Psyllid ID: psy7275


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQHFALPTPQPLWASCDRGNCNLPTDKVPKTKGRKTV
cccccccEEEEEEcccccccHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHcHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
cccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
mydtgfpytELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVgfssvsgegTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREqhfalptpqplwascdrgncnlptdkvpktkgrktv
mydtgfpytELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQhfalptpqplwascdrgncnlptdkvpktkgrktv
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQHFALPTPQPLWASCDRGNCNLPTDKVPKTKGRKTV
****GFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLR***********************LWASC*********************
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEA*SSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEW*****************************************************
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQHFALPTPQPLWASCDRGNCNLPTDKV*********
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSE******************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQHFALPTPQPLWASCDRGNCNLPTDKVPKTKGRKTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
UNIPROTKB|B4DQM4388 GPN1 "cDNA FLJ61157, highly si 0.766 0.296 0.504 5e-28
UNIPROTKB|Q9HCN4374 GPN1 "GPN-loop GTPase 1" [Homo 0.766 0.307 0.504 5e-28
UNIPROTKB|H9GWN5276 LOC607762 "Uncharacterized pro 0.766 0.416 0.495 1.7e-27
UNIPROTKB|J9PBE9215 LOC607762 "Uncharacterized pro 0.766 0.534 0.495 1.7e-27
RGD|1589985373 Gpn1 "GPN-loop GTPase 1" [Ratt 0.766 0.308 0.495 1.7e-27
ZFIN|ZDB-GENE-040801-154400 zgc:100927 "zgc:100927" [Danio 0.766 0.287 0.504 2.2e-27
UNIPROTKB|F1NUD1383 XAB1 "Uncharacterized protein" 0.766 0.300 0.495 2.8e-27
UNIPROTKB|A4FUD1373 GPN1 "GPN-loop GTPase 1" [Bos 0.766 0.308 0.486 3.5e-27
UNIPROTKB|E2RNQ3390 LOC475707 "Uncharacterized pro 0.766 0.294 0.486 3.5e-27
MGI|MGI:1921504372 Gpn1 "GPN-loop GTPase 1" [Mus 0.766 0.309 0.486 3.5e-27
UNIPROTKB|B4DQM4 GPN1 "cDNA FLJ61157, highly similar to XPA-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 313 (115.2 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 58/115 (50%), Positives = 83/115 (72%)

Query:     1 MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYS 60
             +Y T  P+  ++   DI++H +A+EWMQDFE FQ+AL  +++Y+SNLTRSMSL LDEFYS
Sbjct:   191 LYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYS 250

Query:    61 TLKVVGFSSVSGEGTEELLQLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQ 115
             +L+VVG S+V G G +EL   +  A E+YE+ YR E+ RL+   A +E  ++REQ
Sbjct:   251 SLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQ 305




GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
UNIPROTKB|Q9HCN4 GPN1 "GPN-loop GTPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9GWN5 LOC607762 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBE9 LOC607762 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1589985 Gpn1 "GPN-loop GTPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-154 zgc:100927 "zgc:100927" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUD1 XAB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUD1 GPN1 "GPN-loop GTPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNQ3 LOC475707 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921504 Gpn1 "GPN-loop GTPase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
pfam03029235 pfam03029, ATP_bind_1, Conserved hypothetical ATP 8e-14
PRK13768253 PRK13768, PRK13768, GTPase; Provisional 0.001
>gnl|CDD|217326 pfam03029, ATP_bind_1, Conserved hypothetical ATP binding protein Back     alignment and domain information
 Score = 65.8 bits (161), Expect = 8e-14
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 1   MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYS 60
           M   G P+   +   D+++ ++A++W  D +  Q  LE D S    L  ++  ALD FY 
Sbjct: 151 MLRLGLPFVVALNKFDLLSLEFALKWFTDPDDLQLLLELDPSK---LNEAIREALDLFYL 207

Query: 61  TLKVVGFSSVSGEGTEELLQLI 82
             + +  +  +GE  E+LL LI
Sbjct: 208 VPRFLPDARETGESMEDLLTLI 229


Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity. Length = 235

>gnl|CDD|237498 PRK13768, PRK13768, GTPase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG1532|consensus366 100.0
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.22
PRK13768253 GTPase; Provisional 98.73
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.57
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.51
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.43
PRK00089292 era GTPase Era; Reviewed 98.41
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.4
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.36
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.36
PRK14845 1049 translation initiation factor IF-2; Provisional 98.34
PRK04213201 GTP-binding protein; Provisional 98.32
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.31
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.3
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.29
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.29
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.28
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 98.27
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.25
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.24
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.22
PRK12289 352 GTPase RsgA; Reviewed 98.21
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.21
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.21
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.21
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.2
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.2
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.2
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.18
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.17
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.16
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.15
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.15
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.14
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.14
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.13
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.13
PRK12298390 obgE GTPase CgtA; Reviewed 98.12
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.12
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.12
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.11
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.11
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.1
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.09
cd00881189 GTP_translation_factor GTP translation factor fami 98.09
PRK15494339 era GTPase Era; Provisional 98.09
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.08
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.08
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.08
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.08
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.08
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.08
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.07
PRK04004 586 translation initiation factor IF-2; Validated 98.07
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.06
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.06
PRK00093435 GTP-binding protein Der; Reviewed 98.05
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.05
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.05
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.04
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.04
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 98.04
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.04
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.03
COG1159298 Era GTPase [General function prediction only] 98.03
PRK12296500 obgE GTPase CgtA; Reviewed 98.03
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.03
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.02
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.01
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.01
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.01
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.01
PRK03003472 GTP-binding protein Der; Reviewed 98.0
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.0
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.0
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.0
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.0
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.0
PRK12299335 obgE GTPase CgtA; Reviewed 97.99
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.99
PRK12288347 GTPase RsgA; Reviewed 97.99
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.99
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.99
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.99
PTZ00099176 rab6; Provisional 97.98
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.98
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.98
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.98
PRK09435332 membrane ATPase/protein kinase; Provisional 97.98
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.98
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.98
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.98
PRK00454196 engB GTP-binding protein YsxC; Reviewed 97.97
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.97
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.97
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.97
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.96
PLN00223181 ADP-ribosylation factor; Provisional 97.96
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.96
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.95
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.95
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.95
COG2262411 HflX GTPases [General function prediction only] 97.95
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.94
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.94
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.94
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.93
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.93
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.92
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 97.92
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.91
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 97.91
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.9
PRK12297424 obgE GTPase CgtA; Reviewed 97.9
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.9
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.9
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.9
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.9
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.9
PRK00098298 GTPase RsgA; Reviewed 97.9
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 97.89
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.89
cd01896233 DRG The developmentally regulated GTP-binding prot 97.89
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 97.89
PTZ00369189 Ras-like protein; Provisional 97.89
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.89
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 97.88
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 97.87
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.87
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 97.87
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.87
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.87
PRK09563 287 rbgA GTPase YlqF; Reviewed 97.86
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.86
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.86
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.84
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.84
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.83
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.83
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.82
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.82
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 97.82
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.81
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.81
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.8
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.8
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.8
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 97.76
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.76
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.76
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 97.75
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.75
cd00154159 Rab Rab family. Rab GTPases form the largest famil 97.75
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.75
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.75
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.75
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.75
PLN03110216 Rab GTPase; Provisional 97.74
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 97.73
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.73
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.73
PTZ00133182 ADP-ribosylation factor; Provisional 97.72
COG0536369 Obg Predicted GTPase [General function prediction 97.72
KOG1489|consensus366 97.71
COG1160444 Predicted GTPases [General function prediction onl 97.71
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.71
PRK04000 411 translation initiation factor IF-2 subunit gamma; 97.7
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.7
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.69
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.69
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.69
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.67
KOG1145|consensus 683 97.65
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 97.64
PRK05306 787 infB translation initiation factor IF-2; Validated 97.62
PRK11058426 GTPase HflX; Provisional 97.61
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.61
PLN03118211 Rab family protein; Provisional 97.6
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.58
CHL00189 742 infB translation initiation factor 2; Provisional 97.55
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 97.54
PRK01889356 GTPase RsgA; Reviewed 97.54
PLN03108210 Rab family protein; Provisional 97.53
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.53
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.53
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.53
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.52
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.52
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 97.51
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 97.5
COG1160 444 Predicted GTPases [General function prediction onl 97.49
COG0486454 ThdF Predicted GTPase [General function prediction 97.49
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.48
PRK13796 365 GTPase YqeH; Provisional 97.46
PRK03003 472 GTP-binding protein Der; Reviewed 97.45
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 97.43
PRK12736 394 elongation factor Tu; Reviewed 97.41
PRK05433 600 GTP-binding protein LepA; Provisional 97.38
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.35
KOG0462|consensus 650 97.34
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.34
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.34
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.33
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 97.28
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 97.27
PRK00093 435 GTP-binding protein Der; Reviewed 97.25
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.25
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.23
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 97.22
COG1162301 Predicted GTPases [General function prediction onl 97.18
PRK09866 741 hypothetical protein; Provisional 97.18
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.16
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.15
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.12
COG0218200 Predicted GTPase [General function prediction only 97.08
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 97.07
PRK12317 425 elongation factor 1-alpha; Reviewed 97.07
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.05
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.04
COG5258 527 GTPBP1 GTPase [General function prediction only] 97.03
COG1163365 DRG Predicted GTPase [General function prediction 97.02
PLN00043 447 elongation factor 1-alpha; Provisional 97.02
PTZ00141 446 elongation factor 1- alpha; Provisional 96.97
KOG1144|consensus 1064 96.95
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 96.93
PRK12735 396 elongation factor Tu; Reviewed 96.92
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 96.92
CHL00071 409 tufA elongation factor Tu 96.92
KOG0092|consensus200 96.91
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 96.89
KOG1423|consensus379 96.86
TIGR00485 394 EF-Tu translation elongation factor TU. This align 96.82
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 96.8
PRK00049 396 elongation factor Tu; Reviewed 96.79
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 96.74
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 96.68
PLN03127 447 Elongation factor Tu; Provisional 96.6
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 96.58
PLN03126 478 Elongation factor Tu; Provisional 96.53
PRK10218 607 GTP-binding protein; Provisional 96.49
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 96.43
COG3276 447 SelB Selenocysteine-specific translation elongatio 96.42
PRK09602396 translation-associated GTPase; Reviewed 96.38
KOG0078|consensus207 96.3
COG1161 322 Predicted GTPases [General function prediction onl 96.28
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 96.19
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.09
PRK12740 668 elongation factor G; Reviewed 95.96
KOG0461|consensus 522 95.83
KOG0094|consensus221 95.76
cd04105203 SR_beta Signal recognition particle receptor, beta 95.66
KOG0394|consensus210 95.58
KOG0093|consensus193 95.58
PRK13351 687 elongation factor G; Reviewed 95.54
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 95.51
KOG0076|consensus197 95.49
KOG0395|consensus196 95.39
COG2229187 Predicted GTPase [General function prediction only 95.26
KOG0073|consensus185 95.24
KOG0088|consensus218 95.24
KOG0084|consensus205 95.2
KOG0072|consensus182 95.12
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 95.08
KOG1143|consensus 591 95.01
PRK00741 526 prfC peptide chain release factor 3; Provisional 94.9
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 94.65
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 94.44
COG1084346 Predicted GTPase [General function prediction only 94.4
PRK12739 691 elongation factor G; Reviewed 94.35
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 94.16
PRK00007 693 elongation factor G; Reviewed 94.13
COG1100219 GTPase SAR1 and related small G proteins [General 93.9
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 93.89
KOG4252|consensus246 93.81
COG1217 603 TypA Predicted membrane GTPase involved in stress 93.46
KOG0086|consensus214 93.28
KOG0098|consensus216 93.17
KOG0458|consensus 603 93.06
KOG0087|consensus222 92.66
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 92.53
KOG1490|consensus 620 92.49
TIGR00503 527 prfC peptide chain release factor 3. This translat 91.98
KOG0081|consensus219 91.97
KOG0466|consensus 466 91.88
KOG1487|consensus358 91.4
COG4917148 EutP Ethanolamine utilization protein [Amino acid 91.37
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 91.01
KOG1191|consensus531 90.81
KOG1424|consensus 562 90.2
KOG0410|consensus410 90.09
KOG0079|consensus198 89.63
KOG0070|consensus181 89.19
KOG0075|consensus186 89.04
KOG0091|consensus213 88.65
KOG3905|consensus 473 88.46
KOG1707|consensus 625 88.18
KOG0083|consensus192 88.11
KOG0393|consensus198 87.63
PRK07560 731 elongation factor EF-2; Reviewed 86.73
KOG0463|consensus 641 86.49
KOG0090|consensus238 85.88
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 85.8
KOG2484|consensus 435 85.62
KOG0097|consensus215 84.86
KOG2486|consensus320 83.14
KOG2485|consensus 335 81.81
PF08438109 MMR_HSR1_C: GTPase of unknown function C-terminal; 81.65
COG0050 394 TufB GTPases - translation elongation factors [Tra 80.59
>KOG1532|consensus Back     alignment and domain information
Probab=100.00  E-value=3.7e-39  Score=270.44  Aligned_cols=128  Identities=40%  Similarity=0.689  Sum_probs=125.4

Q ss_pred             CCCCCCCEEEeeecCCCCCchhhHHHhhcHHHHHHHHhh-chhhhhhhHHHHHHHHHHhhcCCcEEEeecCCCCCHHHHH
Q psy7275           1 MYDTGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEA-DSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELL   79 (150)
Q Consensus         1 lyk~~lP~IlV~NKiDl~~~~~~~ewm~D~e~f~eal~~-e~~y~~~L~~slsl~l~efy~~l~vv~VSA~TGeGideL~   79 (150)
                      |||+++|+|+||||+|+.+++|+.+||+|||+|++++.. +++|+++|++||||+|+|||+++++|+|||.||+|+++|+
T Consensus       177 lyktklp~ivvfNK~Dv~d~~fa~eWm~DfE~FqeAl~~~~~~y~s~l~~SmSL~leeFY~~lrtv~VSs~tG~G~ddf~  256 (366)
T KOG1532|consen  177 LYKTKLPFIVVFNKTDVSDSEFALEWMTDFEAFQEALNEAESSYMSNLTRSMSLMLEEFYRSLRTVGVSSVTGEGFDDFF  256 (366)
T ss_pred             HHhccCCeEEEEecccccccHHHHHHHHHHHHHHHHHHhhccchhHHhhhhHHHHHHHHHhhCceEEEecccCCcHHHHH
Confidence            799999999999999999999999999999999999996 8899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHhHhhCCCCCCCCcc
Q psy7275          80 QLIKLAGEDYEKNYRVEWIRLRDEKAKSEQLEKREQHFALPTPQPLWAS  128 (150)
Q Consensus        80 ~~I~e~~~ey~~~y~pe~e~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  128 (150)
                      .+|.+.++||.++|+|++||++++++..+++++++++++|+|||++.+-
T Consensus       257 ~av~~~vdEy~~~ykp~~Ek~k~~k~~~ee~~k~k~le~l~kdm~~~~~  305 (366)
T KOG1532|consen  257 TAVDESVDEYEEEYKPEYEKKKAEKRLAEEERKKKQLEKLMKDMHVSPL  305 (366)
T ss_pred             HHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhhhhhHHHHHhccCcccc
Confidence            9999999999999999999999999999999999999999999998876



>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PF08438 MMR_HSR1_C: GTPase of unknown function C-terminal; InterPro: IPR013646 This domain is found at the C terminus of IPR002917 from INTERPRO in archaeal and eukaryotic GTP-binding proteins Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 1e-17
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Back     alignment and structure
 Score = 76.3 bits (187), Expect = 1e-17
 Identities = 16/94 (17%), Positives = 34/94 (36%), Gaps = 6/94 (6%)

Query: 1   MYDTGFPYTELVVGIDIV---NHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDE 57
               G      +  +D++     +   ++ +D +     L+ D S    +   M   + E
Sbjct: 167 DLRLGATTIPALNKVDLLSEEEKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTE 226

Query: 58  FYSTLKVVGFSSVSGEGTEELLQLIKLA---GED 88
               ++V+  S+ + EG E+L  L         D
Sbjct: 227 VLPPVRVLYLSAKTREGFEDLETLAYEHYCTCGD 260


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.65
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.62
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.6
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.59
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.52
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.52
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.47
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.47
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.46
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.46
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.44
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.42
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.42
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.4
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.38
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.38
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.38
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.37
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.37
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.37
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.37
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.36
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.36
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.35
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.35
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.35
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.35
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.34
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.34
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.34
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.33
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.33
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.32
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.31
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.31
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.31
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.31
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.3
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.28
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.28
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.28
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.28
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.28
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.27
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.27
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.27
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.27
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.26
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.26
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.26
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.26
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.26
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.26
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.26
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.26
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.25
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.25
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.25
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.24
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.24
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.24
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.24
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.23
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.23
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.23
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.23
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.22
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.22
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.22
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.22
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.21
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.21
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.21
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.2
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.2
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.19
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.19
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.19
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.18
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 98.18
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.18
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.17
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.17
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.16
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.16
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.15
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.15
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.15
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.15
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.15
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.14
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.13
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.13
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.13
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.12
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.12
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.11
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.11
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.11
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.1
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.1
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.09
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.09
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.09
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.07
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.33
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.06
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.04
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.04
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.03
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.03
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.02
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.02
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.02
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.0
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.0
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.99
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.98
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.98
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.98
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.97
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.97
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.97
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.97
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.96
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.95
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.95
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.94
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.94
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.94
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.92
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.9
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.87
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.82
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.82
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.81
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.8
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.78
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.76
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.75
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.75
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.74
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.74
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 97.73
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.73
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.71
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.69
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 97.69
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.67
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.67
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.66
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.55
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.54
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 97.53
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.49
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.48
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.48
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.47
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.42
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.4
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 97.38
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.37
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.35
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.32
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 97.29
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.26
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 97.26
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.22
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 97.17
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.15
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.15
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.11
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.11
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.1
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 97.06
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.04
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.01
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 96.91
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.88
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.87
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 96.81
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 96.8
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.72
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 96.71
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.66
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 96.66
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.57
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.57
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 96.45
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 96.43
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 96.35
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 96.29
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.24
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 96.18
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 96.08
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 96.0
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 95.97
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 95.71
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 95.66
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 95.09
1wxq_A397 GTP-binding protein; structural genomics, riken st 94.87
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 94.81
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 94.56
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 94.5
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 93.71
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 92.97
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 92.5
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 92.46
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 92.44
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 90.15
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 83.38
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 82.9
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 80.65
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
Probab=98.65  E-value=1.9e-08  Score=73.65  Aligned_cols=64  Identities=6%  Similarity=0.099  Sum_probs=44.8

Q ss_pred             CCCCEEEeeecCCCCCchhhHHHhhcHHHHHHHHhhchhhhhhhHHHHHHHHHHhhcCCcEEEeecCCCCCHHHHHHHHH
Q psy7275           4 TGFPYTELVVGIDIVNHKYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQLIK   83 (150)
Q Consensus         4 ~~lP~IlV~NKiDl~~~~~~~ewm~D~e~f~eal~~e~~y~~~L~~slsl~l~efy~~l~vv~VSA~TGeGideL~~~I~   83 (150)
                      .++|+|+|+||+|+.+.....+..   ..+.                     ..+  +.+++.+||++|.|+++++..|.
T Consensus       108 ~~~p~i~v~nK~Dl~~~~~~~~~~---~~~~---------------------~~~--~~~~~~~Sa~~g~gi~~l~~~l~  161 (189)
T 4dsu_A          108 EDVPMVLVGNKCDLPSRTVDTKQA---QDLA---------------------RSY--GIPFIETSAKTRQGVDDAFYTLV  161 (189)
T ss_dssp             SCCCEEEEEECTTSSSCSSCHHHH---HHHH---------------------HHH--TCCEEECCTTTCTTHHHHHHHHH
T ss_pred             CCCcEEEEEECccCcccccCHHHH---HHHH---------------------HHc--CCeEEEEeCCCCCCHHHHHHHHH
Confidence            478999999999997543321111   0000                     011  46899999999999999999999


Q ss_pred             HHHHHHHhhh
Q psy7275          84 LAGEDYEKNY   93 (150)
Q Consensus        84 e~~~ey~~~y   93 (150)
                      +.+.+....+
T Consensus       162 ~~~~~~~~~~  171 (189)
T 4dsu_A          162 REIRKHKEKM  171 (189)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHhhhhc
Confidence            8886655443



>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-11
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]
 Score = 57.7 bits (138), Expect = 2e-11
 Identities = 15/86 (17%), Positives = 34/86 (39%), Gaps = 3/86 (3%)

Query: 1   MYDTGFPYTELVVGIDIVNH---KYAIEWMQDFEVFQEALEADSSYISNLTRSMSLALDE 57
               G      +  +D+++    +   ++ +D +     L+ D S    +   M   + E
Sbjct: 153 DLRLGATTIPALNKVDLLSEEEKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTE 212

Query: 58  FYSTLKVVGFSSVSGEGTEELLQLIK 83
               ++V+  S+ + EG E+L  L  
Sbjct: 213 VLPPVRVLYLSAKTREGFEDLETLAY 238


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.29
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.98
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.86
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.74
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.7
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.68
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.63
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.57
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.57
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.48
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.43
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.42
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.41
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.38
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.37
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.37
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.36
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.32
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.29
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.28
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.26
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.25
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.22
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.2
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.17
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.16
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.16
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.08
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.07
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.07
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.04
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.04
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.03
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.02
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.97
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.96
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.94
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.93
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.92
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.84
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.83
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.79
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.77
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.74
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.71
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.7
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.49
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.46
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.44
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.43
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.42
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.12
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.08
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 96.75
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.75
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.47
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.43
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.06
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.91
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.57
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.49
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.29
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 95.23
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 90.43
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 84.79
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]
Probab=99.29  E-value=4.6e-12  Score=95.86  Aligned_cols=82  Identities=18%  Similarity=0.260  Sum_probs=70.7

Q ss_pred             CCCCEEEeeecCCCCCchhhH---HHhhcHHHHHHHHhhchhhhhhhHHHHHHHHHHhhcCCcEEEeecCCCCCHHHHHH
Q psy7275           4 TGFPYTELVVGIDIVNHKYAI---EWMQDFEVFQEALEADSSYISNLTRSMSLALDEFYSTLKVVGFSSVSGEGTEELLQ   80 (150)
Q Consensus         4 ~~lP~IlV~NKiDl~~~~~~~---ewm~D~e~f~eal~~e~~y~~~L~~slsl~l~efy~~l~vv~VSA~TGeGideL~~   80 (150)
                      ..+|.|+|+||+|+.+.+...   .|.+.+..+...+.....+...+..++...+++|+..+++++|||+||+|+++|+.
T Consensus       156 ~~~~~ivvinK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~vSa~~geGi~~L~~  235 (244)
T d1yrba1         156 LGATTIPALNKVDLLSEEEKERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMMTEVLPPVRVLYLSAKTREGFEDLET  235 (244)
T ss_dssp             HTSCEEEEECCGGGCCHHHHHHHHHHHHCHHHHHHHHHHCCSHHHHHHHHHHHHHHHHSCCCCCEECCTTTCTTHHHHHH
T ss_pred             hCCCceeeeeccccccHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHhhCCCCcEEEEECCCCCCHHHHHH
Confidence            467999999999999876653   55667777777777667788889999999999999999999999999999999999


Q ss_pred             HHHHH
Q psy7275          81 LIKLA   85 (150)
Q Consensus        81 ~I~e~   85 (150)
                      +|.++
T Consensus       236 ~l~e~  240 (244)
T d1yrba1         236 LAYEH  240 (244)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            99886



>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure