Psyllid ID: psy7265

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--

MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSREAEEKFKEVAEAYEVLSDKKKRDLYDRYGEDGLKSGGPGLHTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTSKKEDKVLTINVKPGWKAGTKITFQKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP

cccccHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccEEEEcccccccccccEEEEEEEEEEEcccccccccEEEEccccccccccccccEEEEEEEccccccEEEcccEEEEEEccHHHHccccEEEEEcccccEEEEEccccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHcc

ccccHHHEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHccccccEEccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEEEEEcccccccEEEEccccccccccEEEEEEEEEEEEccccccccEEEEccccccccccccccEEEEEEEcccccEEcccccEEEEEEEEHHHHHcccEEEEccccccEEEEEEcccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHcc

MGKNYYAILglnkgasdDEIKKAYRKLALKyhpdknksrEAEEKFKEVAEAYEVLSDkkkrdlydrygedglksggpglhtggtenftsfhgdpratfaqffgssspfgaffefpgsggrggpgfqfgmdedmdtddifsmggpraggpgggafrsqsfnihgspnrakdkvqdnaiehDLYVTLEDIVRGCTKKMKisrkvlqpdgtskkedkvltinvkpgwkagtkitfqkegdqgknkipadIVFIIRdkphplfkregsdlrYTAKVSLREALtgcvltvptltgekvnlNLKNEIIktntvkkipgqglpfpkepqkkgdllvsfdikfpdtlsQQTKDILYDLLP

MGKNYYAILglnkgasddEIKKAYRKLAlkyhpdknksreaeEKFKEVAEAyevlsdkkkrdlYDRYGedglksggpglhTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKkmkisrkvlqpdgtskkedkvltinvkpgwkagtkitfqkegdqgknkiPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALtgcvltvptltgekvnlnlkneiiktntvkkipgqglpfpkepqKKGDLLVSFDIkfpdtlsqqtkdilydllp

MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSReaeekfkevaeayevLSDKKKRDLYDRYGEDGLKSGGPGLHTGGTENFTSFHGDPRATfaqffgssspfgaffefpgsggrggpgfqfgMDEDMDTDDIFSMggpraggpgggaFRSQSFNIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTSKKEDKVLTINVKPGWKAGTKITFQKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP

****YYAILGLNK*********AYRKLA***********************************************************TSFHGDPRATFAQFFGSSSPFGAFFEFP************************************************************AIEHDLYVTLEDIVRGCTKKMKISR**************VLTINVKPGWKAGTKITFQKEG*QGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIP**************DLLVSFDIKFPDTLS***KDILY****

MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNK****EEKFKEVAEAYEVLSDKKKRDLYDRYGEDG********************GDPRATFAQ*******************************************************************************DLYVTLEDIVRGCTK*********************LTINVKPGWKAGTKIT**********KI*ADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP

*GKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSREAEEKFKEVAEAYEVLSDKKKRDLYDRYGEDGLKSGGPGLHTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTSKKEDKVLTINVKPGWKAGTKITFQKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKxxxxxxxxxxxxxxxxxxxxxKKRDLYDRYGEDGLKSGGPGLHTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTSKKEDKVLTINVKPGWKAGTKITFQKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		352
FB\|FBgn0031322		350	CG5001 [Drosophila melanogaste	0.965	0.971	0.529	1.1e-92
FB\|FBgn0263106		334	DnaJ-1 "DnaJ-like-1" [Drosophi	0.542	0.571	0.589	3.1e-87
ZFIN\|ZDB-GENE-030131-5455		340	dnajb1b "DnaJ (Hsp40) homolog,	0.616	0.638	0.488	5.7e-86
UNIPROTKB\|F1P9G0		337	DNAJB4 "Uncharacterized protei	0.559	0.584	0.529	5.8e-82
UNIPROTKB\|Q9UDY4		337	DNAJB4 "DnaJ homolog subfamily	0.559	0.584	0.529	1.5e-81
UNIPROTKB\|P25685		340	DNAJB1 "DnaJ homolog subfamily	0.613	0.635	0.511	2.5e-81
UNIPROTKB\|E2R9D7		340	DNAJB1 "Uncharacterized protei	0.613	0.635	0.506	3.2e-81
RGD\|1305826		337	Dnajb4 "DnaJ (Hsp40) homolog,	0.559	0.584	0.533	6.5e-81
UNIPROTKB\|F1S9T0		344	DNAJB4 "Uncharacterized protei	0.559	0.572	0.524	6.5e-81
UNIPROTKB\|Q2KIT4		337	DNAJB4 "DnaJ homolog subfamily	0.522	0.545	0.550	8.3e-81

FB\|FBgn0031322 CG5001 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 923 (330.0 bits), Expect = 1.1e-92, P = 1.1e-92
 Identities = 191/361 (52%), Positives = 241/361 (66%)

Query:     1 MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSRXXXXXXXXXXXXXXXLSDKKK 60
             MGK+YY ILGL K A+DDEIKKAYRKLAL+YHPDKNK+                LSDK K
Sbjct:     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSK 60

Query:    61 RDLYDRYGEDGLKSGGPGLHTGG--TENFT-SFHGDPRATXXXXXXXXXXXXXXXXXXXX 117
             R++YD+YGEDGLKSGG     GG  + +FT  FHGDPRAT                    
Sbjct:    61 REVYDKYGEDGLKSGGT--RNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDN 118

Query:   118 XXXXXXXXXXXMDEDMDTD-DIFSM------XXXXXXXXXXXXFRSQSFNIHGSPNRAKD 170
                           D+DT+ D FS                   FRS SFN+H +P + K+
Sbjct:   119 LFDKKVF-------DLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVH-TPFK-KE 169

Query:   171 KVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTSKKEDKVLTINVKPGWKAGTKI 230
             + QD  +EHDLYVTLE+I  GC KKMKISR+++Q DG+S+KE+K L I++KPGWK+GTK+
Sbjct:   170 QKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKV 229

Query:   231 TFQKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTG 290
             TFQKEGDQ   KIPADIVFIIRDKPH +FKREGSDLRYTA+++L++AL G V  VPT++G
Sbjct:   230 TFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSG 289

Query:   291 EKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDL 350
             +K+ ++   EIIK NTVK+I G GLPFPK+  +KGDLLV+FDI+FP+ L+   K++L D+
Sbjct:   290 DKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDM 349

Query:   351 L 351
             L
Sbjct:   350 L 350

GO:0009408 "response to heat" evidence=ISS

GO:0006457 "protein folding" evidence=IEA

GO:0051082 "unfolded protein binding" evidence=IEA

FB\|FBgn0263106 DnaJ-1 "DnaJ-like-1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5455 dnajb1b "DnaJ (Hsp40) homolog, subfamily B, member 1b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P9G0 DNAJB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UDY4 DNAJB4 "DnaJ homolog subfamily B member 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P25685 DNAJB1 "DnaJ homolog subfamily B member 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R9D7 DNAJB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1305826 Dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S9T0 DNAJB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KIT4 DNAJB4 "DnaJ homolog subfamily B member 4" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		352
COG0484		371	COG0484, DnaJ, DnaJ-class molecular chaperone with	1e-64
PTZ00037		421	PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov	9e-61
cd10747		158	cd10747, DnaJ_C, C-terminal substrate binding doma	2e-50
PRK14286		372	PRK14286, PRK14286, chaperone protein DnaJ; Provis	1e-46
TIGR02349		354	TIGR02349, DnaJ_bact, chaperone protein DnaJ	2e-45
PRK14284		391	PRK14284, PRK14284, chaperone protein DnaJ; Provis	6e-45
PRK14298		377	PRK14298, PRK14298, chaperone protein DnaJ; Provis	3e-44
PRK14292		371	PRK14292, PRK14292, chaperone protein DnaJ; Provis	9e-44
PRK10767		371	PRK10767, PRK10767, chaperone protein DnaJ; Provis	7e-42
PRK14299		291	PRK14299, PRK14299, chaperone protein DnaJ; Provis	1e-41
PRK14283		378	PRK14283, PRK14283, chaperone protein DnaJ; Provis	2e-37
PRK14290		365	PRK14290, PRK14290, chaperone protein DnaJ; Provis	3e-35
PRK14281		397	PRK14281, PRK14281, chaperone protein DnaJ; Provis	3e-34
PRK14294		366	PRK14294, PRK14294, chaperone protein DnaJ; Provis	9e-33
PRK14300		372	PRK14300, PRK14300, chaperone protein DnaJ; Provis	1e-32
pfam00226		63	pfam00226, DnaJ, DnaJ domain	2e-32
PRK14301		373	PRK14301, PRK14301, chaperone protein DnaJ; Provis	2e-32
PRK10266		306	PRK10266, PRK10266, curved DNA-binding protein Cbp	4e-31
PRK14291		382	PRK14291, PRK14291, chaperone protein DnaJ; Provis	6e-30
PRK14280		376	PRK14280, PRK14280, chaperone protein DnaJ; Provis	1e-29
PRK14297		380	PRK14297, PRK14297, chaperone protein DnaJ; Provis	2e-29
PRK14276		380	PRK14276, PRK14276, chaperone protein DnaJ; Provis	3e-29
PRK14278		378	PRK14278, PRK14278, chaperone protein DnaJ; Provis	4e-28
PRK14289		386	PRK14289, PRK14289, chaperone protein DnaJ; Provis	5e-28
smart00271		60	smart00271, DnaJ, DnaJ molecular chaperone homolog	8e-28
cd06257		55	cd06257, DnaJ, DnaJ domain or J-domain	1e-27
PRK14296		372	PRK14296, PRK14296, chaperone protein DnaJ; Provis	2e-27
PRK14287		371	PRK14287, PRK14287, chaperone protein DnaJ; Provis	2e-27
PRK14288		369	PRK14288, PRK14288, chaperone protein DnaJ; Provis	2e-27
PRK14293		374	PRK14293, PRK14293, chaperone protein DnaJ; Provis	6e-27
PRK14277		386	PRK14277, PRK14277, chaperone protein DnaJ; Provis	2e-26
PRK14285		365	PRK14285, PRK14285, chaperone protein DnaJ; Provis	4e-25
COG2214		237	COG2214, CbpA, DnaJ-class molecular chaperone [Pos	4e-25
PRK14295		389	PRK14295, PRK14295, chaperone protein DnaJ; Provis	5e-24
PRK14282		369	PRK14282, PRK14282, chaperone protein DnaJ; Provis	5e-23
PRK14279		392	PRK14279, PRK14279, chaperone protein DnaJ; Provis	2e-22
TIGR03835		871	TIGR03835, termin_org_DnaJ, terminal organelle ass	1e-20
pfam01556		81	pfam01556, DnaJ_C, DnaJ C terminal domain	1e-19
TIGR02349		354	TIGR02349, DnaJ_bact, chaperone protein DnaJ	2e-18
COG5407		610	COG5407, SEC63, Preprotein translocase subunit Sec	6e-15
PRK14291		382	PRK14291, PRK14291, chaperone protein DnaJ; Provis	3e-14
PRK14281		397	PRK14281, PRK14281, chaperone protein DnaJ; Provis	2e-13
PRK14277		386	PRK14277, PRK14277, chaperone protein DnaJ; Provis	1e-12
PRK14293		374	PRK14293, PRK14293, chaperone protein DnaJ; Provis	2e-12
PRK14282		369	PRK14282, PRK14282, chaperone protein DnaJ; Provis	3e-12
PRK14301		373	PRK14301, PRK14301, chaperone protein DnaJ; Provis	4e-12
PTZ00341		1136	PTZ00341, PTZ00341, Ring-infected erythrocyte surf	4e-12
PRK14295		389	PRK14295, PRK14295, chaperone protein DnaJ; Provis	4e-11
PRK14289		386	PRK14289, PRK14289, chaperone protein DnaJ; Provis	6e-11
PRK14297		380	PRK14297, PRK14297, chaperone protein DnaJ; Provis	8e-11
PRK10767		371	PRK10767, PRK10767, chaperone protein DnaJ; Provis	3e-10
PRK14279		392	PRK14279, PRK14279, chaperone protein DnaJ; Provis	4e-10
PRK14278		378	PRK14278, PRK14278, chaperone protein DnaJ; Provis	2e-09
PRK09430		267	PRK09430, djlA, Dna-J like membrane chaperone prot	7e-09
PRK14294		366	PRK14294, PRK14294, chaperone protein DnaJ; Provis	1e-07
COG5269		379	COG5269, ZUO1, Ribosome-associated chaperone zuoti	3e-07
PRK14276		380	PRK14276, PRK14276, chaperone protein DnaJ; Provis	2e-06
PRK14280		376	PRK14280, PRK14280, chaperone protein DnaJ; Provis	6e-06
PRK01356		166	PRK01356, hscB, co-chaperone HscB; Provisional	4e-05
COG1076		174	COG1076, DjlA, DnaJ-domain-containing proteins 1 [	4e-05
PRK14285		365	PRK14285, PRK14285, chaperone protein DnaJ; Provis	8e-05
PHA03102		153	PHA03102, PHA03102, Small T antigen; Reviewed	1e-04
PHA02624		647	PHA02624, PHA02624, large T antigen; Provisional	5e-04
PTZ00100		116	PTZ00100, PTZ00100, DnaJ chaperone protein; Provis	0.004

>gnl\|CDD\|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  209 bits (533), Expect = 1e-64
 Identities = 119/407 (29%), Positives = 165/407 (40%), Gaps = 124/407 (30%)

Query: 1   MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNK-SREAEEKFKEVAEAYEVLSDKK 59
             ++YY ILG++K AS++EIKKAYRKLA KYHPD+N   +EAEEKFKE+ EAYEVLSD +
Sbjct: 2   AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPE 61

Query: 60  KRDLYDRYGEDGLKSGGPGLHTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGG 119
           KR  YD++G  G K+GG      G   F  F GD    F  FFG            G GG
Sbjct: 62  KRAAYDQFGHAGFKAGG-----FGGFGFGGFGGDFGDIFEDFFGG-----------GGGG 105

Query: 120 RGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNIHGSPNRAKDKVQDNAIEH 179
           R  P                                         P R  D      + +
Sbjct: 106 RRRP---------------------------------------NRPRRGAD------LRY 120

Query: 180 DLYVTLEDIVRGCTKKMKISRKVLQP----DGTSKKEDKVL---------TINVKPGWKA 226
           +L +TLE+ V G  K+++++R V        G     D               V+     
Sbjct: 121 NLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFF 180

Query: 227 GTKITFQKEGDQGKN----------------------KIPA------------------- 245
             + T       GK                        IPA                   
Sbjct: 181 SFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPN 240

Query: 246 -----DIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNE 300
                D+   +  KPHP+F+R+G DL     +S  EA  G  + VPTL G +V L +   
Sbjct: 241 GGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDG-RVKLKIPAG 299

Query: 301 IIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDIL 347
             +T  V ++ G+G+P  +    +GDL V   ++ P  LS + K++L
Sbjct: 300 -TQTGEVFRLRGKGMPKLR-SGGRGDLYVRVKVETPKNLSDEQKELL 344

Length = 371

>gnl\|CDD\|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional	Back alignment and domain information

>gnl\|CDD\|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40	Back alignment and domain information

>gnl\|CDD\|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ	Back alignment and domain information

>gnl\|CDD\|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|215804 pfam00226, DnaJ, DnaJ domain	Back alignment and domain information

>gnl\|CDD\|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain	Back alignment and domain information

>gnl\|CDD\|99751 cd06257, DnaJ, DnaJ domain or J-domain	Back alignment and domain information

>gnl\|CDD\|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ	Back alignment and domain information

>gnl\|CDD\|216569 pfam01556, DnaJ_C, DnaJ C terminal domain	Back alignment and domain information

>gnl\|CDD\|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ	Back alignment and domain information

>gnl\|CDD\|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|167217 PRK01356, hscB, co-chaperone HscB; Provisional	Back alignment and domain information

>gnl\|CDD\|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|222986 PHA03102, PHA03102, Small T antigen; Reviewed	Back alignment and domain information

>gnl\|CDD\|222912 PHA02624, PHA02624, large T antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		352
COG0484		371	DnaJ DnaJ-class molecular chaperone with C-termina	100.0
PRK14288		369	chaperone protein DnaJ; Provisional	100.0
PRK14296		372	chaperone protein DnaJ; Provisional	100.0
PTZ00037		421	DnaJ_C chaperone protein; Provisional	100.0
PRK14286		372	chaperone protein DnaJ; Provisional	100.0
PRK14278		378	chaperone protein DnaJ; Provisional	100.0
PRK14279		392	chaperone protein DnaJ; Provisional	100.0
PRK14285		365	chaperone protein DnaJ; Provisional	100.0
PRK14298		377	chaperone protein DnaJ; Provisional	100.0
PRK14276		380	chaperone protein DnaJ; Provisional	100.0
PRK14287		371	chaperone protein DnaJ; Provisional	100.0
PRK14280		376	chaperone protein DnaJ; Provisional	100.0
PRK14281		397	chaperone protein DnaJ; Provisional	100.0
PRK14295		389	chaperone protein DnaJ; Provisional	100.0
PRK14277		386	chaperone protein DnaJ; Provisional	100.0
PRK14284		391	chaperone protein DnaJ; Provisional	100.0
PRK14297		380	chaperone protein DnaJ; Provisional	100.0
PRK14291		382	chaperone protein DnaJ; Provisional	100.0
PRK14299		291	chaperone protein DnaJ; Provisional	100.0
PRK14301		373	chaperone protein DnaJ; Provisional	100.0
PRK14282		369	chaperone protein DnaJ; Provisional	100.0
PRK14300		372	chaperone protein DnaJ; Provisional	100.0
PRK14294		366	chaperone protein DnaJ; Provisional	100.0
PRK14290		365	chaperone protein DnaJ; Provisional	100.0
PRK10767		371	chaperone protein DnaJ; Provisional	100.0
PRK14283		378	chaperone protein DnaJ; Provisional	100.0
TIGR02349		354	DnaJ_bact chaperone protein DnaJ. This model repre	100.0
PRK14293		374	chaperone protein DnaJ; Provisional	100.0
PRK10266		306	curved DNA-binding protein CbpA; Provisional	100.0
PRK14292		371	chaperone protein DnaJ; Provisional	100.0
PRK14289		386	chaperone protein DnaJ; Provisional	100.0
KOG0712\|consensus		337		100.0
TIGR03835		871	termin_org_DnaJ terminal organelle assembly protei	100.0
KOG0713\|consensus		336		100.0
KOG0715\|consensus		288		99.96
KOG0714\|consensus		306		99.95
PF01556		81	CTDII: DnaJ C terminal domain; InterPro: IPR002939	99.87
KOG0716\|consensus		279		99.79
PTZ00341		1136	Ring-infected erythrocyte surface antigen; Provisi	99.79
KOG0718\|consensus		546		99.77
COG2214		237	CbpA DnaJ-class molecular chaperone [Posttranslati	99.77
KOG0717\|consensus		508		99.76
KOG0691\|consensus		296		99.74
PF00226		64	DnaJ: DnaJ domain; InterPro: IPR001623 The prokary	99.73
KOG0624\|consensus		504		99.72
KOG0719\|consensus		264		99.7
PHA03102		153	Small T antigen; Reviewed	99.67
smart00271		60	DnaJ DnaJ molecular chaperone homology domain.	99.65
cd06257		55	DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho	99.62
KOG0721\|consensus		230		99.6
PRK01356		166	hscB co-chaperone HscB; Provisional	99.48
KOG0722\|consensus		329		99.47
PRK05014		171	hscB co-chaperone HscB; Provisional	99.46
KOG0550\|consensus		486		99.43
PRK03578		176	hscB co-chaperone HscB; Provisional	99.4
PRK00294		173	hscB co-chaperone HscB; Provisional	99.4
KOG0720\|consensus		490		99.34
PTZ00100		116	DnaJ chaperone protein; Provisional	99.31
PRK09430		267	djlA Dna-J like membrane chaperone protein; Provis	99.25
PF01556		81	CTDII: DnaJ C terminal domain; InterPro: IPR002939	99.22
PHA02624		647	large T antigen; Provisional	99.22
PRK14282		369	chaperone protein DnaJ; Provisional	99.18
COG5407		610	SEC63 Preprotein translocase subunit Sec63 [Intrac	99.15
PRK14290		365	chaperone protein DnaJ; Provisional	99.07
PRK14294		366	chaperone protein DnaJ; Provisional	99.07
PRK14299		291	chaperone protein DnaJ; Provisional	99.06
PRK14285		365	chaperone protein DnaJ; Provisional	99.05
PRK01773		173	hscB co-chaperone HscB; Provisional	99.05
PRK10767		371	chaperone protein DnaJ; Provisional	99.01
PRK14298		377	chaperone protein DnaJ; Provisional	99.0
PRK14284		391	chaperone protein DnaJ; Provisional	99.0
TIGR00714		157	hscB Fe-S protein assembly co-chaperone HscB. This	98.98
PRK14287		371	chaperone protein DnaJ; Provisional	98.96
PRK14300		372	chaperone protein DnaJ; Provisional	98.96
TIGR02349		354	DnaJ_bact chaperone protein DnaJ. This model repre	98.96
PRK14301		373	chaperone protein DnaJ; Provisional	98.95
PRK14288		369	chaperone protein DnaJ; Provisional	98.95
PRK14279		392	chaperone protein DnaJ; Provisional	98.94
PRK14295		389	chaperone protein DnaJ; Provisional	98.93
PRK14286		372	chaperone protein DnaJ; Provisional	98.89
PRK14293		374	chaperone protein DnaJ; Provisional	98.89
PRK10266		306	curved DNA-binding protein CbpA; Provisional	98.88
PRK14291		382	chaperone protein DnaJ; Provisional	98.86
PRK14276		380	chaperone protein DnaJ; Provisional	98.84
PRK14281		397	chaperone protein DnaJ; Provisional	98.84
PRK14280		376	chaperone protein DnaJ; Provisional	98.83
COG0484		371	DnaJ DnaJ-class molecular chaperone with C-termina	98.82
PRK14297		380	chaperone protein DnaJ; Provisional	98.81
PRK14278		378	chaperone protein DnaJ; Provisional	98.8
PRK14292		371	chaperone protein DnaJ; Provisional	98.79
PRK14296		372	chaperone protein DnaJ; Provisional	98.76
PRK14277		386	chaperone protein DnaJ; Provisional	98.76
PTZ00037		421	DnaJ_C chaperone protein; Provisional	98.75
PRK14283		378	chaperone protein DnaJ; Provisional	98.73
KOG1150\|consensus		250		98.69
PRK14289		386	chaperone protein DnaJ; Provisional	98.69
COG5269		379	ZUO1 Ribosome-associated chaperone zuotin [Transla	98.67
TIGR03835		871	termin_org_DnaJ terminal organelle assembly protei	98.62
KOG0568\|consensus		342		98.45
KOG1789\|consensus		2235		98.22
KOG0723\|consensus		112		98.17
KOG0712\|consensus		337		97.43
KOG3192\|consensus		168		97.26
COG1076		174	DjlA DnaJ-domain-containing proteins 1 [Posttransl	95.63
PF03656		127	Pam16: Pam16; InterPro: IPR005341 The Pam16 protei	93.94
KOG0431\|consensus		453		92.75
COG1076		174	DjlA DnaJ-domain-containing proteins 1 [Posttransl	90.61
KOG0724\|consensus		335		82.48
PF11833		194	DUF3353: Protein of unknown function (DUF3353); In	81.81

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=8.7e-76  Score=556.49  Aligned_cols=287  Identities=40%  Similarity=0.690  Sum_probs=248.8

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-ChhHHHHHHHHHHHHHhccChhhhhhhcccCcccCCCCCCCC
Q psy7265           1 MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNK-SREAEEKFKEVAEAYEVLSDKKKRDLYDRYGEDGLKSGGPGL   79 (352)
Q Consensus         1 m~~~~y~iLgv~~~a~~~~Ik~ayr~la~~~hPd~~~-~~~~~~~f~~i~~Ay~~L~d~~~R~~yD~~G~~~~~~~~~~~   79 (352)
                      |.+|||+||||+++||.+|||+|||+||++||||+|+ +++|+++|++|++||||||||+||++||+||++++++++.+ 
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g-   80 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG-   80 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC-
Confidence            6899999999999999999999999999999999999 78999999999999999999999999999999998733221 


Q ss_pred             CCCCCCCccccCCCchhhhhcccCCCCCCCCcccCCCCCCCCCCCcccCCCCCCCccccccCCCCCCCCCCCCCcccccc
Q psy7265          80 HTGGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSF  159 (352)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~f~~~fg~~~~f~~~f~~~~~~~~~g~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~  159 (352)
                       +.   +|..|.+++.|+|++|||+...              +                                     
T Consensus        81 -g~---g~~~fgg~~~DIF~~~FgGg~~--------------~-------------------------------------  105 (371)
T COG0484          81 -GF---GFGGFGGDFGDIFEDFFGGGGG--------------G-------------------------------------  105 (371)
T ss_pred             -CC---CcCCCCCCHHHHHHHhhcCCCc--------------c-------------------------------------
Confidence             11   2333333677888888763110              0                                     


Q ss_pred             ccCCCCCCCCCccCCCCeEEEEEeehhhhccCceEEEEEEEEeecC----------------------------------
Q psy7265         160 NIHGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQP----------------------------------  205 (352)
Q Consensus       160 ~~~~~~~~~~~~~~g~di~~~l~itlee~~~G~~~~i~~~~~~~~~----------------------------------  205 (352)
                           .+++..++++.|+.+.|+|||+||+.|++++|.+.+.+.|.                                  
T Consensus       106 -----~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~tC~G~G~v~~~~~~g~~  180 (371)
T COG0484         106 -----RRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFF  180 (371)
T ss_pred             -----cCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcCCCCCCcCeEEEEEeeeEE
Confidence                 00112356789999999999999999999999999886551                                  


Q ss_pred             -----------------------CCce-eeeceEEEEEeCCCCCCCcEEEEcccCCCCC-CCCCCcEEEEEeecCCCCcc
Q psy7265         206 -----------------------DGTS-KKEDKVLTINVKPGWKAGTKITFQKEGDQGK-NKIPADIVFIIRDKPHPLFK  260 (352)
Q Consensus       206 -----------------------~G~~-~~~~~~~~V~Ip~G~~~G~~i~~~g~G~~~~-~~~~GDL~v~i~v~~h~~f~  260 (352)
                                             +|.+ +.+.++++|+||||+.+|++|++.|+|++++ ++.+|||||+|.|++|+.|.
T Consensus       181 ~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~F~  260 (371)
T COG0484         181 SFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPIFE  260 (371)
T ss_pred             EEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCCCCCCCccEEEEEEeecCCCeE
Confidence                                   1222 5667899999999999999999999999997 46689999999999999999


Q ss_pred             ccCCCceEEEEeCHHHHhcCCeEEEeCCCCcEEEEeecCCccccCcEEEEcCCCcCCCCCCCCCCCEEEEEEEECCCCCC
Q psy7265         261 REGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLS  340 (352)
Q Consensus       261 R~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~~~v~~i~~~~~~g~~~ri~g~G~p~~~~~~~~Gdl~v~~~v~~P~~l~  340 (352)
                      |+|+||+++++||+.+|+||+++.|+||||+ ++| +||+++++|+++||+|+|||..++ ..+|||||+|+|++|++|+
T Consensus       261 R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l-~ip~Gtq~G~~~rl~gkG~p~~~~-~~~GDl~v~v~v~~P~~ls  337 (371)
T COG0484         261 RDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKL-KIPAGTQTGEVFRLRGKGMPKLRS-GGRGDLYVRVKVETPKNLS  337 (371)
T ss_pred             ECCCceEeccccCHHHHhcCCEEEEEecCCC-EEE-ecCCCCccCcEEEEcCCCccccCC-CCcCCEEEEEEEEcCCCCC
Confidence            9999999999999999999999999999999 999 999999999999999999998665 4679999999999999999


Q ss_pred             HHHHHHHHhhC
Q psy7265         341 QQTKDILYDLL  351 (352)
Q Consensus       341 ~~q~~~l~~~l  351 (352)
                      .+|+++|++|.
T Consensus       338 ~~q~~lL~~~~  348 (371)
T COG0484         338 DEQKELLEEFA  348 (371)
T ss_pred             HHHHHHHHHHH
Confidence            99999999985

>PRK14288 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14296 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PTZ00037 DnaJ_C chaperone protein; Provisional	Back alignment and domain information

>PRK14286 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14278 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14279 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14285 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14298 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14276 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14287 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14280 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14281 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14295 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14277 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14284 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14297 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14291 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14299 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14301 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14282 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14300 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14294 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14290 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK10767 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14283 chaperone protein DnaJ; Provisional	Back alignment and domain information

>TIGR02349 DnaJ_bact chaperone protein DnaJ	Back alignment and domain information

>PRK14293 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK10266 curved DNA-binding protein CbpA; Provisional	Back alignment and domain information

>PRK14292 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14289 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG0712\|consensus	Back alignment and domain information

>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ	Back alignment and domain information

>KOG0713\|consensus	Back alignment and domain information

>KOG0715\|consensus	Back alignment and domain information

>KOG0714\|consensus	Back alignment and domain information

>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress	Back alignment and domain information

>KOG0716\|consensus	Back alignment and domain information

>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional	Back alignment and domain information

>KOG0718\|consensus	Back alignment and domain information

>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0717\|consensus	Back alignment and domain information

>KOG0691\|consensus	Back alignment and domain information

>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG0719\|consensus	Back alignment and domain information

>PHA03102 Small T antigen; Reviewed	Back alignment and domain information

>smart00271 DnaJ DnaJ molecular chaperone homology domain	Back alignment and domain information

>cd06257 DnaJ DnaJ domain or J-domain	Back alignment and domain information

>KOG0721\|consensus	Back alignment and domain information

>PRK01356 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>KOG0722\|consensus	Back alignment and domain information

>PRK05014 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PRK03578 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>PRK00294 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>KOG0720\|consensus	Back alignment and domain information

>PTZ00100 DnaJ chaperone protein; Provisional	Back alignment and domain information

>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional	Back alignment and domain information

>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>PRK14282 chaperone protein DnaJ; Provisional	Back alignment and domain information

>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14290 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14294 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14299 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14285 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK01773 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>PRK10767 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14298 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14284 chaperone protein DnaJ; Provisional	Back alignment and domain information

>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB	Back alignment and domain information

>PRK14287 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14300 chaperone protein DnaJ; Provisional	Back alignment and domain information

>TIGR02349 DnaJ_bact chaperone protein DnaJ	Back alignment and domain information

>PRK14301 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14288 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14279 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14295 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14286 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14293 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK10266 curved DNA-binding protein CbpA; Provisional	Back alignment and domain information

>PRK14291 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14276 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14281 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14280 chaperone protein DnaJ; Provisional	Back alignment and domain information

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14297 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14278 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14292 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14296 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14277 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PTZ00037 DnaJ_C chaperone protein; Provisional	Back alignment and domain information

>PRK14283 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG1150\|consensus	Back alignment and domain information

>PRK14289 chaperone protein DnaJ; Provisional	Back alignment and domain information

>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ	Back alignment and domain information

>KOG0568\|consensus	Back alignment and domain information

>KOG1789\|consensus	Back alignment and domain information

>KOG0723\|consensus	Back alignment and domain information

>KOG0712\|consensus	Back alignment and domain information

>KOG3192\|consensus	Back alignment and domain information

>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) []	Back alignment and domain information

>KOG0431\|consensus	Back alignment and domain information

>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0724\|consensus	Back alignment and domain information

>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		352
3agx_A		181	DNAJ homolog subfamily B member 1; chaperone; 1.85	9e-83
2q2g_A		180	HSP40 protein, heat shock 40 kDa protein, putative	2e-81
1c3g_A		170	Heat shock protein 40; beta sheets, short helices,	2e-78
3lz8_A		329	Putative chaperone DNAJ; structure genomics, struc	9e-77
1hdj_A		77	Human HSP40, HDJ-1; molecular chaperone; NMR {Homo	5e-48
2lgw_A		99	DNAJ homolog subfamily B member 2; J domain, HSJ1A	7e-44
2ctw_A		109	DNAJ homolog subfamily C member 5; J-domain, chape	6e-43
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	5e-42
2dmx_A		92	DNAJ homolog subfamily B member 8; DNAJ J domain,	5e-42
1nlt_A		248	Protein YDJ1, mitochondrial protein import protein	6e-42
1nlt_A		248	Protein YDJ1, mitochondrial protein import protein	4e-04
2cug_A		88	Mkiaa0962 protein; DNAJ-like domain, structural ge	4e-41
2l6l_A		155	DNAJ homolog subfamily C member 24; DPH4, Zn-CSL,	2e-40
2ctp_A		78	DNAJ homolog subfamily B member 12; J-domain, chap	2e-40
2ej7_A		82	HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati	5e-40
2ctr_A		88	DNAJ homolog subfamily B member 9; J-domain, chape	3e-39
2o37_A		92	Protein SIS1; HSP40, J-domain, cochaperone, APC900	9e-39
2och_A		73	Hypothetical protein DNJ-12; HSP40, J-domain, chap	3e-38
2yua_A		99	Williams-beuren syndrome chromosome region 18 prot	2e-37
2dn9_A		79	DNAJ homolog subfamily A member 3; J-domain, TID1,	1e-36
2ctq_A		112	DNAJ homolog subfamily C member 12; J-domain, chap	1e-36
1bq0_A		103	DNAJ, HSP40; chaperone, heat shock, protein foldin	2e-36
1wjz_A		94	1700030A21RIK protein; J-domain, DNAJ like protein	1e-35
2qsa_A		109	DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s	3e-35
2ys8_A		90	RAB-related GTP-binding protein RABJ; DNAJ domain,	3e-33
1iur_A		88	KIAA0730 protein; DNAJ like domain, riken structur	3e-33
1xao_A		121	YDJ1, mitochondrial protein import protein MAS5; b	2e-31
2pf4_E		174	Small T antigen; PP2A, SV40, DNAJ, aalpha subunit,	2e-31
1gh6_A		114	Large T antigen; tumor suppressor, oncoprotein, an	3e-31
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	5e-25
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	5e-24
3uo3_A		181	J-type CO-chaperone JAC1, mitochondrial; structura	3e-19
3hho_A		174	CO-chaperone protein HSCB homolog; structural geno	2e-18
1n4c_A		182	Auxilin; four helix bundle, protein binding; NMR {	3e-18
1fpo_A		171	HSC20, chaperone protein HSCB; molecular chaperone	5e-18
1faf_A		79	Large T antigen; J domain, HPD motif, anti-paralle	2e-16
2guz_A		71	Mitochondrial import inner membrane translocase su	2e-14
3bvo_A		207	CO-chaperone protein HSCB, mitochondrial precurso;	2e-14
3i38_A		109	Putative chaperone DNAJ; structural genomics, prot	6e-14
2qwo_B		92	Putative tyrosine-protein phosphatase auxilin; cha	5e-13
3ag7_A		106	Putative uncharacterized protein F9E10.5; J-domain	6e-12

>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181	Back alignment and structure

 Score =  248 bits (635), Expect = 9e-83
 Identities = 98/180 (54%), Positives = 133/180 (73%), Gaps = 2/180 (1%)

Query: 174 DNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDG-TSKKEDKVLTINVKPGWKAGTKITF 232
           D  + HDL V+LE+I  GCTKKMKIS K L PDG + + EDK+LTI VK GWK GTKITF
Sbjct: 2   DPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITF 61

Query: 233 QKEGDQGKNKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEK 292
            KEGDQ  N IPADIVF+++DKPH +FKR+GSD+ Y A++SLREAL GC + VPTL G  
Sbjct: 62  PKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT 121

Query: 293 VNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPDTLSQQTKDILYDLLP 352
           + +    ++I+    +K+PG+GLP PK P+K+GDL++ F++ FP+ + Q ++ +L  +LP
Sbjct: 122 IPVV-FKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLP 180

PyMOL of 3agx

>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180	Back alignment and structure

>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170	Back alignment and structure

>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329	Back alignment and structure

>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77	Back alignment and structure

>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210	Back alignment and structure

>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248	Back alignment and structure

>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248	Back alignment and structure

>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88	Back alignment and structure

>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155	Back alignment and structure

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78	Back alignment and structure

>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82	Back alignment and structure

>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92	Back alignment and structure

>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73	Back alignment and structure

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79	Back alignment and structure

>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112	Back alignment and structure

>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103	Back alignment and structure

>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94	Back alignment and structure

>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109	Back alignment and structure

>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90	Back alignment and structure

>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88	Back alignment and structure

>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121	Back alignment and structure

>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174	Back alignment and structure

>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780	Back alignment and structure

>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181	Back alignment and structure

>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182	Back alignment and structure

>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171	Back alignment and structure

>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79	Back alignment and structure

>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71	Back alignment and structure

>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207	Back alignment and structure

>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109	Back alignment and structure

>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92	Back alignment and structure

>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		352
3lz8_A		329	Putative chaperone DNAJ; structure genomics, struc	100.0
3agx_A		181	DNAJ homolog subfamily B member 1; chaperone; 1.85	100.0
2q2g_A		180	HSP40 protein, heat shock 40 kDa protein, putative	100.0
1c3g_A		170	Heat shock protein 40; beta sheets, short helices,	100.0
1nlt_A		248	Protein YDJ1, mitochondrial protein import protein	100.0
3i38_A		109	Putative chaperone DNAJ; structural genomics, prot	99.93
1xao_A		121	YDJ1, mitochondrial protein import protein MAS5; b	99.92
1hdj_A		77	Human HSP40, HDJ-1; molecular chaperone; NMR {Homo	99.9
1bq0_A		103	DNAJ, HSP40; chaperone, heat shock, protein foldin	99.89
2ctr_A		88	DNAJ homolog subfamily B member 9; J-domain, chape	99.86
2dn9_A		79	DNAJ homolog subfamily A member 3; J-domain, TID1,	99.86
2cug_A		88	Mkiaa0962 protein; DNAJ-like domain, structural ge	99.86
2ctp_A		78	DNAJ homolog subfamily B member 12; J-domain, chap	99.85
2o37_A		92	Protein SIS1; HSP40, J-domain, cochaperone, APC900	99.85
2ej7_A		82	HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati	99.85
2och_A		73	Hypothetical protein DNJ-12; HSP40, J-domain, chap	99.84
2lgw_A		99	DNAJ homolog subfamily B member 2; J domain, HSJ1A	99.84
2dmx_A		92	DNAJ homolog subfamily B member 8; DNAJ J domain,	99.84
2ctq_A		112	DNAJ homolog subfamily C member 12; J-domain, chap	99.83
2ctw_A		109	DNAJ homolog subfamily C member 5; J-domain, chape	99.82
2yua_A		99	Williams-beuren syndrome chromosome region 18 prot	99.81
1wjz_A		94	1700030A21RIK protein; J-domain, DNAJ like protein	99.8
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	99.78
2qsa_A		109	DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s	99.78
2ys8_A		90	RAB-related GTP-binding protein RABJ; DNAJ domain,	99.76
2l6l_A		155	DNAJ homolog subfamily C member 24; DPH4, Zn-CSL,	99.73
1gh6_A		114	Large T antigen; tumor suppressor, oncoprotein, an	99.72
1faf_A		79	Large T antigen; J domain, HPD motif, anti-paralle	99.72
2pf4_E		174	Small T antigen; PP2A, SV40, DNAJ, aalpha subunit,	99.7
1iur_A		88	KIAA0730 protein; DNAJ like domain, riken structur	99.69
3hho_A		174	CO-chaperone protein HSCB homolog; structural geno	99.68
1n4c_A		182	Auxilin; four helix bundle, protein binding; NMR {	99.66
1fpo_A		171	HSC20, chaperone protein HSCB; molecular chaperone	99.66
3bvo_A		207	CO-chaperone protein HSCB, mitochondrial precurso;	99.64
2qwo_B		92	Putative tyrosine-protein phosphatase auxilin; cha	99.64
3ag7_A		106	Putative uncharacterized protein F9E10.5; J-domain	99.61
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	99.61
3uo3_A		181	J-type CO-chaperone JAC1, mitochondrial; structura	99.6
2guz_A		71	Mitochondrial import inner membrane translocase su	99.6
3i38_A		109	Putative chaperone DNAJ; structural genomics, prot	99.37
1xao_A		121	YDJ1, mitochondrial protein import protein MAS5; b	99.33
3agx_A		181	DNAJ homolog subfamily B member 1; chaperone; 1.85	99.09
1c3g_A		170	Heat shock protein 40; beta sheets, short helices,	99.08
2q2g_A		180	HSP40 protein, heat shock 40 kDa protein, putative	99.07
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.03
1nlt_A		248	Protein YDJ1, mitochondrial protein import protein	99.01
3lz8_A		329	Putative chaperone DNAJ; structure genomics, struc	98.93
2guz_B		65	Mitochondrial import inner membrane translocase su	98.79
2ctt_A		104	DNAJ homolog subfamily A member 3; ZING finger, be	92.09

>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A	Back alignment and structure

Probab=100.00  E-value=5.1e-67  Score=499.34  Aligned_cols=283  Identities=30%  Similarity=0.477  Sum_probs=161.6

Q ss_pred             CCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHHHhccChhhhhhhcccCcccCCCCCCC-CCC
Q psy7265           3 KNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSREAEEKFKEVAEAYEVLSDKKKRDLYDRYGEDGLKSGGPG-LHT   81 (352)
Q Consensus         3 ~~~y~iLgv~~~a~~~~Ik~ayr~la~~~hPd~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~yD~~G~~~~~~~~~~-~~~   81 (352)
                      +|||+||||+++|+.+|||+|||+||++||||+|+++.|+++|++|++||++|+||.+|+.||+|+......+..+ +..
T Consensus        28 ~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~~  107 (329)
T 3lz8_A           28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQT  107 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccccccc
Confidence            7999999999999999999999999999999999888889999999999999999999999999965422111100 000


Q ss_pred             CCCCCccccCCCchhhhhcccCCCCCCCCcccCCCCCCCCCCCcccCCCCCCCccccccCCCCCCCCCCCCCcccccccc
Q psy7265          82 GGTENFTSFHGDPRATFAQFFGSSSPFGAFFEFPGSGGRGGPGFQFGMDEDMDTDDIFSMGGPRAGGPGGGAFRSQSFNI  161 (352)
Q Consensus        82 ~~~~~~~~~~~~~~~~f~~~fg~~~~f~~~f~~~~~~~~~g~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~  161 (352)
                      .+ ++|.  ..++.|+|++|||+.                +                            .+.        
T Consensus       108 ~~-~~f~--~~~f~diF~~~Fg~~----------------g----------------------------~~~--------  132 (329)
T 3lz8_A          108 HE-QSYS--QQDFDDIFSSMFGQQ----------------A----------------------------HQR--------  132 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cc-CCcC--CCchhhhhHhhhcCc----------------C----------------------------CCC--------
Confidence            00 0000  012223333333210                0                            000        


Q ss_pred             CCCCCCCCCccCCCCeEEEEEeehhhhccCceEEEEEEEEeecCCCce-eeeceEEEEEeCCCCCCCcEEEEcccCCCCC
Q psy7265         162 HGSPNRAKDKVQDNAIEHDLYVTLEDIVRGCTKKMKISRKVLQPDGTS-KKEDKVLTINVKPGWKAGTKITFQKEGDQGK  240 (352)
Q Consensus       162 ~~~~~~~~~~~~g~di~~~l~itlee~~~G~~~~i~~~~~~~~~~G~~-~~~~~~~~V~Ip~G~~~G~~i~~~g~G~~~~  240 (352)
                           +....+++.|+.++|.|||+|+|.||++.+.+.+.++|+.|.. +.+.++++|+||||+++|++|+|+|+|++.+
T Consensus       133 -----~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~g~G~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~  207 (329)
T 3lz8_A          133 -----RRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYNVFGMIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGE  207 (329)
T ss_dssp             ---------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECCSCC-CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC-
T ss_pred             -----CCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeecCCeEEEEecceEEEEeCCCCCCCCCEEEEcccccCCC
Confidence                 0011346889999999999999999999999999999888876 3336789999999999999999999999986


Q ss_pred             -CCCCCcEEEEEeecCCCCccccCCCceEEEEeCHHHHhcCCeEEEeCCCCcEEEEeecCCccccCcEEEEcCCCcCCCC
Q psy7265         241 -NKIPADIVFIIRDKPHPLFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPK  319 (352)
Q Consensus       241 -~~~~GDL~v~i~v~~h~~f~R~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~~~v~~i~~~~~~g~~~ri~g~G~p~~~  319 (352)
                       ++.+|||+|+|+|+||+.|+|+|+||+++++|||+||++|+++.|+||||+ +.| +||+++++|+++||+|+|||.. 
T Consensus       208 ~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l-~ip~gt~~g~~~rl~G~GmP~~-  284 (329)
T 3lz8_A          208 NGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILL-TVPPGSQAGQRLRIKGKGLVSK-  284 (329)
T ss_dssp             --CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEE-EECTTCCTTCEEEETTCSCBCS-
T ss_pred             CCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEE-EECCCCCCCCEEEEcCCCCCCC-
Confidence             467999999999999999999999999999999999999999999999997 688 8999999999999999999975 


Q ss_pred             CCCCCCCEEEEEEEECCCCCCHHHHHHHHhh
Q psy7265         320 EPQKKGDLLVSFDIKFPDTLSQQTKDILYDL  350 (352)
Q Consensus       320 ~~~~~Gdl~v~~~v~~P~~l~~~q~~~l~~~  350 (352)
                        +.+|||||+|+|.||+.||++|+++|+++
T Consensus       285 --~~rGDL~v~~~V~~P~~l~~~q~~~l~~~  313 (329)
T 3lz8_A          285 --THTGDLFAVIKIVMPTKPDEKARELWQQL  313 (329)
T ss_dssp             --SCBCCEEEEEEECCCSSCCHHHHHHHHHH
T ss_pred             --CCCCCEEEEEEEECCCCCCHHHHHHHHHH
Confidence              36899999999999999999999999986

PyMOL of 3lz8

>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A	Back alignment and structure

>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II}	Back alignment and structure

>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A	Back alignment and structure

>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1	Back alignment and structure

>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae}	Back alignment and structure

>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1	Back alignment and structure

>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A	Back alignment and structure

>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae}	Back alignment and structure

>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A	Back alignment and structure

>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus}	Back alignment and structure

>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans}	Back alignment and structure

>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1	Back alignment and structure

>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1	Back alignment and structure

>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C	Back alignment and structure

>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1	Back alignment and structure

>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J	Back alignment and structure

>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1	Back alignment and structure

>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens}	Back alignment and structure

>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A	Back alignment and structure

>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A	Back alignment and structure

>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae}	Back alignment and structure

>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A	Back alignment and structure

>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A	Back alignment and structure

>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1	Back alignment and structure

>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A	Back alignment and structure

>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		352
d1hdja_		77	a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9	8e-28
d1xbla_		75	a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain	2e-24
d1wjza_		94	a.2.3.1 (A:) CSL-type zinc finger-containing prote	7e-22
d1nz6a_		98	a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T	6e-21
d1iura_		88	a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human	4e-20
d1c3ga1		80	b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba	4e-20
d1c3ga2		90	b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba	2e-19
d1fpoa1		76	a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma	3e-19
d1gh6a_		114	a.2.3.1 (A:) Large T antigen, the N-terminal J dom	8e-19
d1fafa_		79	a.2.3.1 (A:) Large T antigen, the N-terminal J dom	5e-18
d1nlta2		80	b.4.1.1 (A:258-337) Mitochondrial protein import p	4e-16
d1nlta1		74	b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei	9e-12

>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77	Back information, alignment and structure


class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  101 bits (253), Expect = 8e-28
 Identities = 53/76 (69%), Positives = 66/76 (86%)

Query: 1  MGKNYYAILGLNKGASDDEIKKAYRKLALKYHPDKNKSREAEEKFKEVAEAYEVLSDKKK 60
          MGK+YY  LGL +GASD+EIK+AYR+ AL+YHPDKNK   AEEKFKE+AEAY+VLSD +K
Sbjct: 1  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK 60

Query: 61 RDLYDRYGEDGLKSGG 76
          R+++DRYGE+GLK  G
Sbjct: 61 REIFDRYGEEGLKGSG 76

PyMOL of d1hdja_

>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75	Back information, alignment and structure

>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94	Back information, alignment and structure

>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98	Back information, alignment and structure

>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80	Back information, alignment and structure

>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90	Back information, alignment and structure

>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76	Back information, alignment and structure

>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114	Back information, alignment and structure

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79	Back information, alignment and structure

>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80	Back information, alignment and structure

>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		352
d1c3ga2		90	Heat shock protein 40 Sis1 {Baker's yeast (Sacchar	99.92
d1hdja_		77	HSP40 {Human (Homo sapiens) [TaxId: 9606]}	99.91
d1xbla_		75	DnaJ chaperone, N-terminal (J) domain {Escherichia	99.9
d1nlta2		80	Mitochondrial protein import protein mas5 (Hsp40,	99.85
d1wjza_		94	CSL-type zinc finger-containing protein 3 (J-domai	99.83
d1gh6a_		114	Large T antigen, the N-terminal J domain {Simian v	99.8
d1nlta1		74	Mitochondrial protein import protein mas5 (Hsp40,	99.77
d1c3ga1		80	Heat shock protein 40 Sis1 {Baker's yeast (Sacchar	99.75
d1fafa_		79	Large T antigen, the N-terminal J domain {Murine p	99.71
d1fpoa1		76	HSC20 (HSCB), N-terminal (J) domain {Escherichia c	99.69
d1iura_		88	Hypothetical protein KIAA0730 {Human (Homo sapiens	99.66
d1nz6a_		98	Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}	99.64
d1nlta1		74	Mitochondrial protein import protein mas5 (Hsp40,	99.37
d1c3ga2		90	Heat shock protein 40 Sis1 {Baker's yeast (Sacchar	99.34
d1nlta2		80	Mitochondrial protein import protein mas5 (Hsp40,	99.22
d1c3ga1		80	Heat shock protein 40 Sis1 {Baker's yeast (Sacchar	98.89

>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: All beta proteins
fold: HSP40/DnaJ peptide-binding domain
superfamily: HSP40/DnaJ peptide-binding domain
family: HSP40/DnaJ peptide-binding domain
domain: Heat shock protein 40 Sis1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.92  E-value=2e-26  Score=177.44  Aligned_cols=90  Identities=33%  Similarity=0.676  Sum_probs=85.8

Q ss_pred             CccccCCCceEEEEeCHHHHhcCCeEEEeCCCCcEEEEeecCCccccCcEEEEcCCCcCCCCCCCCCCCEEEEEEEECCC
Q psy7265         258 LFKREGSDLRYTAKVSLREALTGCVLTVPTLTGEKVNLNLKNEIIKTNTVKKIPGQGLPFPKEPQKKGDLLVSFDIKFPD  337 (352)
Q Consensus       258 ~f~R~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~~~v~~i~~~~~~g~~~ri~g~G~p~~~~~~~~Gdl~v~~~v~~P~  337 (352)
                      .|+|+|+||+++++||++||++|+++.|+|+||+.+.| ++|+++++|++++|+|+|||..++++.+|||||+|+|.+|+
T Consensus         1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i-~ip~~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P~   79 (90)
T d1c3ga2           1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL-SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPI   79 (90)
T ss_dssp             SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEE-EESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCCS
T ss_pred             CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceec-ccccccccccccccCCCCCCcCCCCCCcCCEEEEEEEEcCC
Confidence            49999999999999999999999999999999999999 89999999999999999999887777899999999999999


Q ss_pred             CCCHHHHHHHH
Q psy7265         338 TLSQQTKDILY  348 (352)
Q Consensus       338 ~l~~~q~~~l~  348 (352)
                      +||++|+++|+
T Consensus        80 ~ls~~qk~~lE   90 (90)
T d1c3ga2          80 SLNDAQKRAID   90 (90)
T ss_dssp             SCCTTHHHHTC
T ss_pred             CCCHHHHHhhC
Confidence            99999999874

PyMOL of d1c3ga2

>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}	Back information, alignment and structure

>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}	Back information, alignment and structure

>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure