Psyllid ID: psy7087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQMSSAAYRYTAAAASMARSYNTAGPMGHHLSSGSAQCAVMARSHQDHRTPMFPASMNLQSGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK
cccHHHcccHHcccccHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHcc
ccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHc
MDYSYLNQAAAqfdasscaltssmdptglgpcsygdqmsSAAYRYTAAAASMARsyntagpmghhlssgsaQCAVMARshqdhrtpmfpasmnlqsglpykvysghegvltekrkQRRIRTTFTSAQLKELERAFQethypdiytrEEIAMKIDLTEARVQK
MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQMSSAAYRYTAAAASMARSYNTAGPMGHHLSSGSAQCAVMARSHQDHRTPMFPASMNLQSGLPYKVYSGHegvltekrkqrrirttfTSAQLKELErafqethypdiytreeIAMKIDLTEARVQK
MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQmssaayrytaaaasmarsyntaGPMGHHLSSGSAQCAVMARSHQDHRTPMFPASMNLQSGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK
********************************************Y****************************************************LPYKVYSGHEGVL********IRTTFTSAQLKELERAFQETHYPDIYTREEIAMKID********
*DYSY**QAAA**************************************************************************************************************TFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEA*V**
MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQMSSAAYRYTAAAASMARSYNTAGPMGHHLSSGSAQCAVMARSHQDHRTPMFPASMNLQSGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK
****YLNQAAAQFDASSCALTSSM************************AASMAR***TAG*MG******************************************************RIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQMSSAAYRYTAAAASMARSYNTAGPMGHHLSSGSAQCAVMARSHQDHRTPMFPASMNLQSGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q62066 280 Paired mesoderm homeobox yes N/A 0.808 0.467 0.484 6e-27
O14813 284 Paired mesoderm homeobox yes N/A 0.827 0.471 0.493 7e-27
Q62782 281 Paired mesoderm homeobox yes N/A 0.827 0.476 0.493 1e-26
O35690 314 Paired mesoderm homeobox no N/A 0.845 0.436 0.463 2e-25
Q99453 314 Paired mesoderm homeobox no N/A 0.845 0.436 0.463 2e-25
Q26602 288 Homeobox protein SMOX-3 ( N/A N/A 0.302 0.170 0.897 2e-20
A6YP92 566 Homeobox protein ARX OS=R no N/A 0.333 0.095 0.767 4e-19
Q96QS3 562 Homeobox protein ARX OS=H no N/A 0.333 0.096 0.767 4e-19
O35085 564 Homeobox protein ARX OS=M no N/A 0.333 0.095 0.767 5e-19
O42115 453 Aristaless-related homeob no N/A 0.333 0.119 0.767 1e-18
>sp|Q62066|PHX2A_MOUSE Paired mesoderm homeobox protein 2A OS=Mus musculus GN=Phox2a PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 98/165 (59%), Gaps = 34/165 (20%)

Query: 1   MDYSYLNQAAAQFDASSCALTSSMDPTGLGPCSYGDQMS---SAAYRYTAAAASMARSYN 57
           MDYSYLN     +D+   A+ +S         +YGD  +      ++Y+     +  ++ 
Sbjct: 1   MDYSYLNS----YDSCVAAMEAS---------AYGDFGACSQPGGFQYSP----LRPAFP 43

Query: 58  TAGPMGHHLSSGSAQCAVMA-RSHQDHRTPMFPASMNLQSGLPYKVYSGHEGVLTEKRKQ 116
            AGP    L  GS+ CA+ A R HQ       PA     S +PYK +    G L EKRKQ
Sbjct: 44  AAGPPCPAL--GSSNCALGALRDHQ-------PAPY---SAVPYKFFPEPSG-LHEKRKQ 90

Query: 117 RRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQ 161
           RRIRTTFTSAQLKELER F ETHYPDIYTREE+A+KIDLTEARVQ
Sbjct: 91  RRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQ 135
May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype.
Mus musculus (taxid: 10090)
>sp|O14813|PHX2A_HUMAN Paired mesoderm homeobox protein 2A OS=Homo sapiens GN=PHOX2A PE=1 SV=2 Back     alignment and function description
>sp|Q62782|PHX2A_RAT Paired mesoderm homeobox protein 2A OS=Rattus norvegicus GN=Phox2a PE=2 SV=1 Back     alignment and function description
>sp|O35690|PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus GN=Phox2b PE=1 SV=1 Back     alignment and function description
>sp|Q99453|PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens GN=PHOX2B PE=1 SV=2 Back     alignment and function description
>sp|Q26602|SMOX3_SCHMA Homeobox protein SMOX-3 (Fragment) OS=Schistosoma mansoni GN=SMOX-3 PE=2 SV=1 Back     alignment and function description
>sp|A6YP92|ARX_RAT Homeobox protein ARX OS=Rattus norvegicus GN=Arx PE=2 SV=1 Back     alignment and function description
>sp|Q96QS3|ARX_HUMAN Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1 Back     alignment and function description
>sp|O35085|ARX_MOUSE Homeobox protein ARX OS=Mus musculus GN=Arx PE=2 SV=3 Back     alignment and function description
>sp|O42115|ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio GN=arx PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
307205017223 Paired mesoderm homeobox protein 2B [Har 0.956 0.695 0.576 6e-40
328788663196 PREDICTED: paired mesoderm homeobox prot 0.975 0.806 0.602 5e-39
383854434 313 PREDICTED: uncharacterized protein LOC10 0.987 0.511 0.614 4e-38
340726685 314 PREDICTED: hypothetical protein LOC10064 0.987 0.509 0.614 1e-37
350418342200 PREDICTED: paired mesoderm homeobox prot 0.987 0.8 0.614 1e-37
332027511212 Paired mesoderm homeobox protein 2B [Acr 0.956 0.731 0.586 3e-37
307182442 368 Paired mesoderm homeobox protein 2B [Cam 0.956 0.421 0.589 1e-36
322797345185 hypothetical protein SINV_02900 [Solenop 0.956 0.837 0.586 2e-36
380018965187 PREDICTED: paired mesoderm homeobox prot 0.987 0.855 0.559 4e-36
328705901 400 PREDICTED: hypothetical protein LOC10057 0.950 0.385 0.515 1e-35
>gi|307205017|gb|EFN83540.1| Paired mesoderm homeobox protein 2B [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 113/196 (57%), Positives = 126/196 (64%), Gaps = 41/196 (20%)

Query: 1   MDYSYLNQAAAQ----FDASSCALTSSMDPTGLGPCSYGD-----QMSSAAYRYTAAAAS 51
           MDYSYLNQAAA     F+ASSCAL +     G   CSYGD     QMS AA RY AA  +
Sbjct: 1   MDYSYLNQAAAAAAAGFEASSCALAA-----GEMQCSYGDLSSCSQMSQAASRYPAAQTA 55

Query: 52  ---------MARSYNTAGPMGHHLSSG--------------SAQCAVMA-RSHQDHR--T 85
                     A +   A P G  L++               S  C+VMA RS + HR   
Sbjct: 56  GYPSIADAAAAGAAAAAAPCGTPLAAHHTAHPHAHAHHGAHSTPCSVMAARSQEVHRHAA 115

Query: 86  PMFPASMNLQSGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYT 145
            +FP+++NLQSGL YK YSGH+G L EKRKQRRIRTTFTSAQLKELERAFQETHYPDIYT
Sbjct: 116 SIFPSAINLQSGLGYKAYSGHDG-LAEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYT 174

Query: 146 REEIAMKIDLTEARVQ 161
           REEIAMKIDLTEARVQ
Sbjct: 175 REEIAMKIDLTEARVQ 190

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328788663|ref|XP_001120833.2| PREDICTED: paired mesoderm homeobox protein 2B [Apis mellifera] Back     alignment and taxonomy information
>gi|383854434|ref|XP_003702726.1| PREDICTED: uncharacterized protein LOC100883470 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340726685|ref|XP_003401684.1| PREDICTED: hypothetical protein LOC100649005 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418342|ref|XP_003491830.1| PREDICTED: paired mesoderm homeobox protein 2B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332027511|gb|EGI67588.1| Paired mesoderm homeobox protein 2B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307182442|gb|EFN69677.1| Paired mesoderm homeobox protein 2B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322797345|gb|EFZ19457.1| hypothetical protein SINV_02900 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380018965|ref|XP_003693389.1| PREDICTED: paired mesoderm homeobox protein 2B-like [Apis florea] Back     alignment and taxonomy information
>gi|328705901|ref|XP_003242937.1| PREDICTED: hypothetical protein LOC100570786 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
UNIPROTKB|F1NMR5229 F1NMR5 "Uncharacterized protei 0.401 0.283 0.787 1.9e-26
UNIPROTKB|F1NMR6213 F1NMR6 "Uncharacterized protei 0.401 0.305 0.787 1.9e-26
UNIPROTKB|E1BME7 315 PHOX2B "Uncharacterized protei 0.401 0.206 0.787 1.9e-26
UNIPROTKB|E2RMY1 314 PHOX2B "Uncharacterized protei 0.401 0.207 0.787 1.9e-26
UNIPROTKB|Q99453 314 PHOX2B "Paired mesoderm homeob 0.401 0.207 0.787 1.9e-26
MGI|MGI:1100882 314 Phox2b "paired-like homeobox 2 0.401 0.207 0.787 1.9e-26
UNIPROTKB|F2Z3R9 314 Phox2b "Protein Phox2b" [Rattu 0.401 0.207 0.787 1.9e-26
ZFIN|ZDB-GENE-050407-3 285 phox2bb "paired-like homeobox 0.382 0.217 0.825 3.1e-26
UNIPROTKB|F1MIH1 285 PHOX2A "Uncharacterized protei 0.512 0.291 0.655 5.1e-26
UNIPROTKB|E2R2D3 284 PHOX2A "Uncharacterized protei 0.512 0.292 0.655 5.1e-26
UNIPROTKB|F1NMR5 F1NMR5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 1.9e-26, Sum P(2) = 1.9e-26
 Identities = 52/66 (78%), Positives = 59/66 (89%)

Query:    96 SGLPYKVYSGHEGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDL 155
             + +PYK+++ H G L EKRKQRRIRTTFTSAQLKELER F ETHYPDIYTREE+A+KIDL
Sbjct:    79 AAVPYKLFTDHGG-LNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDL 137

Query:   156 TEARVQ 161
             TEARVQ
Sbjct:   138 TEARVQ 143
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0000790 "nuclear chromatin" evidence=IEA
GO:0000978 "RNA polymerase II core promoter proximal region sequence-specific DNA binding" evidence=IEA
GO:0001764 "neuron migration" evidence=IEA
GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=IEA
GO:0003357 "noradrenergic neuron differentiation" evidence=IEA
GO:0003360 "brainstem development" evidence=IEA
GO:0008285 "negative regulation of cell proliferation" evidence=IEA
GO:0010001 "glial cell differentiation" evidence=IEA
GO:0021533 "cell differentiation in hindbrain" evidence=IEA
GO:0021723 "medullary reticular formation development" evidence=IEA
GO:0021934 "hindbrain tangential cell migration" evidence=IEA
GO:0045665 "negative regulation of neuron differentiation" evidence=IEA
GO:0045666 "positive regulation of neuron differentiation" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0048484 "enteric nervous system development" evidence=IEA
GO:0048485 "sympathetic nervous system development" evidence=IEA
GO:0048486 "parasympathetic nervous system development" evidence=IEA
GO:0048839 "inner ear development" evidence=IEA
GO:0048894 "efferent axon development in a lateral line nerve" evidence=IEA
GO:0060541 "respiratory system development" evidence=IEA
GO:0061452 "retrotrapezoid nucleus neuron differentiation" evidence=IEA
GO:0071542 "dopaminergic neuron differentiation" evidence=IEA
GO:0071773 "cellular response to BMP stimulus" evidence=IEA
GO:1901166 "neural crest cell migration involved in autonomic nervous system development" evidence=IEA
UNIPROTKB|F1NMR6 F1NMR6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BME7 PHOX2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMY1 PHOX2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99453 PHOX2B "Paired mesoderm homeobox protein 2B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1100882 Phox2b "paired-like homeobox 2b" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z3R9 Phox2b "Protein Phox2b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050407-3 phox2bb "paired-like homeobox 2bb" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIH1 PHOX2A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2D3 PHOX2A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-19
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-15
smart0038957 smart00389, HOX, Homeodomain 9e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 75.2 bits (186), Expect = 6e-19
 Identities = 24/45 (53%), Positives = 32/45 (71%)

Query: 117 RRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQ 161
           RR RTTFT  QL+ELE+ F++  YP    REE+A K+ LTE +V+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
KOG0484|consensus125 99.58
KOG0850|consensus245 99.49
KOG2251|consensus 228 99.41
KOG0488|consensus309 99.4
KOG0489|consensus261 99.4
KOG0843|consensus197 99.37
KOG0842|consensus 307 99.36
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.32
KOG0487|consensus308 99.2
KOG0485|consensus 268 99.13
KOG0848|consensus317 99.13
KOG0494|consensus 332 99.13
KOG0492|consensus246 99.13
KOG0486|consensus 351 99.07
KOG0493|consensus342 99.04
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.88
KOG0844|consensus 408 98.81
KOG0490|consensus 235 98.71
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.7
KOG0491|consensus194 98.68
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.58
KOG0849|consensus 354 98.57
COG5576156 Homeodomain-containing transcription factor [Trans 98.24
KOG0847|consensus288 97.82
KOG0483|consensus 198 97.73
KOG3802|consensus398 97.69
KOG4577|consensus 383 97.41
KOG2252|consensus558 97.12
KOG0490|consensus235 96.1
KOG1168|consensus385 95.73
KOG0774|consensus334 93.52
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 92.99
KOG0775|consensus304 91.0
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 85.13
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 83.68
KOG1146|consensus 1406 81.76
>KOG0484|consensus Back     alignment and domain information 
Probab=99.58  E-value=3.7e-16  Score=108.86  Aligned_cols=53  Identities=92%  Similarity=1.224  Sum_probs=50.6

Q ss_pred             cccccccCCCCcccChHHHHHHHHhhhhcCCCCHHHHHHHHHHcCCCCCcccC
Q psy7087         110 LTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK  162 (162)
Q Consensus       110 ~~~~~k~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~L~e~qVkI  162 (162)
                      ...++|+||.||+||..||.+||+.|-++||||+.+|++||.+|+|+|.+|||
T Consensus        11 l~ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQV   63 (125)
T KOG0484|consen   11 LTEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQV   63 (125)
T ss_pred             hhHHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHH
Confidence            45688999999999999999999999999999999999999999999999986

>KOG0850|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 8e-17
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 2e-15
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 4e-15
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-14
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 4e-14
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 1e-12
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 7e-11
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 7e-11
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-10
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 6e-10
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 3e-08
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 44/49 (89%)
Query: 113 KRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQ 161
           KRKQRR RTTFTS QL+ELE+AF  THYPD++TREE+AMKI LTEAR+Q
Sbjct: 3   KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQ 51
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 7e-33
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-32
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-31
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 8e-31
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-30
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 4e-28
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-28
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-27
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-27
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-25
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 8e-23
1uhs_A72 HOP, homeodomain only protein; structural genomics 6e-22
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-21
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-20
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-20
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 4e-16
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-15
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-15
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 3e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 4e-13
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 8e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-11
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-11
3a01_A93 Homeodomain-containing protein; homeodomain, prote 4e-11
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-11
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-11
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-11
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 4e-11
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 5e-11
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 6e-11
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-11
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-10
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-09
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-09
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-08
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-07
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-07
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-06
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 5e-06
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 7e-06
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-05
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  110 bits (278), Expect = 7e-33
 Identities = 36/55 (65%), Positives = 45/55 (81%)

Query: 107 EGVLTEKRKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQ 161
           E  +  KRKQRR RTTF+++QL ELERAF+ T YPDIYTREE+A + +LTEAR+Q
Sbjct: 9   EPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.42
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.4
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.39
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.37
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.36
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.35
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.35
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.34
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.34
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.34
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.33
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.33
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.32
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.32
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.32
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.32
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.31
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.31
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.31
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.3
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.3
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.3
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.3
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.29
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.28
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.28
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.28
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.28
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.26
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.26
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.26
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.26
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.26
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.25
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.24
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.22
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.21
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.21
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.2
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.19
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.17
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.15
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.15
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.14
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.14
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.14
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.12
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.1
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.09
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.09
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.08
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.05
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.05
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.03
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.03
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.02
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.01
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.0
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 98.97
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.96
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.96
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.94
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.9
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.9
2e19_A64 Transcription factor 8; homeobox domain, structura 98.88
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.86
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.86
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.84
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.73
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.48
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.33
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.14
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 97.84
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 88.96
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.42  E-value=1.7e-13  Score=91.54  Aligned_cols=51  Identities=14%  Similarity=0.128  Sum_probs=47.7

Q ss_pred             cccccCCCCcccChHHHHHHHHhhhh----cCCCCHHHHHHHHHHcCCCCCcccC
Q psy7087         112 EKRKQRRIRTTFTSAQLKELERAFQE----THYPDIYTREEIAMKIDLTEARVQK  162 (162)
Q Consensus       112 ~~~k~rr~Rt~ft~~Ql~~Le~~F~~----~~yp~~~~r~~LA~~l~L~e~qVkI  162 (162)
                      ..+++||.||.||.+|+.+||..|+.    ++||+..+|++||..|+|++.||||
T Consensus        13 ~~~~~rR~Rt~ft~~Ql~~Le~~f~~~~~~~~yp~~~~r~~La~~lgL~~~~Vkv   67 (80)
T 1wh5_A           13 GGGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKV   67 (80)
T ss_dssp             CCCCSCCCSCCCCHHHHHHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHH
T ss_pred             CCCCCCCCCccCCHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHhCCCcccccC
Confidence            34567889999999999999999999    9999999999999999999999987
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-17
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 8e-16
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 9e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-15
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-14
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 5e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-13
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-12
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 7e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 9e-11
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 8e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-10
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-09
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 6e-09
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 6e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 70.6 bits (173), Expect = 1e-17
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 114 RKQRRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQ 161
           R  R+ R  +T  Q  ELE+ F    Y     R E+A  ++LTE +V+
Sbjct: 11  RSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVK 58
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.43
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.42
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.42
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.41
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.4
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.38
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.37
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.37
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.37
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.36
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.36
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.31
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.31
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.28
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.27
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.26
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.26
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.25
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.23
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.17
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.15
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.14
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.12
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.0
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.85
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.84
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.78
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.59
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.53
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.48
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Msx-1 homeodomain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.43  E-value=3.3e-14  Score=88.00  Aligned_cols=46  Identities=43%  Similarity=0.642  Sum_probs=44.1

Q ss_pred             CCCCcccChHHHHHHHHhhhhcCCCCHHHHHHHHHHcCCCCCcccC
Q psy7087         117 RRIRTTFTSAQLKELERAFQETHYPDIYTREEIAMKIDLTEARVQK  162 (162)
Q Consensus       117 rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~L~e~qVkI  162 (162)
                      ||.||.||.+|+..||..|+.++||+..+|++||..|||++.+|+|
T Consensus         1 rr~Rt~ft~~Ql~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~   46 (58)
T d1ig7a_           1 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKI   46 (58)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhheee
Confidence            5689999999999999999999999999999999999999999986
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure