            9997 44789999999997643211   1111       11245679999999999999999999999999998 78889


Q ss_pred             eccCccCCCCcccccC
Q psy7018         313 WLSYSVYTPEVKGSVP  328 (349)
Q Consensus       313 ~t~~~~p~~p~~~~~~  328 (349)
                      +|...+|.+|....+.
T Consensus       628 ~T~~~~P~~P~~l~v~  643 (680)
T 1zlg_A          628 RTPELPPSSAHRSHLK  643 (680)
T ss_pred             ECCCCCCCCCCCCeEE
Confidence            9988888887755443



>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 349
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 4e-13
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 2e-07
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 6e-11
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 3e-06
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 0.002
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 1e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 9e-09
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-09
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 2e-07
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-09
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 6e-09
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-07
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 8e-09
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 7e-07
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-08
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 5e-08
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-08
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-04
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.001
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-08
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-08
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-08
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 9e-08
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-06
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 3e-07
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 5e-05
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 0.002
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 4e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 6e-07
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 5e-07
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 1e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 5e-07
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 1e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 1e-04
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-06
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 4e-04
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 1e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 4e-06
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 6e-06
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-05
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1e-05
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-05
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 4e-05
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 2e-05
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 3e-05
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-05
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 3e-04
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-05
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 5e-04
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 4e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 1e-04
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 4e-05
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-04
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 7e-05
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 2e-04
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 7e-05
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 0.002
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-04
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 1e-04
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 8e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 1e-04
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 2e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 2e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.001
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 2e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 2e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 0.004
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-04
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.003
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-04
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 4e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 5e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 8e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 5e-04
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 6e-04
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 8e-04
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 8e-04
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 0.001
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 8e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 0.002
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 0.001
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 0.001
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 0.001
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 0.001
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.001
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.003
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 0.001
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 0.001
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 0.003
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 0.001
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.001
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.003
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 0.002
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.002
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 0.002
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 0.003
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 0.003
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 0.003
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 0.004
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 0.003
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 0.003
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.0 bits (152), Expect = 4e-13
 Identities = 38/90 (42%), Positives = 58/90 (64%)

Query: 216 FTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKS 275
           FTT  CEPD PNPP++  +T+ SL L+W A  DNG+ + +++LE D+G   G+F +    
Sbjct: 4   FTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMG 63

Query: 276 KNKNFTLSKLTPSTCFRFRLAAVNQHGKSA 305
             K F ++KL+P+   +FRL+A N +G S 
Sbjct: 64  SQKQFKITKLSPAMGCKFRLSARNDYGTSG 93


>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.76
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.72
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.71
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.71
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.7
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.69
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.69
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.68
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.67
d2crza197 Fibronectin type-III domain containing protein 3a, 99.67
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.65
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.65
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.64
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.64
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.63
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.63
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.59
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.59
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.59
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.58
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.58
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.58
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.57
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.57
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.56
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.56
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.55
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.55
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.53
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.53
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.53
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.53
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.53
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.52
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.52
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.5
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.48
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.48
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.47
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.47
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.47
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.47
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.47
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.47
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.46
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.46
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.44
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.44
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.43
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.43
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.43
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.42
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.42
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.42
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.41
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.41
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.4
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.38
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.38
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.36
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.36
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.35
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.34
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.34
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.34
d2crza197 Fibronectin type-III domain containing protein 3a, 99.33
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.33
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.32
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.3
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.3
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.29
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.29
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.26
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.25
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.23
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.23
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.22
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.22
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.2
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.2
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.2
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.19
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.19
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.19
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.17
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.17
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.17
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.16
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.16
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.16
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.15
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.13
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.12
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.11
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.1
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.09
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.09
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.09
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.08
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.07
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.07
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.05
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.04
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.04
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.03
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.02
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.02
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.0
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.0
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.99
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.98
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.96
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.96
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.95
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.94
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.92
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.92
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.9
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.87
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.86
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.84
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.8
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.79
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.71
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.68
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.66
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.53
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.51
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.42
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.34
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.68
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 97.65
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.51
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 97.32
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.26
d2hfta1106 Extracellular region of human tissue factor {Human 96.24
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.11
d2c4fu1116 Extracellular region of human tissue factor {Human 96.03
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 95.94
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 95.19
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 94.75
d2c4fu1116 Extracellular region of human tissue factor {Human 92.92
d1edqa1109 Chitinase A, N-terminal domain N {Serratia marcesc 89.04
d2hfta1106 Extracellular region of human tissue factor {Human 88.26
d1a21a1103 Extracellular region of human tissue factor {Rabbi 86.62
d1edqa1109 Chitinase A, N-terminal domain N {Serratia marcesc 84.57
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 82.13
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 81.17
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=5.6e-18  Score=117.98  Aligned_cols=101  Identities=40%  Similarity=0.737  Sum_probs=91.4

Q ss_pred             EecCCCCCCCCCCCeEEeecCCeEEEEeecCCCCCCcccEEEEEEecCCCCCCcEEeecCCcceEEEcCCCCCCeEEEEE
Q psy7018         216 FTTPPCEPDQPNPPKLVTKTRTSLALKWNAAVDNGAHVMHYILESDQGNATGDFKEISKSKNKNFTLSKLTPSTCFRFRL  295 (349)
Q Consensus       216 ~~t~~~~P~~p~~~~~~~~~~~sv~l~W~~~~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~~~V  295 (349)
                      |+|...+|.+|.++++...+.++|.|+|.++.++++.+.+|.|+++.......+.....+....+.+.+|.+++.|.|+|
T Consensus         4 f~T~~~~P~~P~~~~~~~~~~~sv~l~W~pp~~~~~~i~~Y~i~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~frV   83 (105)
T d1x3da1           4 FTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQCYMGSQKQFKITKLSPAMGCKFRL   83 (105)
T ss_dssp             CCCCCSCCCCCCCCEEEEEETTEEEEECCCCCCCSSCEEEEEEEECTTTSSSCCEEEEEESCSEEEEESCCTTCEEEEEC
T ss_pred             EECCCCCCcCCCCCEEEEccCCEEEEEEECCCCCcCccEEEEEEEecCCCcceeEEEecCCccEEEecCCcCCcEEEEEE
Confidence            67888899999999999999999999999998888899999999988766555666777788899999999999999999


Q ss_pred             EEecCCCCCCCCceEEeeccC
Q psy7018         296 AAVNQHGKSADATSVAEWLSY  316 (349)
Q Consensus       296 ~A~~~~G~~~~s~~~~~~t~~  316 (349)
                      +|.|..|.|++|+.+.+.|.+
T Consensus        84 ~A~N~~G~s~~S~~~~~~T~g  104 (105)
T d1x3da1          84 SARNDYGTSGFSEEVLYYTSG  104 (105)
T ss_dssp             CEEESSCBCCCCCCEEEECSC
T ss_pred             EEECCCeEcCCCCcEEEECCC
Confidence            999999999999999998864



>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1edqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure