Psyllid ID: psy7383

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-

MDKRKMMAKRPRMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGTLPPVQQAHSTTPHDSAIAPAPGSERGGGAPPSGSGGGGAPPSGGGPPPNTPAGLPHNLPLSTADPSNHHPPKPESSEPGVH

cccccccccccccccccccccccccccccEEEEEccccccccHHHHccccEEEEEccccHHHHHHHHHccccEEEEEccccccHHHHHcccccEEEEEEccccccccHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccHHHHHHcccEEcccHHHHHHHccEEEEcccccHHHHccccHHHHHccccccEEEEccccccccHHHHHHHHHHccEEEEEcccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccc

cccccccccccccccccccccccccccccEEEEcccccccccHHHHccccEEEEcccccHHHccHHHHHHEEEEEEcccccEcHHHHHccccccEEEEcccccccEcHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHccccEEEEEcccccccHHHHcccEEcccHHHHHHHccEEEEcccccccccccEcHHHHHHccccEEEEEcccHHHEcHHHHHHHHHHccEEEEEEccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEccccccccHcHHHcHHHHHHHHHHcccEEEEccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

mdkrkmmakrprmdsirgpisngpmqtrPLVAlldgrdcsiempilKDVATVafcdaqstsEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGsgvdnidvkaaGELGIavcnvpgygveeVADTTLCLILNLYRRTYWLANMVregkkftgpeQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFgfnvifydpylpdgiekslgltrVYTLQDLLFQSDCVSLHCTLNEHNHHlineftikqmrpgaflvntargglvdddSLAAALKQGRIRAAAldvhesepynvfqgnlkdapnilctphaafyseASCTELREMAASEIRRAIVGRipdclrncvnkeyfpsagggglpaglnyphappggpvssgppggppgpgvvpeginggssSLVSRYYAAAAAAAigtlppvqqahsttphdsaiapapgsergggappsgsggggappsgggpppntpaglphnlplstadpsnhhppkpessepgvh

mdkrkmmakrprmdsirgpisngpmqTRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVRegkkftgpEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGTLPPVQQAHSTTPHDSAIAPAPGSERGGGAPPSGSGGGGAPPSGGGPPPNTPAGLPHNLPLSTADPSNhhppkpessepgvh

MDKRKMMAKRPRMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFpsagggglpaglNYPHAppggpvssgppggppgpgvvpEGINGGSSSLVSRYYaaaaaaaIGTLPPVQQAHSTTPHDSAIapapgsergggappsgsggggappsgggpppntpaglpHNLPLSTADPSNHHPPKPESSEPGVH

****************************PLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGL***************************************LVSRYYAAAAAAAIGT*********************************************************************************

****************************PLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGTLPPVQQAHSTTPHDSAIAPAPGS*********************GPPPNTPAGLPHNLPLSTADPSNHH*P**********

***********RMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGTLPPV*********DSAIAPA*************************PPPNTPAGLPHNLPLSTA******************

*************DSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSAGGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGTLPPVQQAHSTTPHDSAIAPAPGSERGGGAPPSGSGGGGAPPSGGGPPPNTPAGLPHNLPLS********************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		501	2.2.26 [Sep-21-2011]
O46036		476	C-terminal-binding protei	no	N/A	0.710	0.747	0.907	0.0
Q9Z2F5		430	C-terminal-binding protei	yes	N/A	0.770	0.897	0.705	1e-161
O88712		441	C-terminal-binding protei	yes	N/A	0.764	0.868	0.708	1e-160
Q9YHU0		440	C-terminal-binding protei	N/A	N/A	0.766	0.872	0.704	1e-160
P56546		445	C-terminal-binding protei	no	N/A	0.786	0.885	0.672	1e-159
Q9EQH5		445	C-terminal-binding protei	no	N/A	0.786	0.885	0.672	1e-159
P56545		445	C-terminal-binding protei	no	N/A	0.784	0.883	0.670	1e-159
Q13363		440	C-terminal-binding protei	no	N/A	0.766	0.872	0.691	1e-158
Q0VCQ1		445	C-terminal-binding protei	no	N/A	0.784	0.883	0.665	1e-158
Q9W758		437	C-terminal-binding protei	N/A	N/A	0.774	0.887	0.674	1e-153

>sp\|O46036\|CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster GN=CtBP PE=1 SV=3	Back alignment and function desciption

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/357 (90%), Positives = 341/357 (95%), Gaps = 1/357 (0%)

Query: 1   MDKRKMMAKRPRMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQST 60
           MDK  MM KR R+D ++G  +NGP+Q RPLVALLDGRDCSIEMPILKDVATVAFCDAQST
Sbjct: 1   MDKNLMMPKRSRID-VKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQST 59

Query: 61  SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN 120
           SEIHEKVLNEAVGALMWHTIILTKEDLEKFK LRIIVRIGSG DNIDVKAAGELGIAVCN
Sbjct: 60  SEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCN 119

Query: 121 VPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGI 180
           VPGYGVEEVADTT+CLILNLYRRTYWLANMVREGKKFTGPEQ+REAA GCARIRGDTLG+
Sbjct: 120 VPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGL 179

Query: 181 VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTL 240
           VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGI+KSLGLTRVYTLQDLLFQSDCVSLHCTL
Sbjct: 180 VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTL 239

Query: 241 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNV 300
           NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDD++LA ALKQGRIRAAALDVHE+EPYNV
Sbjct: 240 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNV 299

Query: 301 FQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYF 357
           FQG LKDAPN++CTPHAAF+S+AS TELREMAA+EIRRAIVG IPD LRNCVNKEYF
Sbjct: 300 FQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNKEYF 356

Corepressor targeting diverse transcription regulators. Hairy-interacting protein required for embryonic segmentation and hairy-mediated transcriptional repression.
Drosophila melanogaster (taxid: 7227)

>sp\|Q9Z2F5\|CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus GN=Ctbp1 PE=1 SV=3	Back alignment and function description

>sp\|O88712\|CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus GN=Ctbp1 PE=1 SV=2	Back alignment and function description

>sp\|Q9YHU0\|CTBP1_XENLA C-terminal-binding protein 1 OS=Xenopus laevis GN=ctbp1 PE=2 SV=1	Back alignment and function description

>sp\|P56546\|CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus GN=Ctbp2 PE=1 SV=2	Back alignment and function description

>sp\|Q9EQH5\|CTBP2_RAT C-terminal-binding protein 2 OS=Rattus norvegicus GN=Ctbp2 PE=1 SV=2	Back alignment and function description

>sp\|P56545\|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens GN=CTBP2 PE=1 SV=1	Back alignment and function description

>sp\|Q13363\|CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens GN=CTBP1 PE=1 SV=2	Back alignment and function description

>sp\|Q0VCQ1\|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus GN=CTBP2 PE=1 SV=1	Back alignment and function description

>sp\|Q9W758\|CTBP2_XENLA C-terminal-binding protein 2 OS=Xenopus laevis GN=ctbp2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		501
242022752		436	C-terminal-binding protein, putative [Pe	0.866	0.995	0.782	0.0
91090312		444	PREDICTED: similar to 2-hydroxyacid dehy	0.882	0.995	0.778	0.0
307180364		455	C-terminal-binding protein [Camponotus f	0.780	0.859	0.839	0.0
350413510		446	PREDICTED: C-terminal-binding protein-li	0.848	0.952	0.784	0.0
345491070		473	PREDICTED: C-terminal-binding protein-li	0.790	0.837	0.836	0.0
328776329		477	PREDICTED: c-terminal-binding protein is	0.780	0.819	0.834	0.0
383862195		477	PREDICTED: C-terminal-binding protein-li	0.780	0.819	0.827	0.0
328716960		490	PREDICTED: c-terminal-binding protein-li	0.832	0.851	0.804	0.0
347970860		473	AGAP003893-PA [Anopheles gambiae str. PE	0.770	0.816	0.803	0.0
157109874		437	2-hydroxyacid dehydrogenase [Aedes aegyp	0.702	0.805	0.920	0.0

>gi\|242022752\|ref\|XP_002431802.1\| C-terminal-binding protein, putative [Pediculus humanus corporis] gi\|212517134\|gb\|EEB19064.1\| C-terminal-binding protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/497 (78%), Positives = 408/497 (82%), Gaps = 63/497 (12%)

Query: 1   MDKRKMMAKRPRMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQST 60
           MDKRKM+AKRPRMD +RGPI+NGPMQ+RPLVALLDGRDCSIEMPILKDVATVAFCDAQST
Sbjct: 1   MDKRKMLAKRPRMD-VRGPIANGPMQSRPLVALLDGRDCSIEMPILKDVATVAFCDAQST 59

Query: 61  SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN 120
           SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN
Sbjct: 60  SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN 119

Query: 121 VPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGI 180
           VPGYGVEEVADTTLCLILNLYRRTYWLA+MVREGKKF GPEQ+REAA GCARIRGDTLGI
Sbjct: 120 VPGYGVEEVADTTLCLILNLYRRTYWLASMVREGKKFNGPEQVREAAQGCARIRGDTLGI 179

Query: 181 VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTL 240
           VGLGRIGS VALRAKAFGFNVIFYDPYLPDGI+KSLGLTRVYTLQ+LLFQSDCVSLHCTL
Sbjct: 180 VGLGRIGSGVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQELLFQSDCVSLHCTL 239

Query: 241 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNV 300
           NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDD+SLAAALKQGRIRAAALDVHE+EPYNV
Sbjct: 240 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDESLAAALKQGRIRAAALDVHENEPYNV 299

Query: 301 FQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYFPSA 360
           FQG LKDAPN+LCTPHAAFYS+ASCTELREMAASEIRRAIVGRIP+CLRNCVNKEYF  +
Sbjct: 300 FQGPLKDAPNLLCTPHAAFYSDASCTELREMAASEIRRAIVGRIPECLRNCVNKEYFLPS 359

Query: 361 GGGGLPAGLNYPHAPPGGPVSSGPPGGPPGPGVVPEGINGGSSSLVSRYYAAAAAAAIGT 420
           GG                                PEGINGG       YYA A       
Sbjct: 360 GG-------------------------------YPEGINGG-------YYAGAL------ 375

Query: 421 LPPVQQAHSTTPHDSAIAPAPGSERGGGAPPSGSGGGGAPPSGGGPPPNTPAGLPHNLPL 480
             PVQQAHSTTPH+      P S         GSG  G PPS       + +G+PH LPL
Sbjct: 376 --PVQQAHSTTPHE-----VPHS--------VGSGSAGGPPSATA---GSVSGIPHTLPL 417

Query: 481 STADPSNHHPPKPESSE 497
           S  DP+NHH  KPE SE
Sbjct: 418 SAPDPANHHSQKPEPSE 434

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|91090312\|ref\|XP_972241.1\| PREDICTED: similar to 2-hydroxyacid dehydrogenase [Tribolium castaneum] gi\|270013805\|gb\|EFA10253.1\| hypothetical protein TcasGA2_TC012453 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|307180364\|gb\|EFN68390.1\| C-terminal-binding protein [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|350413510\|ref\|XP_003490012.1\| PREDICTED: C-terminal-binding protein-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|345491070\|ref\|XP_001602190.2\| PREDICTED: C-terminal-binding protein-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328776329\|ref\|XP_392682.3\| PREDICTED: c-terminal-binding protein isoform 1 [Apis mellifera] gi\|380012210\|ref\|XP_003690179.1\| PREDICTED: C-terminal-binding protein-like [Apis florea]	Back alignment and taxonomy information

>gi\|383862195\|ref\|XP_003706569.1\| PREDICTED: C-terminal-binding protein-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|328716960\|ref\|XP_001946980.2\| PREDICTED: c-terminal-binding protein-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi|347970860|ref|XP_308121.5| AGAP003893-PA [Anopheles gambiae str. PEST] gi|347970862|ref|XP_003436651.1| AGAP003893-PB [Anopheles gambiae str. PEST] gi|347970864|ref|XP_003436652.1| AGAP003893-PC [Anopheles gambiae str. PEST] gi|347970866|ref|XP_003436653.1| AGAP003893-PD [Anopheles gambiae str. PEST] gi|347970868|ref|XP_003436654.1| AGAP003893-PE [Anopheles gambiae str. PEST] gi|333466406|gb|EAA03909.6| AGAP003893-PA [Anopheles gambiae str. PEST] gi|333466407|gb|EGK96230.1| AGAP003893-PB [Anopheles gambiae str. PEST] gi|333466408|gb|EGK96231.1| AGAP003893-PC [Anopheles gambiae str. PEST] gi|333466409|gb|EGK96232.1| AGAP003893-PD [Anopheles gambiae str. PEST] gi|333466410|gb|EGK96233.1| AGAP003893-PE [Anopheles gambiae str. PEST]

Back alignment and taxonomy information

>gi\|157109874\|ref\|XP_001650861.1\| 2-hydroxyacid dehydrogenase [Aedes aegypti] gi\|108878898\|gb\|EAT43123.1\| AAEL005400-PD [Aedes aegypti]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		501
FB\|FBgn0020496		476	CtBP "C-terminal Binding Prote	0.710	0.747	0.907	4.3e-180
UNIPROTKB\|F1MYP4		419	CTBP1 "Uncharacterized protein	0.686	0.821	0.758	4.3e-143
UNIPROTKB\|Q9YHU0		440	ctbp1 "C-terminal-binding prot	0.680	0.775	0.771	5.5e-143
UNIPROTKB\|Q5ZIZ6		430	CTBP1 "Uncharacterized protein	0.686	0.8	0.770	1.8e-142
RGD\|2441		430	Ctbp1 "C-terminal binding prot	0.686	0.8	0.767	2.3e-142
UNIPROTKB\|Q9Z2F5		430	Ctbp1 "C-terminal-binding prot	0.686	0.8	0.767	2.3e-142
ZFIN\|ZDB-GENE-010130-2		1156	ctbp2 "C-terminal binding prot	0.684	0.296	0.763	2.9e-142
UNIPROTKB\|E1C7D4		472	CTBP1 "Uncharacterized protein	0.680	0.722	0.774	6.1e-142
MGI\|MGI:1201685		441	Ctbp1 "C-terminal binding prot	0.680	0.773	0.771	7.8e-142
UNIPROTKB\|D4A2Y2		441	Ctbp1 "C-terminal-binding prot	0.680	0.773	0.771	7.8e-142

FB\|FBgn0020496 CtBP "C-terminal Binding Protein" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1696 (602.1 bits), Expect = 4.3e-180, Sum P(3) = 4.3e-180
 Identities = 324/357 (90%), Positives = 341/357 (95%)

Query:     1 MDKRKMMAKRPRMDSIRGPISNGPMQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQST 60
             MDK  MM KR R+D ++G  +NGP+Q RPLVALLDGRDCSIEMPILKDVATVAFCDAQST
Sbjct:     1 MDKNLMMPKRSRID-VKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQST 59

Query:    61 SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN 120
             SEIHEKVLNEAVGALMWHTIILTKEDLEKFK LRIIVRIGSG DNIDVKAAGELGIAVCN
Sbjct:    60 SEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCN 119

Query:   121 VPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGI 180
             VPGYGVEEVADTT+CLILNLYRRTYWLANMVREGKKFTGPEQ+REAA GCARIRGDTLG+
Sbjct:   120 VPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGL 179

Query:   181 VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTL 240
             VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGI+KSLGLTRVYTLQDLLFQSDCVSLHCTL
Sbjct:   180 VGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTL 239

Query:   241 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNV 300
             NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDD++LA ALKQGRIRAAALDVHE+EPYNV
Sbjct:   240 NEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNV 299

Query:   301 FQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVNKEYF 357
             FQG LKDAPN++CTPHAAF+S+AS TELREMAA+EIRRAIVG IPD LRNCVNKEYF
Sbjct:   300 FQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNKEYF 356

GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP

GO:0005515 "protein binding" evidence=IPI

GO:0008022 "protein C-terminus binding" evidence=NAS

GO:0070491 "repressing transcription factor binding" evidence=IPI

GO:0003714 "transcription corepressor activity" evidence=IMP;NAS;IDA;TAS

GO:0005634 "nucleus" evidence=IDA;NAS

GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=TAS

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA;IMP

GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0051287 "NAD binding" evidence=IEA

GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IMP

GO:0003713 "transcription coactivator activity" evidence=IDA

GO:0016055 "Wnt receptor signaling pathway" evidence=IGI

GO:0008134 "transcription factor binding" evidence=IPI

GO:0022416 "chaeta development" evidence=IMP

GO:0016360 "sensory organ precursor cell fate determination" evidence=IMP

GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IMP

GO:0035220 "wing disc development" evidence=IMP

GO:0042803 "protein homodimerization activity" evidence=IDA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP

GO:0030111 "regulation of Wnt receptor signaling pathway" evidence=IMP

UNIPROTKB\|F1MYP4 CTBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9YHU0 ctbp1 "C-terminal-binding protein 1" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZIZ6 CTBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|2441 Ctbp1 "C-terminal binding protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9Z2F5 Ctbp1 "C-terminal-binding protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-010130-2 ctbp2 "C-terminal binding protein 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C7D4 CTBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1201685 Ctbp1 "C-terminal binding protein 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|D4A2Y2 Ctbp1 "C-terminal-binding protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9Z2F5	CTBP1_RAT	1, ., 1, ., 1, ., -	0.7052	0.7704	0.8976	yes	N/A
Q9YHU0	CTBP1_XENLA	1, ., 1, ., 1, ., -	0.7040	0.7664	0.8727	N/A	N/A
O46036	CTBP_DROME	No assigned EC number	0.9075	0.7105	0.7478	no	N/A
O88712	CTBP1_MOUSE	1, ., 1, ., 1, ., -	0.7081	0.7644	0.8684	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		501
cd05299		312	cd05299, CtBP_dh, C-terminal binding protein (CtBP	1e-149
cd05198		302	cd05198, formate_dh_like, Formate/glycerate and re	2e-98
cd12172		306	cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat	1e-88
pfam00389		312	pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy	8e-84
COG1052		324	COG1052, LdhA, Lactate dehydrogenase and related d	1e-83
cd12173		304	cd12173, PGDH_4, Phosphoglycerate dehydrogenases,	3e-82
COG0111		324	COG0111, SerA, Phosphoglycerate dehydrogenase and	4e-80
cd12175		311	cd12175, 2-Hacid_dh_11, Putative D-isomer specific	3e-76
cd05301		309	cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr	1e-75
cd01619		323	cd01619, LDH_like, D-Lactate and related Dehydroge	4e-74
cd12162		307	cd12162, 2-Hacid_dh_4, Putative D-isomer specific	2e-73
cd05303		301	cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P	2e-72
cd12178		317	cd12178, 2-Hacid_dh_13, Putative D-isomer specific	2e-71
PRK13581		526	PRK13581, PRK13581, D-3-phosphoglycerate dehydroge	1e-69
cd12168		321	cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l	2e-67
pfam02826		175	pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro	9e-67
cd12187		329	cd12187, LDH_like_1, D-Lactate and related Dehydro	2e-65
cd12171		310	cd12171, 2-Hacid_dh_10, Putative D-isomer specific	5e-65
cd12177		321	cd12177, 2-Hacid_dh_12, Putative D-isomer specific	1e-64
cd12174		305	cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat	2e-63
cd12161		315	cd12161, GDH_like_1, Putative glycerate dehydrogen	1e-61
cd12186		329	cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr	2e-61
PRK08410		311	PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P	7e-61
cd12183		328	cd12183, LDH_like_2, D-Lactate and related Dehydro	2e-60
TIGR01327		525	TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas	1e-59
cd12185		322	cd12185, HGDH_LDH_like, Putative Lactate dehydroge	1e-54
cd12169		308	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat	2e-54
PRK13243		333	PRK13243, PRK13243, glyoxylate reductase; Reviewed	3e-54
PRK06932		314	PRK06932, PRK06932, glycerate dehydrogenase; Provi	3e-50
PRK06487		317	PRK06487, PRK06487, glycerate dehydrogenase; Provi	6e-50
cd12156		301	cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase,	5e-46
cd12176		304	cd12176, PGDH_3, Phosphoglycerate dehydrogenases,	1e-45
cd12167		330	cd12167, 2-Hacid_dh_8, Putative D-isomer specific	2e-45
cd05302		348	cd05302, FDH, NAD-dependent Formate Dehydrogenase	5e-44
cd12184		330	cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro	8e-44
cd12157		318	cd12157, PTDH, Thermostable Phosphite Dehydrogenas	5e-43
PRK11790		409	PRK11790, PRK11790, D-3-phosphoglycerate dehydroge	7e-43
cd12179		306	cd12179, 2-Hacid_dh_14, Putative D-isomer specific	2e-41
PRK07574		385	PRK07574, PRK07574, formate dehydrogenase; Provisi	4e-39
PRK08605		332	PRK08605, PRK08605, D-lactate dehydrogenase; Valid	5e-39
cd12158		343	cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh	9e-39
cd12165		314	cd12165, 2-Hacid_dh_6, Putative D-isomer specific	4e-38
cd05300		313	cd05300, 2-Hacid_dh_1, Putative D-isomer specific	1e-37
PRK15409		323	PRK15409, PRK15409, bifunctional glyoxylate/hydrox	2e-37
cd12155		314	cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2	3e-34
PLN02306		386	PLN02306, PLN02306, hydroxypyruvate reductase	2e-31
PLN02928		347	PLN02928, PLN02928, oxidoreductase family protein	2e-30
PRK12480		330	PRK12480, PRK12480, D-lactate dehydrogenase; Provi	6e-29
cd12180		308	cd12180, 2-Hacid_dh_15, Putative D-isomer specific	2e-28
PLN03139		386	PLN03139, PLN03139, formate dehydrogenase; Provisi	3e-25
PRK00257		381	PRK00257, PRK00257, erythronate-4-phosphate dehydr	5e-23
cd12164		306	cd12164, GDH_like_2, Putative glycerate dehydrogen	3e-22
cd12166		300	cd12166, 2-Hacid_dh_7, Putative D-isomer specific	4e-21
cd12159		303	cd12159, 2-Hacid_dh_2, Putative D-isomer specific	7e-21
PRK06436		303	PRK06436, PRK06436, glycerate dehydrogenase; Provi	5e-18
cd12160		310	cd12160, 2-Hacid_dh_3, Putative D-isomer specific	7e-17
cd12163		334	cd12163, 2-Hacid_dh_5, Putative D-isomer specific	2e-15
PRK15438		378	PRK15438, PRK15438, erythronate-4-phosphate dehydr	6e-15
cd12170		294	cd12170, 2-Hacid_dh_9, Putative D-isomer specific	6e-15
cd12154		310	cd12154, FDH_GDH_like, Formate/glycerate dehydroge	2e-11
PRK15469		312	PRK15469, ghrA, bifunctional glyoxylate/hydroxypyr	6e-08
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	7e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-05
pfam05518		753	pfam05518, Totivirus_coat, Totivirus coat protein	2e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	7e-05
PRK14959		624	PRK14959, PRK14959, DNA polymerase III subunits ga	2e-04
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	4e-04
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	7e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001
pfam04652		315	pfam04652, DUF605, Vta1 like	0.001
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	0.002
PHA03378		991	PHA03378, PHA03378, EBNA-3B; Provisional	0.002
PRK13875		440	PRK13875, PRK13875, conjugal transfer protein TrbL	0.002
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	0.003

>gnl\|CDD\|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor	Back alignment and domain information

 Score =  429 bits (1105), Expect = e-149
 Identities = 160/323 (49%), Positives = 193/323 (59%), Gaps = 15/323 (4%)

Query: 29  PLVALLDGR--DCSIEMPILKDVATVAFCDAQS--TSEIHEKVLNEAVGALMWHTIILTK 84
           P V + D    D  IE  +L++ A V   DAQS    E+ E    +A   L+ +  + T 
Sbjct: 1   PKVVITDYDFPDLDIEREVLEE-AGVELVDAQSRTEDELIEAA-ADADALLVQYAPV-TA 57

Query: 85  EDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILNLYRRT 144
           E +E    L++IVR G GVDN+DV AA E GI VCNVP Y  EEVAD  L LIL L R+ 
Sbjct: 58  EVIEALPRLKVIVRYGVGVDNVDVAAATERGIPVCNVPDYCTEEVADHALALILALARKL 117

Query: 145 YWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFY 204
            +L   VR G                 R+RG TLG+VG GRIG AVA RAKAFGF VI Y
Sbjct: 118 PFLDRAVRAGGWDWT------VGGPIRRLRGLTLGLVGFGRIGRAVAKRAKAFGFRVIAY 171

Query: 205 DPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN 264
           DPY+PDG+  +LG  RV +L +LL +SD VSLHC L     HLI+   +  M+PGAFLVN
Sbjct: 172 DPYVPDGVA-ALGGVRVVSLDELLARSDVVSLHCPLTPETRHLIDAEALALMKPGAFLVN 230

Query: 265 TARGGLVDDDSLAAALKQGRIRAAALDVHESEPYNVFQGNLKDAPNILCTPHAAFYSEAS 324
           TARGGLVD+ +LA ALK GRI  AALDV E EP       L  APN++ TPHAA+YSE S
Sbjct: 231 TARGGLVDEAALARALKSGRIAGAALDVLEEEPPP-ADSPLLSAPNVILTPHAAWYSEES 289

Query: 325 CTELREMAASEIRRAIVGRIPDC 347
             ELR  AA E+ R + G  P  
Sbjct: 290 LAELRRKAAEEVVRVLRGEPPRN 312

The transcriptional corepressor CtBP is a dehydrogenase with sequence and structural similarity to the d2-hydroxyacid dehydrogenase family. CtBP was initially identified as a protein that bound the PXDLS sequence at the adenovirus E1A C terminus, causing the loss of CR-1-mediated transactivation. CtBP binds NAD(H) within a deep cleft, undergoes a conformational change upon NAD binding, and has NAD-dependent dehydrogenase activity. Length = 312

>gnl\|CDD\|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain	Back alignment and domain information

>gnl\|CDD\|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH)	Back alignment and domain information

>gnl\|CDD\|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases	Back alignment and domain information

>gnl\|CDD\|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain	Back alignment and domain information

>gnl\|CDD\|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases	Back alignment and domain information

>gnl\|CDD\|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed	Back alignment and domain information

>gnl\|CDD\|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase	Back alignment and domain information

>gnl\|CDD\|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH)	Back alignment and domain information

>gnl\|CDD\|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase	Back alignment and domain information

>gnl\|CDD\|236985 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase	Back alignment and domain information

>gnl\|CDD\|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>gnl\|CDD\|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|177941 PLN02306, PLN02306, hydroxypyruvate reductase	Back alignment and domain information

>gnl\|CDD\|215501 PLN02928, PLN02928, oxidoreductase family protein	Back alignment and domain information

>gnl\|CDD\|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains	Back alignment and domain information

>gnl\|CDD\|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|240641 cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240640 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|185335 PRK15438, PRK15438, erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>gnl\|CDD\|240647 cd12170, 2-Hacid_dh_9, Putative D-isomer specific 2-hydroxyacid dehydrogenases	Back alignment and domain information

>gnl\|CDD\|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases	Back alignment and domain information

>gnl\|CDD\|185366 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|218621 pfam05518, Totivirus_coat, Totivirus coat protein	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223065 PHA03378, PHA03378, EBNA-3B; Provisional	Back alignment and domain information

>gnl\|CDD\|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		501
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	100.0
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	100.0
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	100.0
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	100.0
PRK06487		317	glycerate dehydrogenase; Provisional	100.0
PRK13243		333	glyoxylate reductase; Reviewed	100.0
PRK06932		314	glycerate dehydrogenase; Provisional	100.0
PLN02306		386	hydroxypyruvate reductase	100.0
PRK07574		385	formate dehydrogenase; Provisional	100.0
PLN03139		386	formate dehydrogenase; Provisional	100.0
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	100.0
PLN02928		347	oxidoreductase family protein	100.0
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	100.0
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	100.0
PRK12480		330	D-lactate dehydrogenase; Provisional	100.0
KOG0068\|consensus		406		100.0
PRK08605		332	D-lactate dehydrogenase; Validated	100.0
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	100.0
PRK06436		303	glycerate dehydrogenase; Provisional	100.0
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	100.0
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	100.0
KOG0069\|consensus		336		100.0
KOG0067\|consensus		435		100.0
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	100.0
PTZ00075		476	Adenosylhomocysteinase; Provisional	99.84
PF00389		133	2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr	99.81
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	99.79
PRK08306		296	dipicolinate synthase subunit A; Reviewed	99.6
PLN02494		477	adenosylhomocysteinase	99.6
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	99.51
PRK13403		335	ketol-acid reductoisomerase; Provisional	99.48
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	99.46
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	99.38
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	99.33
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	99.29
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	99.28
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	99.27
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	99.26
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	99.26
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	99.22
PRK15059		292	tartronate semialdehyde reductase; Provisional	99.15
PRK05479		330	ketol-acid reductoisomerase; Provisional	99.14
PLN02256		304	arogenate dehydrogenase	99.12
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	99.12
PLN02712		667	arogenate dehydrogenase	99.06
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	99.03
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	99.03
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	99.02
PLN02858		1378	fructose-bisphosphate aldolase	99.01
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	99.0
KOG0409\|consensus		327		98.99
PLN02858		1378	fructose-bisphosphate aldolase	98.97
PRK08655		437	prephenate dehydrogenase; Provisional	98.92
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	98.91
PLN02712		667	arogenate dehydrogenase	98.84
COG0499		420	SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me	98.83
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	98.83
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	98.81
PLN02688		266	pyrroline-5-carboxylate reductase	98.78
PRK07417		279	arogenate dehydrogenase; Reviewed	98.76
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	98.75
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	98.75
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.74
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	98.74
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	98.73
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.69
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	98.67
PRK15182		425	Vi polysaccharide biosynthesis protein TviB; Provi	98.67
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	98.66
PRK05225		487	ketol-acid reductoisomerase; Validated	98.66
PRK06545		359	prephenate dehydrogenase; Validated	98.66
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	98.63
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	98.63
COG1023		300	Gnd Predicted 6-phosphogluconate dehydrogenase [Ca	98.63
PRK08507		275	prephenate dehydrogenase; Validated	98.61
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	98.61
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	98.59
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.59
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	98.59
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.58
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	98.57
KOG1370\|consensus		434		98.56
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	98.55
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	98.54
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	98.53
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	98.52
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.51
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	98.51
PRK14806		735	bifunctional cyclohexadienyl dehydrogenase/ 3-phos	98.5
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.49
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	98.49
PRK08818		370	prephenate dehydrogenase; Provisional	98.48
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.47
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.47
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.45
TIGR01724		341	hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome	98.45
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	98.42
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	98.41
PRK09287		459	6-phosphogluconate dehydrogenase; Validated	98.38
PRK07680		273	late competence protein ComER; Validated	98.37
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	98.37
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	98.36
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	98.35
PRK14179		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.31
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.31
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	98.3
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	98.28
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	98.28
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	98.25
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	98.24
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	98.18
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	98.17
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	98.14
PRK13304		265	L-aspartate dehydrogenase; Reviewed	98.14
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	98.14
PRK05472		213	redox-sensing transcriptional repressor Rex; Provi	98.12
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	98.12
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.11
COG0345		266	ProC Pyrroline-5-carboxylate reductase [Amino acid	98.11
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	98.11
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	98.08
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	98.03
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	98.0
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	98.0
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	97.97
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	97.94
PTZ00431		260	pyrroline carboxylate reductase; Provisional	97.94
PRK14191		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.93
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	97.92
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	97.92
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	97.9
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	97.88
KOG2380\|consensus		480		97.87
PRK12557		342	H(2)-dependent methylenetetrahydromethanopterin de	97.86
COG0059		338	IlvC Ketol-acid reductoisomerase [Amino acid trans	97.85
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	97.85
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.84
PF02882		160	THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl	97.8
TIGR01546		333	GAPDH-II_archae glyceraldehyde-3-phosphate dehydro	97.8
PRK14190		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.78
PLN00203		519	glutamyl-tRNA reductase	97.77
PRK06141		314	ornithine cyclodeaminase; Validated	97.75
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.74
PRK14178		279	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.72
cd01079		197	NAD_bind_m-THF_DH NAD binding domain of methylene-	97.72
PRK14176		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.72
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	97.72
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	97.69
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	97.67
PRK14169		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.64
PLN02353		473	probable UDP-glucose 6-dehydrogenase	97.61
COG0362		473	Gnd 6-phosphogluconate dehydrogenase [Carbohydrate	97.58
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	97.58
PLN02516		299	methylenetetrahydrofolate dehydrogenase (NADP+)	97.57
PTZ00345		365	glycerol-3-phosphate dehydrogenase; Provisional	97.56
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	97.55
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	97.54
PRK14173		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.52
TIGR03376		342	glycerol3P_DH glycerol-3-phosphate dehydrogenase (	97.51
PRK14170		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.5
PRK14193		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.49
PRK14183		281	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.48
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	97.47
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	97.47
COG0677		436	WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas	97.47
PRK11730		715	fadB multifunctional fatty acid oxidation complex	97.46
PRK14171		288	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.45
PF02153		258	PDH: Prephenate dehydrogenase; InterPro: IPR003099	97.43
PRK14982		340	acyl-ACP reductase; Provisional	97.41
PRK14186		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.41
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	97.41
PRK07340		304	ornithine cyclodeaminase; Validated	97.38
PRK14172		278	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.37
cd05313		254	NAD_bind_2_Glu_DH NAD(P) binding domain of glutama	97.37
PRK14177		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.36
PRK14166		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.35
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.35
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	97.33
TIGR01921		324	DAP-DH diaminopimelate dehydrogenase. This model r	97.32
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.31
COG0190		283	FolD 5,10-methylene-tetrahydrofolate dehydrogenase	97.31
PRK14187		294	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.29
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	97.29
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	97.29
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	97.29
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	97.28
PLN02897		345	tetrahydrofolate dehydrogenase/cyclohydrolase, put	97.28
PRK14180		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.28
PLN02616		364	tetrahydrofolate dehydrogenase/cyclohydrolase, put	97.27
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	97.27
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	97.27
PRK13940		414	glutamyl-tRNA reductase; Provisional	97.26
PRK14181		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.25
PRK14182		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.25
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	97.24
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	97.24
PF03720		106	UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen	97.23
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	97.2
PRK14184		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.19
PRK14174		295	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.18
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	97.18
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	97.15
PRK08618		325	ornithine cyclodeaminase; Validated	97.14
PRK09310		477	aroDE bifunctional 3-dehydroquinate dehydratase/sh	97.14
PRK00676		338	hemA glutamyl-tRNA reductase; Validated	97.12
TIGR02992		326	ectoine_eutC ectoine utilization protein EutC. Mem	97.12
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	97.11
PRK14185		293	bifunctional 5,10-methylene-tetrahydrofolate dehyd	97.09
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	97.09
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	97.09
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	97.09
PRK14031		444	glutamate dehydrogenase; Provisional	97.07
PTZ00117		319	malate dehydrogenase; Provisional	97.05
PRK13303		265	L-aspartate dehydrogenase; Provisional	97.04
PRK06046		326	alanine dehydrogenase; Validated	97.01
KOG2653\|consensus		487		96.97
PRK06444		197	prephenate dehydrogenase; Provisional	96.96
PRK09414		445	glutamate dehydrogenase; Provisional	96.95
PRK14167		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.95
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	96.94
PRK14168		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.93
smart00859		122	Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin	96.93
PRK06199		379	ornithine cyclodeaminase; Validated	96.9
PRK08291		330	ectoine utilization protein EutC; Validated	96.9
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	96.9
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	96.82
PLN02477		410	glutamate dehydrogenase	96.81
PRK14030		445	glutamate dehydrogenase; Provisional	96.8
KOG0023\|consensus		360		96.8
PRK08306		296	dipicolinate synthase subunit A; Reviewed	96.8
PRK06823		315	ornithine cyclodeaminase; Validated	96.76
PF13380		116	CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5	96.74
cd00650		263	LDH_MDH_like NAD-dependent, lactate dehydrogenase-	96.73
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	96.68
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.67
COG0334		411	GdhA Glutamate dehydrogenase/leucine dehydrogenase	96.67
PF02423		313	OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst	96.66
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	96.62
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	96.61
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	96.61
PRK06719		157	precorrin-2 dehydrogenase; Validated	96.61
PRK07589		346	ornithine cyclodeaminase; Validated	96.59
PRK00048		257	dihydrodipicolinate reductase; Provisional	96.54
PRK06407		301	ornithine cyclodeaminase; Provisional	96.54
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	96.5
PTZ00079		454	NADP-specific glutamate dehydrogenase; Provisional	96.49
PF00208		244	ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val	96.48
PRK00779		304	ornithine carbamoyltransferase; Provisional	96.45
PF00185		158	OTCace: Aspartate/ornithine carbamoyltransferase,	96.4
PRK11579		346	putative oxidoreductase; Provisional	96.39
PRK12548		289	shikimate 5-dehydrogenase; Provisional	96.37
PRK06223		307	malate dehydrogenase; Reviewed	96.37
PTZ00082		321	L-lactate dehydrogenase; Provisional	96.34
COG2423		330	Predicted ornithine cyclodeaminase, mu-crystallin	96.34
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	96.34
TIGR00658		304	orni_carb_tr ornithine carbamoyltransferase. Most	96.3
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	96.3
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	96.28
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	96.22
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	96.21
PLN02353		473	probable UDP-glucose 6-dehydrogenase	96.19
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	96.16
PRK08269		314	3-hydroxybutyryl-CoA dehydrogenase; Validated	96.12
TIGR01850		346	argC N-acetyl-gamma-glutamyl-phosphate reductase,	96.11
PRK02102		331	ornithine carbamoyltransferase; Validated	96.11
PRK00683		418	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.07
PLN02342		348	ornithine carbamoyltransferase	96.03
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	96.0
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.97
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.96
COG0026		375	PurK Phosphoribosylaminoimidazole carboxylase (NCA	95.96
PRK04284		332	ornithine carbamoyltransferase; Provisional	95.93
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	95.9
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	95.88
KOG2304\|consensus		298		95.88
PRK00856		305	pyrB aspartate carbamoyltransferase catalytic subu	95.86
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	95.86
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	95.85
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	95.84
PRK01713		334	ornithine carbamoyltransferase; Provisional	95.81
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	95.78
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	95.75
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	95.74
PRK07232		752	bifunctional malic enzyme oxidoreductase/phosphotr	95.72
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	95.72
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	95.72
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.72
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	95.7
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	95.69
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.68
PRK09496		453	trkA potassium transporter peripheral membrane com	95.67
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.66
PRK11891		429	aspartate carbamoyltransferase; Provisional	95.66
TIGR03316		357	ygeW probable carbamoyltransferase YgeW. Members o	95.66
KOG2711\|consensus		372		95.65
TIGR02964		246	xanthine_xdhC xanthine dehydrogenase accessory pro	95.64
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	95.64
PRK03515		336	ornithine carbamoyltransferase subunit I; Provisio	95.63
cd05297		423	GH4_alpha_glucosidase_galactosidase Glycoside Hydr	95.63
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.62
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	95.62
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	95.59
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	95.58
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	95.56
TIGR01761		343	thiaz-red thiazolinyl imide reductase. This reduct	95.55
COG0569		225	TrkA K+ transport systems, NAD-binding component [	95.53
PF02629		96	CoA_binding: CoA binding domain; InterPro: IPR0037	95.48
PLN02968		381	Probable N-acetyl-gamma-glutamyl-phosphate reducta	95.47
PRK12862		763	malic enzyme; Reviewed	95.43
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	95.4
PRK06019		372	phosphoribosylaminoimidazole carboxylase ATPase su	95.38
TIGR00036		266	dapB dihydrodipicolinate reductase.	95.38
cd01486		307	Apg7 Apg7 is an E1-like protein, that activates tw	95.36
PLN02527		306	aspartate carbamoyltransferase	95.36
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	95.31
PRK13814		310	pyrB aspartate carbamoyltransferase catalytic subu	95.3
PRK10669		558	putative cation:proton antiport protein; Provision	95.28
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	95.27
PRK03659		601	glutathione-regulated potassium-efflux system prot	95.24
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	95.22
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	95.17
PRK08328		231	hypothetical protein; Provisional	95.16
TIGR00670		301	asp_carb_tr aspartate carbamoyltransferase. Ornith	95.16
PRK02255		338	putrescine carbamoyltransferase; Provisional	95.15
PRK00436		343	argC N-acetyl-gamma-glutamyl-phosphate reductase;	95.13
cd00300		300	LDH_like L-lactate dehydrogenase-like enzymes. Mem	95.11
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	95.11
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	95.11
cd00762		254	NAD_bind_malic_enz NAD(P) binding domain of malic	95.1
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	95.09
COG5322		351	Predicted dehydrogenase [General function predicti	95.08
PRK06270		341	homoserine dehydrogenase; Provisional	95.06
PF04016		147	DUF364: Domain of unknown function (DUF364); Inter	95.01
PF13478		136	XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2	95.0
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.95
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	94.93
PRK03562		621	glutathione-regulated potassium-efflux system prot	94.93
PRK12562		334	ornithine carbamoyltransferase subunit F; Provisio	94.91
PRK08300		302	acetaldehyde dehydrogenase; Validated	94.89
cd05188		271	MDR Medium chain reductase/dehydrogenase (MDR)/zin	94.89
COG0281		432	SfcA Malic enzyme [Energy production and conversio	94.87
TIGR01087		433	murD UDP-N-acetylmuramoylalanine--D-glutamate liga	94.86
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	94.82
PRK03803		448	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.8
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	94.7
PRK05086		312	malate dehydrogenase; Provisional	94.7
COG0673		342	MviM Predicted dehydrogenases and related proteins	94.69
PRK10637		457	cysG siroheme synthase; Provisional	94.68
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	94.67
PRK05562		223	precorrin-2 dehydrogenase; Provisional	94.66
TIGR01381		664	E1_like_apg7 E1-like protein-activating enzyme Gsa	94.65
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	94.64
TIGR02822		329	adh_fam_2 zinc-binding alcohol dehydrogenase famil	94.61
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	94.61
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.56
PRK12861		764	malic enzyme; Reviewed	94.55
TIGR03215		285	ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati	94.51
PRK09496		453	trkA potassium transporter peripheral membrane com	94.5
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	94.48
PRK08223		287	hypothetical protein; Validated	94.47
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.45
PLN03209		576	translocon at the inner envelope of chloroplast su	94.45
CHL00194		317	ycf39 Ycf39; Provisional	94.38
PF05222		136	AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal	94.35
PRK07411		390	hypothetical protein; Validated	94.31
TIGR02717		447	AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP	94.24
PRK08265		261	short chain dehydrogenase; Provisional	94.23
COG4007		340	Predicted dehydrogenase related to H2-forming N5,N	94.13
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	94.12
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	94.1
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	94.1
PLN02586		360	probable cinnamyl alcohol dehydrogenase	94.08
TIGR01161		352	purK phosphoribosylaminoimidazole carboxylase, Pur	94.01
PLN02948		577	phosphoribosylaminoimidazole carboxylase	93.97
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	93.97
PLN02214		342	cinnamoyl-CoA reductase	93.96
PRK15182		425	Vi polysaccharide biosynthesis protein TviB; Provi	93.95
PRK07806		248	short chain dehydrogenase; Provisional	93.92
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	93.87
PRK04523		335	N-acetylornithine carbamoyltransferase; Reviewed	93.87
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	93.87
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	93.76
PRK06128		300	oxidoreductase; Provisional	93.74
PLN02178		375	cinnamyl-alcohol dehydrogenase	93.72
PRK01368		454	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.69
PRK07576		264	short chain dehydrogenase; Provisional	93.66
PRK03806		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.64
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	93.62
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.61
PRK06349		426	homoserine dehydrogenase; Provisional	93.6
TIGR03201		349	dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co	93.56
cd01338		322	MDH_choloroplast_like Chloroplast-like malate dehy	93.55
cd00704		323	MDH Malate dehydrogenase. Malate dehydrogenase (MD	93.54
PTZ00325		321	malate dehydrogenase; Provisional	93.53
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	93.46
PRK06392		326	homoserine dehydrogenase; Provisional	93.45
PRK14804		311	ornithine carbamoyltransferase; Provisional	93.44
PRK15076		431	alpha-galactosidase; Provisional	93.44
cd05294		309	LDH-like_MDH_nadp A lactate dehydrogenases-like st	93.43
PRK10206		344	putative oxidoreductase; Provisional	93.4
COG3288		356	PntA NAD/NADP transhydrogenase alpha subunit [Ener	93.37
cd05283		337	CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam	93.36
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.36
PRK03815		401	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.27
TIGR01532		325	E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas	93.26
PRK14851		679	hypothetical protein; Provisional	93.16
PRK12742		237	oxidoreductase; Provisional	93.11
PRK07877		722	hypothetical protein; Provisional	93.03
cd08237		341	ribitol-5-phosphate_DH ribitol-5-phosphate dehydro	93.02
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	93.0
PLN00106		323	malate dehydrogenase	92.96
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	92.95
PRK04663		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	92.93
PRK07200		395	aspartate/ornithine carbamoyltransferase family pr	92.86
PLN02740		381	Alcohol dehydrogenase-like	92.82
cd08281		371	liver_ADH_like1 Zinc-dependent alcohol dehydrogena	92.81
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	92.75
TIGR01772		312	MDH_euk_gproteo malate dehydrogenase, NAD-dependen	92.7
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	92.69
PRK06153		393	hypothetical protein; Provisional	92.69
TIGR02825		325	B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15	92.67
PLN02602		350	lactate dehydrogenase	92.66
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	92.63
cd01336		325	MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli	92.6
cd08234		334	threonine_DH_like L-threonine dehydrogenase. L-thr	92.46
PRK06182		273	short chain dehydrogenase; Validated	92.38
PRK04148		134	hypothetical protein; Provisional	92.34
PF03949		255	Malic_M: Malic enzyme, NAD binding domain; InterPr	92.33
cd08296		333	CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci	92.33
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	92.27
cd08245		330	CAD Cinnamyl alcohol dehydrogenases (CAD) and rela	92.27
PRK12937		245	short chain dehydrogenase; Provisional	92.25
TIGR00112		245	proC pyrroline-5-carboxylate reductase. This enzym	92.23
cd08255		277	2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_	92.17
cd08274		350	MDR9 Medium chain dehydrogenases/reductase (MDR)/z	92.11
PLN02514		357	cinnamyl-alcohol dehydrogenase	92.08
PRK08192		338	aspartate carbamoyltransferase; Provisional	92.04
PRK08324		681	short chain dehydrogenase; Validated	92.04
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	92.03
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	92.01
COG2344		211	AT-rich DNA-binding protein [General function pred	92.0
PRK10537		393	voltage-gated potassium channel; Provisional	91.97
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	91.92
PRK13376		525	pyrB bifunctional aspartate carbamoyltransferase c	91.87
cd01337		310	MDH_glyoxysomal_mitochondrial Glyoxysomal and mito	91.86
TIGR01758		324	MDH_euk_cyt malate dehydrogenase, NAD-dependent. T	91.79
PRK14874		334	aspartate-semialdehyde dehydrogenase; Provisional	91.77
PLN03154		348	putative allyl alcohol dehydrogenase; Provisional	91.72
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	91.67
PLN02383		344	aspartate semialdehyde dehydrogenase	91.67
cd08301		369	alcohol_DH_plants Plant alcohol dehydrogenase. NAD	91.62
TIGR02818		368	adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr	91.62
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	91.61
cd08242		319	MDR_like Medium chain dehydrogenases/reductase (MD	91.54
cd08260		345	Zn_ADH6 Alcohol dehydrogenases of the MDR family.	91.53
PRK13529		563	malate dehydrogenase; Provisional	91.53
PLN02695		370	GDP-D-mannose-3',5'-epimerase	91.53
PRK05678		291	succinyl-CoA synthetase subunit alpha; Validated	91.52
cd08233		351	butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog	91.5
TIGR01082		448	murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a	91.38
PRK05442		326	malate dehydrogenase; Provisional	91.36
cd08269		312	Zn_ADH9 Alcohol dehydrogenases of the MDR family.	91.32
cd08289		326	MDR_yhfp_like Yhfp putative quinone oxidoreductase	91.3
KOG0022\|consensus		375		91.24
cd08293		345	PTGR2 Prostaglandin reductase. Prostaglandins and	91.24
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	91.2
cd08295		338	double_bond_reductase_like Arabidopsis alkenal dou	91.17
PRK11863		313	N-acetyl-gamma-glutamyl-phosphate reductase; Provi	91.16
TIGR01296		339	asd_B aspartate-semialdehyde dehydrogenase (peptid	91.16
TIGR01759		323	MalateDH-SF1 malate dehydrogenase. This model repr	91.13
cd08277		365	liver_alcohol_DH_like Liver alcohol dehydrogenase.	91.12
PRK08177		225	short chain dehydrogenase; Provisional	91.1
cd05284		340	arabinose_DH_like D-arabinose dehydrogenase. This	90.97
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	90.96
PRK10309		347	galactitol-1-phosphate dehydrogenase; Provisional	90.95
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	90.93
cd01491		286	Ube1_repeat1 Ubiquitin activating enzyme (E1), rep	90.83
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	90.79
PRK14852		989	hypothetical protein; Provisional	90.78
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	90.74
PRK06398		258	aldose dehydrogenase; Validated	90.69
PRK08040		336	putative semialdehyde dehydrogenase; Provisional	90.68
cd08231		361	MDR_TM0436_like Hypothetical enzyme TM0436 resembl	90.68
PRK07523		255	gluconate 5-dehydrogenase; Provisional	90.67
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	90.62
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	90.62
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	90.6
PLN02896		353	cinnamyl-alcohol dehydrogenase	90.58
cd08264		325	Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam	90.57
PRK14573		809	bifunctional D-alanyl-alanine synthetase A/UDP-N-a	90.56
TIGR01214		287	rmlD dTDP-4-dehydrorhamnose reductase. This enzyme	90.55
PLN02827		378	Alcohol dehydrogenase-like	90.53
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	90.51
PRK06728		347	aspartate-semialdehyde dehydrogenase; Provisional	90.41
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	90.31
PLN02427		386	UDP-apiose/xylose synthase	90.27
TIGR01472		343	gmd GDP-mannose 4,6-dehydratase. Excluded from thi	90.26
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	90.21
PRK06523		260	short chain dehydrogenase; Provisional	90.19
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	90.18

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=1e-68  Score=549.48  Aligned_cols=284  Identities=39%  Similarity=0.546  Sum_probs=257.0

Q ss_pred             hHHHHHHhhccceEEEEeccCCCCHHHHhcCCCCcEEEEcCccccccchhhhhhcCeEEeecCCCCchhhHHHHHHHHHH
Q psy7383          60 TSEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCNVPGYGVEEVADTTLCLILN  139 (501)
Q Consensus        60 ~~ei~~~~l~~a~~vli~~~~~l~~e~l~~~p~LK~I~~~gaG~D~ID~~aa~~~GI~Vtn~pg~~a~aVAE~alal~L~  139 (501)
                      .+++. +.+.+++++++ ...++++++++++++||||++.++|+||||+++++++||.|+|+|+.|+.+||||++++||+
T Consensus        36 ~~~l~-~~~~~~d~~~~-~~~~v~~~~l~~~~~Lk~I~~~g~Gvd~id~~~~~~~gi~V~nap~~na~~vAE~~~~~~L~  113 (324)
T COG0111          36 EEELL-EALADADALIV-SVTPVTEEVLAAAPNLKAIGRAGAGVDNIDLEAATKRGILVVNAPGGNAISVAELVLALLLA  113 (324)
T ss_pred             hHHHH-hhcccCcEEEE-ecCCCCHHHHhhCCCceEEEEccccccccCHHHHhhcCCEEEeCCCcchHHHHHHHHHHHHH
Confidence            33444 34466776666 66789999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhHHHHHHHHHcCCccCCchhhhhhccccccccCCeEEeeccchHHHHHHHHHHhCCCEEEEECCCCCchhhhhcCce
Q psy7383         140 LYRRTYWLANMVREGKKFTGPEQLREAASGCARIRGDTLGIVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIEKSLGLT  219 (501)
Q Consensus       140 l~R~~~~~~~~~~~g~w~~~~~~~~~~~~g~~~L~gktVGIVGlG~IG~~iA~~L~afG~~Vi~~dr~~~~~~~~~~gv~  219 (501)
                      ++|++..+++.+++|.|.+..       ....+|+||||||||+|+||+.+|++|++|||+|++||++.........++.
T Consensus       114 ~~R~~~~~~~~~~~g~W~~~~-------~~g~el~gkTvGIiG~G~IG~~va~~l~afgm~v~~~d~~~~~~~~~~~~~~  186 (324)
T COG0111         114 LARRIPDADASQRRGEWDRKA-------FRGTELAGKTVGIIGLGRIGRAVAKRLKAFGMKVIGYDPYSPRERAGVDGVV  186 (324)
T ss_pred             HhcCchhhHHHHHcCCccccc-------cccccccCCEEEEECCCHHHHHHHHHHHhCCCeEEEECCCCchhhhccccce
Confidence            999999999999999997511       1234799999999999999999999999999999999998766555556677


Q ss_pred             ecCCHHHHHhcCCEEEEeccCchhhhhcccHHHHhcCCCCcEEEEcCCCCccCHHHHHHHHHcCCceEEEEecCCCCCCC
Q psy7383         220 RVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDDSLAAALKQGRIRAAALDVHESEPYN  299 (501)
Q Consensus       220 ~~~sLdelL~~sDvVil~lPlt~~T~~lI~~~~l~~MK~gAilINvaRG~vVde~aL~~aL~~g~I~GAaLDVfe~EPl~  299 (501)
                      ...+|+++|++||||++|+|+|++|++|||++.|++||+|++|||++||.+||++||+++|++|+|+||+||||++||++
T Consensus       187 ~~~~Ld~lL~~sDiv~lh~PlT~eT~g~i~~~~~a~MK~gailIN~aRG~vVde~aL~~AL~~G~i~gA~lDVf~~EPl~  266 (324)
T COG0111         187 GVDSLDELLAEADILTLHLPLTPETRGLINAEELAKMKPGAILINAARGGVVDEDALLAALDSGKIAGAALDVFEEEPLP  266 (324)
T ss_pred             ecccHHHHHhhCCEEEEcCCCCcchhcccCHHHHhhCCCCeEEEECCCcceecHHHHHHHHHcCCcceEEecCCCCCCCC
Confidence            77799999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCCCCCCCCeEEecCCCCCcHHHHHHHHHHHHHHHHHHHhCCCCCCCccccc
Q psy7383         300 VFQGNLKDAPNILCTPHAAFYSEASCTELREMAASEIRRAIVGRIPDCLRNCVN  353 (501)
Q Consensus       300 ~~~~pL~~~pNVilTPHiAg~T~ea~~~~~~~~~~ni~~~l~G~~p~~l~N~Vn  353 (501)
                      . +||||++|||++|||+|+.|.|+.+++..++++||.+|++|+.+.+..+.|+
T Consensus       267 ~-~~pL~~~pnV~~TPHia~~T~ea~~~~~~~~~~~i~~~l~g~~~~~~~~~v~  319 (324)
T COG0111         267 A-DSPLWDLPNVILTPHIGGSTDEAQERVAEIVAENIVRYLAGGPVVNNAPEVD  319 (324)
T ss_pred             C-CChhhcCCCeEECCcccccCHHHHHHHHHHHHHHHHHHHcCCCCCCCccccc
Confidence            7 7999999999999999999999999999999999999999996543233343

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PLN02306 hydroxypyruvate reductase	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>KOG0068\|consensus	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>KOG0069\|consensus	Back alignment and domain information

>KOG0067\|consensus	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>KOG0409\|consensus	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>KOG1370\|consensus	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>PRK09287 6-phosphogluconate dehydrogenase; Validated	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>PRK05472 redox-sensing transcriptional repressor Rex; Provisional	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>KOG2380\|consensus	Back alignment and domain information

>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional	Back alignment and domain information

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF)	Back alignment and domain information

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II	Back alignment and domain information

>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase	Back alignment and domain information

>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+)	Back alignment and domain information

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+))	Back alignment and domain information

>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2	Back alignment and domain information

>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01921 DAP-DH diaminopimelate dehydrogenase	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]	Back alignment and domain information

>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed	Back alignment and domain information

>PRK00676 hemA glutamyl-tRNA reductase; Validated	Back alignment and domain information

>TIGR02992 ectoine_eutC ectoine utilization protein EutC	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK14031 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK13303 L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>KOG2653\|consensus	Back alignment and domain information

>PRK06444 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK09414 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain	Back alignment and domain information

>PRK06199 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK08291 ectoine utilization protein EutC; Validated	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PLN02477 glutamate dehydrogenase	Back alignment and domain information

>PRK14030 glutamate dehydrogenase; Provisional	Back alignment and domain information

>KOG0023\|consensus	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PRK06823 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A	Back alignment and domain information

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline []	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK07589 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PRK06407 ornithine cyclodeaminase; Provisional	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional	Back alignment and domain information

>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related	Back alignment and domain information

>PRK00779 ornithine carbamoyltransferase; Provisional	Back alignment and domain information

>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2	Back alignment and domain information

>PRK11579 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>TIGR00658 orni_carb_tr ornithine carbamoyltransferase	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form	Back alignment and domain information

>PRK02102 ornithine carbamoyltransferase; Validated	Back alignment and domain information

>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN02342 ornithine carbamoyltransferase	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK04284 ornithine carbamoyltransferase; Provisional	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>KOG2304\|consensus	Back alignment and domain information

>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK01713 ornithine carbamoyltransferase; Provisional	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK11891 aspartate carbamoyltransferase; Provisional	Back alignment and domain information

>TIGR03316 ygeW probable carbamoyltransferase YgeW	Back alignment and domain information

>KOG2711\|consensus	Back alignment and domain information

>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>PRK03515 ornithine carbamoyltransferase subunit I; Provisional	Back alignment and domain information

>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>TIGR01761 thiaz-red thiazolinyl imide reductase	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases	Back alignment and domain information

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase	Back alignment and domain information

>PRK12862 malic enzyme; Reviewed	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed	Back alignment and domain information

>TIGR00036 dapB dihydrodipicolinate reductase	Back alignment and domain information

>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively	Back alignment and domain information

>PLN02527 aspartate carbamoyltransferase	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00670 asp_carb_tr aspartate carbamoyltransferase	Back alignment and domain information

>PRK02255 putrescine carbamoyltransferase; Provisional	Back alignment and domain information

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated	Back alignment and domain information

>cd00300 LDH_like L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>COG5322 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function	Back alignment and domain information

>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>PRK12562 ornithine carbamoyltransferase subunit F; Provisional	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>COG0281 SfcA Malic enzyme [Energy production and conversion]	Back alignment and domain information

>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK05086 malate dehydrogenase; Provisional	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PRK10637 cysG siroheme synthase; Provisional	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12861 malic enzyme; Reviewed	Back alignment and domain information

>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only]	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PLN02586 probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein	Back alignment and domain information

>PLN02948 phosphoribosylaminoimidazole carboxylase	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PLN02214 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>PLN02178 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06349 homoserine dehydrogenase; Provisional	Back alignment and domain information

>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase	Back alignment and domain information

>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases	Back alignment and domain information

>cd00704 MDH Malate dehydrogenase	Back alignment and domain information

>PTZ00325 malate dehydrogenase; Provisional	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>PRK06392 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK14804 ornithine carbamoyltransferase; Provisional	Back alignment and domain information

>PRK15076 alpha-galactosidase; Provisional	Back alignment and domain information

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>PRK10206 putative oxidoreductase; Provisional	Back alignment and domain information

>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion]	Back alignment and domain information

>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase	Back alignment and domain information

>PRK14851 hypothetical protein; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK07877 hypothetical protein; Provisional	Back alignment and domain information

>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PLN00106 malate dehydrogenase	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated	Back alignment and domain information

>PLN02740 Alcohol dehydrogenase-like	Back alignment and domain information

>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>PRK06153 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases	Back alignment and domain information

>cd08234 threonine_DH_like L-threonine dehydrogenase	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e	Back alignment and domain information

>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR00112 proC pyrroline-5-carboxylate reductase	Back alignment and domain information

>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members	Back alignment and domain information

>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PLN02514 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK08192 aspartate carbamoyltransferase; Provisional	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>COG2344 AT-rich DNA-binding protein [General function prediction only]	Back alignment and domain information

>PRK10537 voltage-gated potassium channel; Provisional	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional	Back alignment and domain information

>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases	Back alignment and domain information

>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PLN03154 putative allyl alcohol dehydrogenase; Provisional	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>PLN02383 aspartate semialdehyde dehydrogenase	Back alignment and domain information

>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase	Back alignment and domain information

>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK13529 malate dehydrogenase; Provisional	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PRK05678 succinyl-CoA synthetase subunit alpha; Validated	Back alignment and domain information

>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase	Back alignment and domain information

>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase	Back alignment and domain information

>PRK05442 malate dehydrogenase; Provisional	Back alignment and domain information

>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases	Back alignment and domain information

>KOG0022\|consensus	Back alignment and domain information

>cd08293 PTGR2 Prostaglandin reductase	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase	Back alignment and domain information

>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional	Back alignment and domain information

>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>TIGR01759 MalateDH-SF1 malate dehydrogenase	Back alignment and domain information

>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd05284 arabinose_DH_like D-arabinose dehydrogenase	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK08040 putative semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase	Back alignment and domain information

>PLN02827 Alcohol dehydrogenase-like	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>TIGR01472 gmd GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

Homologous Structure Templates