Psyllid ID: psy7019


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MIKTTEFNQASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSARSPCPGQTLSSTDTV
ccccccccccccEEEEEEEccccccEEEEEEccccEEEEcccccccEEEEEEEEEcccccccccccEEEEEcccccccccccEEEEEEEcccEEEEEcEEEEEEcccEEEEEEEcccccccccccccc
cccccccccEEEEccHcccccccccEEEEEEccccEEEEEEcccccEEEEEEEEEccccccccccEEEEEcccccccccccccEEEEEEcccEEEEEEEEEEEEcccEEEEEEccccccccccccccc
mikttefnqasfkashslsdrpddrkhvvyqgtnfsckvnklqelTTYRFYITatndagqgpyseaypfttctappaplkgktYFSLVLSRGVCLRAGFLWVFASGRAfcvsarspcpgqtlsstdtv
mikttefnqasfkashslsdrpddRKHVVYQGtnfsckvnklqELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVsarspcpgqtlsstdtv
MIKTTEFNQASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSARSPCPGQTLSSTDTV
**************************HVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSA***************
*******NQASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPA***************VCLRAGFLWVFASGRAFCVSARSPCPGQT*******
********************RPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSARSP************
****TEFNQASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSARSPC***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKTTEFNQASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFSLVLSRGVCLRAGFLWVFASGRAFCVSARSPCPGQTLSSTDTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q6DFV6 1356 Fibronectin type III doma yes N/A 0.570 0.053 0.410 7e-09
Q53EP0 1204 Fibronectin type III doma yes N/A 0.468 0.049 0.409 1e-06
Q6NWW91207 Fibronectin type III doma no N/A 0.492 0.052 0.437 1e-06
Q9Y2H61198 Fibronectin type-III doma no N/A 0.398 0.042 0.480 5e-06
Q5RBN11142 Fibronectin type-III doma no N/A 0.398 0.044 0.480 6e-06
Q5ZJP51198 Fibronectin type-III doma no N/A 0.367 0.039 0.480 6e-06
Q8BX901198 Fibronectin type-III doma no N/A 0.484 0.051 0.444 7e-06
>sp|Q6DFV6|FN3C1_MOUSE Fibronectin type III domain containing protein 3C1 OS=Mus musculus GN=Fndc3c1 PE=2 SV=1 Back     alignment and function desciption
 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%)

Query: 10   ASFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPF 69
            A+F   + L +    R  V+Y+G + + KV KL E T Y+F I A N+AG+GP S+ Y F
Sbjct: 1134 ANFINYNVLMEDRSGRFSVIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEGPESDIYTF 1193

Query: 70   TTCTAPPAPLKGKTYFSL 87
            TT  +PP  LK      L
Sbjct: 1194 TTTKSPPTALKAPKVHPL 1211





Mus musculus (taxid: 10090)
>sp|Q53EP0|FND3B_HUMAN Fibronectin type III domain-containing protein 3B OS=Homo sapiens GN=FNDC3B PE=1 SV=2 Back     alignment and function description
>sp|Q6NWW9|FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus GN=Fndc3b PE=1 SV=1 Back     alignment and function description
>sp|Q9Y2H6|FND3A_HUMAN Fibronectin type-III domain-containing protein 3A OS=Homo sapiens GN=FNDC3A PE=1 SV=4 Back     alignment and function description
>sp|Q5RBN1|FND3A_PONAB Fibronectin type-III domain-containing protein 3A OS=Pongo abelii GN=FNDC3A PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJP5|FND3A_CHICK Fibronectin type-III domain-containing protein 3a OS=Gallus gallus GN=FNDC3A PE=2 SV=2 Back     alignment and function description
>sp|Q8BX90|FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus GN=Fndc3a PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
91094911 965 PREDICTED: similar to AGAP009522-PA [Tri 0.515 0.068 0.536 4e-10
270006595 1059 hypothetical protein TcasGA2_TC010469 [T 0.515 0.062 0.536 5e-10
405975696 1139 Fibronectin type-III domain-containing p 0.453 0.050 0.491 2e-08
443683010 1138 hypothetical protein CAPTEDRAFT_151424 [ 0.406 0.045 0.507 4e-08
390340903 813 PREDICTED: fibronectin type-III domain-c 0.437 0.068 0.535 5e-08
390358419 688 PREDICTED: fibronectin type-III domain-c 0.437 0.081 0.535 6e-08
354486360 1374 PREDICTED: fibronectin type III domain c 0.562 0.052 0.444 8e-08
354486358 1371 PREDICTED: fibronectin type III domain c 0.562 0.052 0.444 8e-08
300795120 1360 fibronectin type III domain containing p 0.609 0.057 0.423 1e-07
392343303 950 PREDICTED: fibronectin type III domain c 0.562 0.075 0.444 1e-07
>gi|91094911|ref|XP_973615.1| PREDICTED: similar to AGAP009522-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 15  SHSLSDRPDDRKH---VVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTT 71
           +H L +  + R H    VY+GT  + KVNKL ELTTYRF I A+NDAG G +S+ Y FTT
Sbjct: 742 THYLIEMENGRTHDFQCVYKGTALTYKVNKLHELTTYRFRICASNDAGVGDFSDIYEFTT 801

Query: 72  CTAPPAPLK 80
             APPA +K
Sbjct: 802 SIAPPAVVK 810




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270006595|gb|EFA03043.1| hypothetical protein TcasGA2_TC010469 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|405975696|gb|EKC40245.1| Fibronectin type-III domain-containing protein 3a [Crassostrea gigas] Back     alignment and taxonomy information
>gi|443683010|gb|ELT87402.1| hypothetical protein CAPTEDRAFT_151424 [Capitella teleta] Back     alignment and taxonomy information
>gi|390340903|ref|XP_001187439.2| PREDICTED: fibronectin type-III domain-containing protein 3A-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390358419|ref|XP_787929.3| PREDICTED: fibronectin type-III domain-containing protein 3A-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|354486360|ref|XP_003505349.1| PREDICTED: fibronectin type III domain containing protein 3C1 isoform 2 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|354486358|ref|XP_003505348.1| PREDICTED: fibronectin type III domain containing protein 3C1 isoform 1 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|300795120|ref|NP_001178651.1| fibronectin type III domain containing protein 3C1 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|392343303|ref|XP_003754846.1| PREDICTED: fibronectin type III domain containing protein 3C1-like [Rattus norvegicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
MGI|MGI:2685630 1356 Fndc3c1 "fibronectin type III 0.484 0.045 0.476 8.7e-09
MGI|MGI:19192571207 Fndc3b "fibronectin type III d 0.484 0.051 0.444 3.8e-07
RGD|13116731182 Fndc3b "fibronectin type III d 0.484 0.052 0.428 4.8e-07
UNIPROTKB|F1MPN01207 FNDC3B "Uncharacterized protei 0.460 0.048 0.459 8e-07
UNIPROTKB|E1BW51 1208 FNDC3B "Uncharacterized protei 0.429 0.045 0.454 8e-07
UNIPROTKB|Q53EP0 1204 FNDC3B "Fibronectin type III d 0.460 0.049 0.423 1e-06
FB|FBgn0259735 2064 CG42389 [Drosophila melanogast 0.5 0.031 0.470 1.1e-06
RGD|13047361170 Fndc3a "fibronectin type III d 0.406 0.044 0.480 1.6e-06
MGI|MGI:11964631198 Fndc3a "fibronectin type III d 0.484 0.051 0.444 1.6e-06
UNIPROTKB|Q5ZJP51198 FNDC3A "Fibronectin type-III d 0.406 0.043 0.480 1.6e-06
MGI|MGI:2685630 Fndc3c1 "fibronectin type III domain containing 3C1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 146 (56.5 bits), Expect = 8.7e-09, P = 8.7e-09
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query:    18 LSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPA 77
             + DR   R  V+Y+G + + KV KL E T Y+F I A N+AG+GP S+ Y FTT  +PP 
Sbjct:  1143 MEDR-SGRFSVIYRGPDVTHKVQKLSEYTEYKFKIQACNEAGEGPESDIYTFTTTKSPPT 1201

Query:    78 PLK 80
              LK
Sbjct:  1202 ALK 1204




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
MGI|MGI:1919257 Fndc3b "fibronectin type III domain containing 3B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311673 Fndc3b "fibronectin type III domain containing 3B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPN0 FNDC3B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW51 FNDC3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q53EP0 FNDC3B "Fibronectin type III domain-containing protein 3B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0259735 CG42389 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1304736 Fndc3a "fibronectin type III domain containing 3a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1196463 Fndc3a "fibronectin type III domain containing 3A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJP5 FNDC3A "Fibronectin type-III domain-containing protein 3a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-06
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 42.9 bits (101), Expect = 2e-06
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 20 DRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTT 71
             D ++  V  G+  S  +  L+  T Y F + A N  G+ P SE+   TT
Sbjct: 42 GSGDWKEVEVTPGSETSYTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
KOG0196|consensus 996 99.24
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.8
KOG3513|consensus1051 98.56
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.48
KOG4221|consensus 1381 98.47
KOG4367|consensus 699 98.4
KOG4221|consensus 1381 98.27
KOG3513|consensus 1051 97.93
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.78
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.62
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 96.29
KOG4258|consensus1025 96.23
KOG4152|consensus830 96.17
KOG4802|consensus 516 96.03
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.89
KOG4222|consensus 1281 95.72
PLN02533 427 probable purple acid phosphatase 91.74
KOG0196|consensus 996 90.9
PF10179 300 DUF2369: Uncharacterised conserved protein (DUF236 90.45
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 90.34
KOG4222|consensus 1281 90.27
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 85.9
>KOG0196|consensus Back     alignment and domain information
Probab=99.24  E-value=9.8e-12  Score=109.73  Aligned_cols=72  Identities=22%  Similarity=0.327  Sum_probs=63.8

Q ss_pred             ccceeCCcEEEEEEEeeCCC-CCCeEEEEecCCceEEEccCCCCCEEEEEEEEEcCCCCCCCCCceeeeeCCC
Q psy7019           3 KTTEFNQASFKASHSLSDRP-DDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTA   74 (128)
Q Consensus         3 ~~~~~~~~~i~Y~le~~~~~-~~~~~~v~~g~~t~~~V~~L~p~t~Y~FRVrA~N~~G~G~~S~~~~~~T~~~   74 (128)
                      ++-+-||.++.|+|++++++ ++........+.++.++++|+|++.|.|||||++.+|+|+||...+|+|.+.
T Consensus       465 ~p~~png~ildYEvky~ek~~~e~~~~~~~t~~~~~ti~gL~p~t~YvfqVRarT~aG~G~~S~~~~fqT~~~  537 (996)
T KOG0196|consen  465 EPDQPNGVILDYEVKYYEKDEDERSYSTLKTKTTTATITGLKPGTVYVFQVRARTAAGYGPYSGKHEFQTLPS  537 (996)
T ss_pred             CCCCCCCcceeEEEEEeeccccccceeEEecccceEEeeccCCCcEEEEEEEEecccCCCCCCCceeeeecCc
Confidence            56678999999999999875 4555566666889999999999999999999999999999999999999875



>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2crz_A110 Solution Structure Of The Fifth Fniii Domain Of Hum 3e-04
>pdb|2CRZ|A Chain A, Solution Structure Of The Fifth Fniii Domain Of Human Fibronectin Type Iii Domain Containing Protein 3a Length = 110 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 27/57 (47%) Query: 15 SHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTT 71 S +S D VYQG+ C V+ L TY F + A N G GP+SE TT Sbjct: 45 SVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITT 101

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2crm_A120 Fibronectin type-III domain containing protein 3A; 4e-11
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 8e-11
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-10
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-10
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-10
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 8e-10
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 6e-07
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 1e-09
1x5x_A109 Fibronectin type-III domain containing protein 3A; 1e-09
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-09
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 7e-09
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 9e-09
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 8e-09
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-08
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-05
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-04
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-08
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-08
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-08
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 3e-08
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-08
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-08
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 4e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 4e-08
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 5e-08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 5e-08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 7e-08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-07
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 7e-08
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 9e-08
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-07
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-07
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-07
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-04
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-07
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-07
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-07
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-07
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 2e-07
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-07
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 3e-07
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 3e-07
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 4e-07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-07
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-07
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-07
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 4e-07
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 5e-07
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 5e-07
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-07
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-07
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 5e-07
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 6e-07
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-06
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-06
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-06
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 3e-05
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-06
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-06
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-06
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-06
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-06
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-06
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-04
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 4e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 4e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-05
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 4e-05
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 4e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 5e-06
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-06
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-05
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-04
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-05
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-05
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-04
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-05
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-05
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-04
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-04
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-05
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-05
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 2e-05
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-05
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-04
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-05
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-04
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 3e-05
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 4e-05
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-05
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 4e-05
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 5e-05
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 5e-05
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 9e-05
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 6e-05
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 9e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-04
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-04
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 2e-04
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 3e-04
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-04
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 6e-04
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 4e-11
 Identities = 11/51 (21%), Positives = 18/51 (35%)

Query: 28  VVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAP 78
           ++Y G       ++L     YR  +   +D GQ   SE+    T       
Sbjct: 68  MIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAVSGPS 118


>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.65
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.64
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.62
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.59
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.56
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.56
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.54
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.53
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.48
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.46
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.44
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.44
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.43
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.43
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.43
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.41
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.41
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.4
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.4
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.39
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.39
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.38
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.38
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.38
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.38
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.37
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.37
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.36
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.36
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.36
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.36
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.36
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.35
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.34
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.34
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.33
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.33
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.32
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.32
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.32
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.3
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.29
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.29
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.29
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.27
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.27
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.26
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.26
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.25
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.24
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.23
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.21
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.21
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.2
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.2
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.17
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.17
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.15
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.11
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.11
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.1
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.09
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.09
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.08
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.08
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.07
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.07
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.03
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.02
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.02
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.02
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.01
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.0
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 98.98
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 98.98
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 98.96
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 98.96
3t04_D103 Monobody 7C12; engineered binding protein, antibod 98.95
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.94
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 98.93
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.91
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 98.9
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 98.89
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 98.88
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.88
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.87
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.86
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 98.86
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.85
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 98.84
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.81
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.79
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.76
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.75
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 98.75
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 98.75
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 98.75
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.73
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.73
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 98.71
3k2m_C101 Monobody HA4; engineered binding protein, antibody 98.71
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 98.68
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 98.68
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.67
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 98.67
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.63
1eer_B227 Epobp, erythropoietin receptor; signal transductio 98.63
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 98.63
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.63
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 98.62
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 98.61
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 98.6
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 98.59
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 98.59
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 98.58
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 98.58
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 98.58
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 98.57
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 98.57
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 98.55
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 98.55
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.55
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 98.54
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.52
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.52
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.51
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 98.5
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 98.5
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 98.5
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 98.47
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.46
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 98.45
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 98.42
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.39
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.39
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.37
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 98.36
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 98.32
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 98.32
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 98.31
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 98.31
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 98.3
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 98.26
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 98.24
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 98.24
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 98.23
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 98.21
2gys_A419 Cytokine receptor common beta chain; dimer of inte 98.2
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 98.18
3s98_A 306 Interferon alpha/beta receptor 1; human, type I in 98.15
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.11
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 98.1
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 98.1
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 98.08
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 98.05
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 97.99
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 97.96
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 97.89
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 97.84
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 97.8
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 97.73
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 97.7
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 97.63
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 97.57
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 97.54
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 97.51
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 97.18
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 96.97
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 96.9
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 96.71
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 96.08
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 95.92
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 95.51
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 95.48
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 95.47
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 95.47
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 95.47
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 95.28
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 95.04
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 95.0
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 94.85
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 94.71
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 93.67
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 93.6
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 92.84
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 92.74
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 92.36
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 91.61
2crm_A120 Fibronectin type-III domain containing protein 3A; 91.35
4a2l_A795 BT_4663, two-component system sensor histidine kin 91.21
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 91.16
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 91.13
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 90.47
3v9f_A781 Two-component system sensor histidine kinase/RESP 90.33
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 89.52
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 89.39
3ott_A758 Two-component system sensor histidine kinase; beta 88.5
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 88.35
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 88.2
1x3d_A118 Fibronectin type-III domain containing protein 3A; 87.93
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 84.24
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 83.51
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 81.86
3bes_R 250 Interferon-gamma binding protein C4R; orthopoxviru 80.67
1eer_B227 Epobp, erythropoietin receptor; signal transductio 80.07
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
Probab=99.65  E-value=3.8e-16  Score=111.38  Aligned_cols=76  Identities=22%  Similarity=0.235  Sum_probs=69.4

Q ss_pred             EEEEEEEeeCCC-CCCeEEEEecCCceEEEccCCCCCEEEEEEEEEcCCCCCCCCCceeeeeCCCCCCCCCCceEEE
Q psy7019          11 SFKASHSLSDRP-DDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAPLKGKTYFS   86 (128)
Q Consensus        11 ~i~Y~le~~~~~-~~~~~~v~~g~~t~~~V~~L~p~t~Y~FRVrA~N~~G~G~~S~~~~~~T~~~pp~~~~~p~v~~   86 (128)
                      .+.|+|+++++. ++.+..++.+..++++|++|+|++.|.|||+|+|.+|.|++|+.+.|+|....|..|.+|++..
T Consensus        57 i~~Yev~~~~k~~~~~~~~~~~g~~ts~~v~~L~P~T~Y~~rV~A~n~~G~G~~S~~~~f~T~~~~P~~P~~p~l~~  133 (137)
T 1wk0_A           57 LYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDIPNPPRISG  133 (137)
T ss_dssp             CCEEEEEECSSCTTSCCEEEEEESCSEEEECSCCTTCEECEEEEEEETTEECCCCCCCCEECCCSSSCCCSCSCCCS
T ss_pred             cEEEEEEEEecCCCCceEEEEecCccEEEEcCCCCCCEEEEEEEEEeCCCcCCCCCCEEEECCCCCCCCCCCCEEeC
Confidence            489999998753 4668888899999999999999999999999999999999999999999999999999998874



>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-08
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 8e-08
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-07
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 1e-07
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-07
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-07
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 3e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-07
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 3e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 4e-07
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 6e-07
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 9e-07
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 1e-06
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 2e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-06
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 2e-06
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 3e-06
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 6e-06
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 8e-06
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 1e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-05
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-05
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-05
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 2e-05
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 2e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-05
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 3e-05
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 4e-05
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 5e-05
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-05
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 6e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 7e-05
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 9e-05
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-04
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 1e-04
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 3e-04
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 4e-04
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 5e-04
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 6e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 6e-04
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 7e-04
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 7e-04
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 8e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 8e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 0.001
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 0.002
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 0.002
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 0.002
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 0.002
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 0.004
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 47.9 bits (113), Expect = 1e-08
 Identities = 16/56 (28%), Positives = 25/56 (44%)

Query: 23  DDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCTAPPAP 78
           D +   VY G   +  +N L+    Y   + A  ++ +G  SEA  FTT +  P  
Sbjct: 70  DGKYKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEAEIFTTLSCEPDI 125


>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d2crza197 Fibronectin type-III domain containing protein 3a, 99.6
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.49
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.48
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.47
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.46
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.44
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.41
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.4
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.4
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.38
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.36
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.36
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.32
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.32
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.3
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.29
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.28
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.28
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.26
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.21
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.21
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.2
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.19
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.19
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.18
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.18
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.18
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.16
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.15
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.14
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.13
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.11
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.09
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.09
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.07
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.06
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.05
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.05
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.05
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.04
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.03
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.03
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.0
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.99
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.99
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.97
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.91
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.87
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.86
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.84
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.83
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.83
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.81
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.78
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.74
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.71
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.71
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.67
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.65
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.65
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.64
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.62
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.61
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.61
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.57
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.57
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.52
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.4
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.29
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.27
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.43
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.36
d2c4fu1116 Extracellular region of human tissue factor {Human 96.45
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 95.6
d2hfta1106 Extracellular region of human tissue factor {Human 95.06
d1a21a1103 Extracellular region of human tissue factor {Rabbi 94.14
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 89.95
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 80.72
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 80.45
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=1.9e-15  Score=98.98  Aligned_cols=68  Identities=32%  Similarity=0.420  Sum_probs=61.5

Q ss_pred             eeCCc-EEEEEEEeeCCCCCCeEEEEecCCceEEEccCCCCCEEEEEEEEEcCCCCCCCCCceeeeeCC
Q psy7019           6 EFNQA-SFKASHSLSDRPDDRKHVVYQGTNFSCKVNKLQELTTYRFYITATNDAGQGPYSEAYPFTTCT   73 (128)
Q Consensus         6 ~~~~~-~i~Y~le~~~~~~~~~~~v~~g~~t~~~V~~L~p~t~Y~FRVrA~N~~G~G~~S~~~~~~T~~   73 (128)
                      ..||. +.+|.||+++.+.+.|..++.+..+++.|++|+|++.|.|||+|.|..|.|++|+.+.++|.+
T Consensus        28 ~~gg~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~v~~L~p~t~Y~frV~A~N~~G~s~~S~~~~~~T~p   96 (97)
T d2crza1          28 VDGGSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAP   96 (97)
T ss_dssp             CCTTSCCCEEEEEEECTTSCCCEEEEEESCSEEEEESCCTTCEEEECCEEECSSCBCCCCCCEEEECCC
T ss_pred             cCCCCceeEEEEEEEcCcCCceeEeecCCceEEEEcCCCCCEEEEEEEEEecCCeEcCCcCCCeEEeCc
Confidence            34554 568999999878888999999999999999999999999999999999999999999999875



>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure