Psyllid ID: psy7395

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MSEDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
cccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHccccEEEEccccHHHHHHHHHccccHHHHHccccccccccHHccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHcHHHHHcccEEEEEEccHHHHHHHHcc
cccccEEEEEEEcccEHHHHccEccccccccEcHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHcccccEEEcHHHcccccHHHcccEHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHcHHHHHHccccEEEEEcHHHHHHHHHHHccccHHHHHHccccccccEEEEEcccccEEEEEEcccHHHHHHHcHHHHHcccccccccccHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHcHHHHHHccccEEEEEcHHHHHHHHHHH
MSEDCYTLVMLRHgesewtkrnlfcgwydsklsengiKEAHVAGQIlrdegfqfdhvftsQLSRAQDTVQIILQElgqspevtkswrlnerhygdltgynKLQMANKYGLEQVQIWRRsydvlpppmtkdhkyyqdiitnpnfkidgpnedqfphteSLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEImklniptaipfvykldanltptkprqflcdEETVSKAMEKILKVHvgrpwglqSHVFLLGINNNFARFQVQIWRRsydvlpppmtkdhkyyqdiitnpnfkidgpnedqfphteSLKETIMRVLPYWNENIATEIKQGKKVLVVTHGtslrglvkhi
MSEDCYTLVMLrhgesewtkrNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQElgqspevtkswrlnerHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHgtslrglvkhi
MSEDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
****CYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKID***********SLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKID***********SLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRG*****
***DCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
MSEDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
**EDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQSPEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSKAMEKILKVHVGRPWGLQSHVFLLGINNNFARFQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q5ZLN1254 Phosphoglycerate mutase 1 yes N/A 0.665 0.956 0.536 5e-73
O70250253 Phosphoglycerate mutase 2 yes N/A 0.663 0.956 0.530 3e-71
P16290253 Phosphoglycerate mutase 2 yes N/A 0.663 0.956 0.526 6e-71
P15259253 Phosphoglycerate mutase 2 yes N/A 0.663 0.956 0.530 7e-71
Q32KV0253 Phosphoglycerate mutase 2 yes N/A 0.663 0.956 0.534 4e-69
B7J2L3248 2,3-bisphosphoglycerate-d yes N/A 0.654 0.963 0.546 5e-69
O51602248 2,3-bisphosphoglycerate-d yes N/A 0.654 0.963 0.546 5e-69
Q0SMJ5248 2,3-bisphosphoglycerate-d yes N/A 0.654 0.963 0.551 6e-69
P25113254 Phosphoglycerate mutase 1 no N/A 0.665 0.956 0.552 6e-69
Q9DBJ1254 Phosphoglycerate mutase 1 no N/A 0.665 0.956 0.552 6e-69
>sp|Q5ZLN1|PGAM1_CHICK Phosphoglycerate mutase 1 OS=Gallus gallus GN=PGAM1 PE=1 SV=3 Back     alignment and function desciption
 Score =  275 bits (702), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 132/246 (53%), Positives = 167/246 (67%), Gaps = 3/246 (1%)

Query: 5   CYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSR 64
            Y LV++RHGES W   N FCGWYD+ LS  G +EA   G+ LRD G++FD  FTS   R
Sbjct: 3   AYRLVLVRHGESAWNLENRFCGWYDADLSPAGQQEARRGGEALRDAGYEFDICFTSVQKR 62

Query: 65  AQDTVQIILQELGQS-PEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVL 123
           A  T+  +L  + Q    V ++WRLNERHYG LTG NK + A K+G  QV+IWRRS+D+ 
Sbjct: 63  AIRTLWNVLDAIDQMWLPVVRTWRLNERHYGALTGLNKAETAAKHGEAQVKIWRRSFDIP 122

Query: 124 PPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKK 183
           PPPM  DH ++  I  +  +      EDQ P  ESLK+TI R LP+WNE I  +IK+GK+
Sbjct: 123 PPPMQSDHPFFSTISKDRRYA--DLTEDQLPTCESLKDTIARALPFWNEEIVPQIKEGKR 180

Query: 184 VLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVS 243
           VL+  HG SLRG+VKH+E +S+  IM+LN+PT IP VY+LD NL P KP QFL DEETV 
Sbjct: 181 VLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR 240

Query: 244 KAMEKI 249
           KAME +
Sbjct: 241 KAMEAV 246
Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Gallus gallus (taxid: 9031)
EC: 5EC: .EC: 4EC: .EC: 2EC: .EC: 4
>sp|O70250|PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus GN=Pgam2 PE=1 SV=3 Back     alignment and function description
>sp|P16290|PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus GN=Pgam2 PE=2 SV=2 Back     alignment and function description
>sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 Back     alignment and function description
>sp|Q32KV0|PGAM2_BOVIN Phosphoglycerate mutase 2 OS=Bos taurus GN=PGAM2 PE=2 SV=1 Back     alignment and function description
>sp|B7J2L3|GPMA_BORBZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ZS7) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|O51602|GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gpmA PE=1 SV=2 Back     alignment and function description
>sp|Q0SMJ5|GPMA_BORAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia afzelii (strain PKo) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|P25113|PGAM1_RAT Phosphoglycerate mutase 1 OS=Rattus norvegicus GN=Pgam1 PE=1 SV=4 Back     alignment and function description
>sp|Q9DBJ1|PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus GN=Pgam1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
91092672256 PREDICTED: similar to putative phosphogl 0.665 0.949 0.607 2e-83
91078204256 PREDICTED: similar to putative phosphogl 0.665 0.949 0.587 5e-81
195396194299 GJ11087 [Drosophila virilis] gi|19414342 0.682 0.832 0.565 1e-80
121543655254 putative phosphoglycerate mutase [Macone 0.665 0.956 0.583 1e-80
332373932254 unknown [Dendroctonus ponderosae] 0.665 0.956 0.575 8e-80
195111954293 GI10280 [Drosophila mojavensis] gi|19391 0.682 0.849 0.553 2e-79
307203820254 Phosphoglycerate mutase 1 [Harpegnathos 0.646 0.929 0.592 4e-79
413965926255 phosphoglycerate mutase [Plutella xylost 0.665 0.952 0.571 6e-79
225717600256 Phosphoglycerate mutase 2 [Caligus cleme 0.668 0.953 0.573 6e-79
225708832256 Phosphoglycerate mutase 2 [Caligus roger 0.668 0.953 0.577 8e-79
>gi|91092672|ref|XP_971117.1| PREDICTED: similar to putative phosphoglycerate mutase [Tribolium castaneum] gi|270014862|gb|EFA11310.1| hypothetical protein TcasGA2_TC010847 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  315 bits (807), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 150/247 (60%), Positives = 187/247 (75%), Gaps = 4/247 (1%)

Query: 6   YTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRA 65
           Y +VM+RHGESEW ++NLFCGWYD+ LSE G +EA  AG+ L+D G++FD  +TS L+RA
Sbjct: 4   YKIVMVRHGESEWNEKNLFCGWYDANLSEKGKQEAVSAGKALKDAGYKFDIAYTSVLTRA 63

Query: 66  QDTVQIILQELGQSP-EVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLP 124
           Q+T+Q IL+E+GQ+   V K+WRLNERHYG LTG NK + A KYG EQV IWRRS+DV P
Sbjct: 64  QNTLQSILKEIGQTDLPVVKTWRLNERHYGGLTGLNKAETAAKYGDEQVAIWRRSFDVPP 123

Query: 125 PPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKV 184
           P M  DH YY++I+ +P +K DGP  DQFP  ESLK TI R LP+WN+ I  EIK GK++
Sbjct: 124 PAMEPDHPYYENIVKDPRYK-DGPAPDQFPKYESLKLTIERTLPFWNDTIVPEIKAGKQI 182

Query: 185 LVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTK--PRQFLCDEETV 242
           L+  HG SLRG+VKH++Q+SD +IMKLN+PT IPFVY LD NL PT     QFL D ETV
Sbjct: 183 LIAAHGNSLRGIVKHLDQMSDEQIMKLNLPTGIPFVYILDENLKPTANGSLQFLGDPETV 242

Query: 243 SKAMEKI 249
            KAME +
Sbjct: 243 KKAMEAV 249

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91078204|ref|XP_966314.1| PREDICTED: similar to putative phosphoglycerate mutase [Tribolium castaneum] gi|270002362|gb|EEZ98809.1| hypothetical protein TcasGA2_TC001380 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195396194|ref|XP_002056717.1| GJ11087 [Drosophila virilis] gi|194143426|gb|EDW59829.1| GJ11087 [Drosophila virilis] Back     alignment and taxonomy information
>gi|121543655|gb|ABM55529.1| putative phosphoglycerate mutase [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|332373932|gb|AEE62107.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|195111954|ref|XP_002000541.1| GI10280 [Drosophila mojavensis] gi|193917135|gb|EDW16002.1| GI10280 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|307203820|gb|EFN82756.1| Phosphoglycerate mutase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|413965926|gb|AFW90042.1| phosphoglycerate mutase [Plutella xylostella] Back     alignment and taxonomy information
>gi|225717600|gb|ACO14646.1| Phosphoglycerate mutase 2 [Caligus clemensi] Back     alignment and taxonomy information
>gi|225708832|gb|ACO10262.1| Phosphoglycerate mutase 2 [Caligus rogercresseyi] gi|225711190|gb|ACO11441.1| Phosphoglycerate mutase 2 [Caligus rogercresseyi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
FB|FBgn0014869255 Pglym78 "Phosphoglyceromutase" 0.665 0.952 0.546 6.7e-72
FB|FBgn0011270309 Pglym87 "Pglym87" [Drosophila 0.663 0.783 0.556 6.1e-71
ZFIN|ZDB-GENE-030131-1827254 pgam1a "phosphoglycerate mutas 0.660 0.948 0.544 2.4e-69
ZFIN|ZDB-GENE-040116-6255 pgam2 "phosphoglycerate mutase 0.663 0.949 0.542 3.8e-69
UNIPROTKB|Q3SZ62254 PGAM1 "Phosphoglycerate mutase 0.660 0.948 0.556 1e-68
UNIPROTKB|E2RT65254 PGAM1 "Uncharacterized protein 0.660 0.948 0.556 1e-68
UNIPROTKB|P18669254 PGAM1 "Phosphoglycerate mutase 0.660 0.948 0.556 1e-68
UNIPROTKB|F1S8Y5258 LOC100524527 "Uncharacterized 0.660 0.934 0.556 1e-68
MGI|MGI:97552254 Pgam1 "phosphoglycerate mutase 0.660 0.948 0.556 1e-68
RGD|3312254 Pgam1 "phosphoglycerate mutase 0.660 0.948 0.556 1e-68
FB|FBgn0014869 Pglym78 "Phosphoglyceromutase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
 Identities = 134/245 (54%), Positives = 174/245 (71%)

Query:     6 YTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRA 65
             Y +VM+RHGESEW ++N FCGWYD+ LSE G +EA  AG+ ++D G +FD   TS L+RA
Sbjct:     5 YKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRA 64

Query:    66 QDTVQIILQELGQSP-EVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLP 124
             Q T+  IL+  G     + K+WRLNERHYG LTG NK + A KYG  QVQIWRRS+D  P
Sbjct:    65 QVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPP 124

Query:   125 PPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKV 184
             PPM   H YY++I+ +P +  +GP  ++FP  ESLK TI R LPYWN+ I  ++K+GK++
Sbjct:   125 PPMEPGHPYYENIVKDPRYA-EGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRI 183

Query:   185 LVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSK 244
             L+  HG SLRG+VKH++ LS+  IM LN+PT IPFVY+LD N  P    QFL DEETV K
Sbjct:   184 LIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKK 243

Query:   245 AMEKI 249
             A+E +
Sbjct:   244 AIEAV 248
GO:0004619 "phosphoglycerate mutase activity" evidence=ISS;NAS
GO:0031430 "M band" evidence=IDA
GO:0030018 "Z disc" evidence=IDA
GO:0006096 "glycolysis" evidence=IEA
FB|FBgn0011270 Pglym87 "Pglym87" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1827 pgam1a "phosphoglycerate mutase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040116-6 pgam2 "phosphoglycerate mutase 2 (muscle)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ62 PGAM1 "Phosphoglycerate mutase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RT65 PGAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P18669 PGAM1 "Phosphoglycerate mutase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8Y5 LOC100524527 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97552 Pgam1 "phosphoglycerate mutase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3312 Pgam1 "phosphoglycerate mutase 1 (brain)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O51602GPMA_BORBU5, ., 4, ., 2, ., 10.54690.65470.9637yesN/A
B7N9Z7GPMA_ECOLU5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
Q5P7N4GPMA_AROAE5, ., 4, ., 2, ., 10.46530.65470.9598yesN/A
P16290PGAM2_RAT5, ., 4, ., 2, ., 40.52650.66300.9565yesN/A
Q324G4GPMA_SHIBS5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
B5RQ00GPMA_BORRA5, ., 4, ., 2, ., 10.52650.65470.956yesN/A
B4RZM6GPMA_ALTMD5, ., 4, ., 2, ., 10.45960.66300.9758yesN/A
Q3Z455GPMA_SHISS5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
C0QV47GPMA_BRAHW5, ., 4, ., 2, ., 10.48970.64930.9556yesN/A
P62710GPMA_SHIFL5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
A7ZY11GPMA_ECOHS5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
O70250PGAM2_MOUSE5, ., 4, ., 2, ., 40.53060.66300.9565yesN/A
B3QPN8GPMA_CHLP85, ., 4, ., 2, ., 10.47750.65470.9676yesN/A
Q0TJU6GPMA_ECOL55, ., 4, ., 2, ., 10.48720.63010.92yesN/A
A1A8Z8GPMA_ECOK15, ., 4, ., 2, ., 10.48720.63010.92yesN/A
B1IXY1GPMA_ECOLC5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
Q39V40GPMA_GEOMG5, ., 4, ., 2, ., 10.50830.63560.9392yesN/A
B7J2L3GPMA_BORBZ5, ., 4, ., 2, ., 10.54690.65470.9637yesN/A
P62708GPMA_ECOL65, ., 4, ., 2, ., 10.48720.63010.92yesN/A
Q2Y9Z7GPMA2_NITMU5, ., 4, ., 2, ., 10.49380.64930.9442yesN/A
B2TUY6GPMA_SHIB35, ., 4, ., 2, ., 10.48720.63010.92yesN/A
B6I7Q9GPMA_ECOSE5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
A1R083GPMA_BORT95, ., 4, ., 2, ., 10.51830.65470.9637yesN/A
B2S101GPMA_BORHD5, ., 4, ., 2, ., 10.51830.65470.9637yesN/A
Q0T6Y5GPMA_SHIF85, ., 4, ., 2, ., 10.48720.63010.92yesN/A
B5RMK4GPMA_BORDL5, ., 4, ., 2, ., 10.53060.65470.956yesN/A
Q5ZLN1PGAM1_CHICK5, ., 4, ., 2, ., 40.53650.66570.9566yesN/A
Q660L2GPMA_BORGA5, ., 4, ., 2, ., 10.54280.65470.9637yesN/A
B7LK04GPMA_ESCF35, ., 4, ., 2, ., 10.48720.63010.92yesN/A
Q8R7C8GPMA_THETN5, ., 4, ., 2, ., 10.51620.65750.9638yesN/A
C5BJ25GPMA_TERTT5, ., 4, ., 2, ., 10.45960.66300.9758yesN/A
P15259PGAM2_HUMAN5, ., 4, ., 2, ., 40.53060.66300.9565yesN/A
B1LM46GPMA_ECOSM5, ., 4, ., 2, ., 10.48720.63010.92yesN/A
Q32KV0PGAM2_BOVIN5, ., 4, ., 2, ., 40.53460.66300.9565yesN/A
P30798GPMA_ZYMMO5, ., 4, ., 2, ., 10.53410.61090.9780yesN/A
Q0SMJ5GPMA_BORAP5, ., 4, ., 2, ., 10.55100.65470.9637yesN/A
Q2FTH0GPMA_METHJ5, ., 4, ., 2, ., 10.49200.63560.9354yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
4th Layer5.4.2.10.824
3rd Layer5.4.20.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
PRK14115247 PRK14115, gpmA, phosphoglyceromutase; Provisional 1e-117
TIGR01258245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep 1e-112
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 1e-108
PTZ00123236 PTZ00123, PTZ00123, phosphoglycerate mutase like-p 7e-99
PRK14120249 PRK14120, gpmA, phosphoglyceromutase; Provisional 4e-90
PRK14118227 PRK14118, gpmA, phosphoglyceromutase; Provisional 1e-75
PRK14117230 PRK14117, gpmA, phosphoglyceromutase; Provisional 9e-75
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisio 4e-73
PRK14116228 PRK14116, gpmA, phosphoglyceromutase; Provisional 2e-70
PRK14119228 PRK14119, gpmA, phosphoglyceromutase; Provisional 4e-69
PRK01112228 PRK01112, PRK01112, phosphoglyceromutase; Provisio 6e-56
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 6e-49
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 2e-35
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 4e-34
PRK14115247 PRK14115, gpmA, phosphoglyceromutase; Provisional 2e-33
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 4e-31
TIGR01258245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep 5e-31
PTZ00123236 PTZ00123, PTZ00123, phosphoglycerate mutase like-p 8e-30
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 2e-28
cd07040153 cd07040, HP, Histidine phosphatase domain found in 4e-27
PRK14120249 PRK14120, gpmA, phosphoglyceromutase; Provisional 3e-24
PRK14117230 PRK14117, gpmA, phosphoglyceromutase; Provisional 8e-22
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphata 3e-20
PRK14119228 PRK14119, gpmA, phosphoglyceromutase; Provisional 1e-19
PRK14118227 PRK14118, gpmA, phosphoglyceromutase; Provisional 4e-18
PRK14116228 PRK14116, gpmA, phosphoglyceromutase; Provisional 6e-16
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 1e-14
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisio 8e-14
cd07040153 cd07040, HP, Histidine phosphatase domain found in 3e-13
PRK03482215 PRK03482, PRK03482, phosphoglycerate mutase; Provi 2e-12
PRK15004199 PRK15004, PRK15004, alpha-ribazole phosphatase; Pr 1e-11
PRK01112228 PRK01112, PRK01112, phosphoglyceromutase; Provisio 2e-11
COG2062163 COG2062, SixA, Phosphohistidine phosphatase SixA [ 2e-11
PRK07238372 PRK07238, PRK07238, bifunctional RNase H/acid phos 2e-11
TIGR03848204 TIGR03848, MSMEG_4193, probable phosphomutase, MSM 2e-09
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 6e-09
cd07040153 cd07040, HP, Histidine phosphatase domain found in 3e-06
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 7e-06
PRK13462203 PRK13462, PRK13462, acid phosphatase; Provisional 8e-06
TIGR00249152 TIGR00249, sixA, phosphohistidine phosphatase SixA 1e-05
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 3e-05
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 7e-04
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information 
 Score =  339 bits (871), Expect = e-117
 Identities = 129/244 (52%), Positives = 166/244 (68%), Gaps = 8/244 (3%)

Query: 6   YTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRA 65
             LV++RHGES+W K N F GW D  LSE G+ EA  AG++L++EG+ FD  +TS L RA
Sbjct: 1   TKLVLIRHGESQWNKENRFTGWTDVDLSEKGVSEAKAAGKLLKEEGYTFDVAYTSVLKRA 60

Query: 66  QDTVQIILQELGQS--PEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVL 123
             T+ I+L EL Q   P V KSWRLNERHYG L G NK + A KYG EQV+IWRRSYDV 
Sbjct: 61  IRTLWIVLDELDQMWLP-VEKSWRLNERHYGALQGLNKAETAAKYGDEQVKIWRRSYDVP 119

Query: 124 PPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKK 183
           PP + KD + Y     +P +      E++ P TESLK+TI RVLPYWNE IA ++K GK+
Sbjct: 120 PPALEKDDERYP--GHDPRYA--KLPEEELPLTESLKDTIARVLPYWNETIAPQLKSGKR 175

Query: 184 VLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVS 243
           VL+  HG SLR LVK+++ +SD EI++LNIPT +P VY+LD NL P K   +L D + ++
Sbjct: 176 VLIAAHGNSLRALVKYLDNISDEEILELNIPTGVPLVYELDENLKPIK-HYYLGDADEIA 234

Query: 244 KAME 247
            A  
Sbjct: 235 AAAA 238

Length = 247
>gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|224973 COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|139587 PRK13462, PRK13462, acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|129351 TIGR00249, sixA, phosphohistidine phosphatase SixA Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 100.0
PRK14119228 gpmA phosphoglyceromutase; Provisional 100.0
PRK14116228 gpmA phosphoglyceromutase; Provisional 100.0
PRK14117230 gpmA phosphoglyceromutase; Provisional 100.0
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 100.0
PRK14120249 gpmA phosphoglyceromutase; Provisional 100.0
PRK14115247 gpmA phosphoglyceromutase; Provisional 100.0
PRK14118227 gpmA phosphoglyceromutase; Provisional 100.0
PRK01295206 phosphoglyceromutase; Provisional 100.0
PRK01112228 phosphoglyceromutase; Provisional 100.0
PRK13463203 phosphatase PhoE; Provisional 100.0
PRK15004199 alpha-ribazole phosphatase; Provisional 100.0
KOG0235|consensus214 100.0
PRK13462203 acid phosphatase; Provisional 100.0
PRK03482215 phosphoglycerate mutase; Provisional 100.0
COG0406208 phoE Broad specificity phosphatase PhoE and relate 100.0
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 100.0
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 100.0
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 100.0
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 100.0
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.97
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.97
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.97
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.95
PTZ00122299 phosphoglycerate mutase; Provisional 99.93
cd07067153 HP_PGM_like Histidine phosphatase domain found in 99.92
PRK14119228 gpmA phosphoglyceromutase; Provisional 99.9
PRK14117230 gpmA phosphoglyceromutase; Provisional 99.88
PRK14116228 gpmA phosphoglyceromutase; Provisional 99.88
TIGR00249152 sixA phosphohistidine phosphatase SixA. 99.87
cd07040153 HP Histidine phosphatase domain found in a functio 99.87
PRK14118227 gpmA phosphoglyceromutase; Provisional 99.86
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.86
PRK14115247 gpmA phosphoglyceromutase; Provisional 99.84
PRK10848159 phosphohistidine phosphatase; Provisional 99.84
PRK14120249 gpmA phosphoglyceromutase; Provisional 99.84
PRK01112228 phosphoglyceromutase; Provisional 99.83
KOG4609|consensus284 99.83
KOG0235|consensus214 99.82
PRK06193206 hypothetical protein; Provisional 99.82
PRK13463203 phosphatase PhoE; Provisional 99.81
KOG0234|consensus438 99.81
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 99.8
KOG4754|consensus248 99.8
PRK01295206 phosphoglyceromutase; Provisional 99.8
PRK15004199 alpha-ribazole phosphatase; Provisional 99.8
KOG3734|consensus272 99.8
PRK13462203 acid phosphatase; Provisional 99.79
PRK03482215 phosphoglycerate mutase; Provisional 99.79
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.78
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.77
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 99.75
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.74
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.71
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.69
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.67
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.66
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.62
PTZ00122299 phosphoglycerate mutase; Provisional 99.13
KOG0234|consensus438 98.98
cd07067153 HP_PGM_like Histidine phosphatase domain found in 98.69
PRK06193206 hypothetical protein; Provisional 98.48
cd07040153 HP Histidine phosphatase domain found in a functio 98.47
KOG3734|consensus272 98.1
cd07061242 HP_HAP_like Histidine phosphatase domain found in 97.92
TIGR00249152 sixA phosphohistidine phosphatase SixA. 97.86
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 97.64
KOG4609|consensus284 97.53
KOG4754|consensus248 97.46
PF00328347 His_Phos_2: Histidine phosphatase superfamily (bra 97.0
KOG3720|consensus411 96.15
PRK10848159 phosphohistidine phosphatase; Provisional 96.07
PRK10172436 phosphoanhydride phosphorylase; Provisional 95.64
PRK10173413 glucose-1-phosphatase/inositol phosphatase; Provis 95.24
KOG1057|consensus 1018 89.68
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 88.59
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-43  Score=295.56  Aligned_cols=223  Identities=53%  Similarity=0.912  Sum_probs=213.2

Q ss_pred             cEEEEEEeccCCCcCccCcccccCCCCCCHhhHHHHHHHHHHHHhcCCCcCEEEEcccHHHHHHHHHHHHHcCC-CCCce
Q psy7395           5 CYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQ-SPEVT   83 (365)
Q Consensus         5 ~~~i~lvRHGes~~n~~~~~~g~~D~~Lte~G~~Qa~~l~~~L~~~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~-~~~~~   83 (365)
                      |++++|+|||||+||..+.|.||.|.+||+.|+.||...|+.|++.++.||.+|||-+.||++|+.+++++.+. .+++.
T Consensus         1 ~~~Lvl~RHGqSeWN~~NlFtGW~Dv~LtekG~~EA~~ag~llk~~~~~~dia~TS~L~RAi~T~~i~L~e~d~~~ipv~   80 (230)
T COG0588           1 MMKLVLLRHGQSEWNKENLFTGWVDVDLTEKGISEAKAAGKLLKEEGLEFDIAYTSVLKRAIKTLNIVLEESDQLWIPVI   80 (230)
T ss_pred             CceEEEEecCchhhhhcCceeeeeecCcchhhHHHHHHHHHHHHHcCCCcceeehHHHHHHHHHHHHHhhhhcccCcchh
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999876 78999


Q ss_pred             eccCccccccCCCCCCCHHHHHHHhcHHHHHHHHHhcCCCCCCCCCCcchhhhhhcCCCCcCCCCCCCCCCCCCCHHHHH
Q psy7395          84 KSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETI  163 (365)
Q Consensus        84 ~~~~L~E~~~g~~eg~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~p~~Es~~~~~  163 (365)
                      ..++|+|++||.++|++..+..++|+++++..|+++++++||++..++++++.  .|.+|.  .......|..||..++.
T Consensus        81 kswrLNERhYG~LqGlnK~~t~~kyGeeqv~~wRRsydi~PP~~~~~~~~~~~--~d~ry~--~~~~~~~p~~EsLkdt~  156 (230)
T COG0588          81 KSWRLNERHYGALQGLNKAETAAKYGEEQVLIWRRSYDIPPPKLEKDDERSPH--RDRRYA--HLDIGGLPLTESLKDTV  156 (230)
T ss_pred             hHHHhhhhhhhhhhcCChHHHHHHHhHHHHHHHHHhcCCCCCCcccccccccc--cccccc--cccccCCCccchHHHHH
Confidence            99999999999999999999999999999999999999999999999999988  888888  66667788899999999


Q ss_pred             HHHHHHHHHHHHHhhhCCCEEEEEecchHHHHHHHHHcCCChhhhhcccCCCcceEEEEecCCCCCcC
Q psy7395         164 MRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTK  231 (365)
Q Consensus       164 ~R~~~~~~~~i~~~~~~~~~iliV~Hg~t~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  231 (365)
                      +|+..+|+..|...+..+++|+||+||.++++++.++.|.++..+....+|+|.++++++++++..+.
T Consensus       157 ~Rv~Pyw~~~I~p~l~~Gk~VlI~AHGNSlRaLiK~L~~iSd~dI~~l~IPtg~Plvyeld~~l~~~~  224 (230)
T COG0588         157 ERVLPYWEDDIAPNLKSGKNVLIVAHGNSLRALIKYLEGISDEDILDLNIPTGIPLVYELDKNLKVIS  224 (230)
T ss_pred             HHhhHHHHHHhhHHHhCCCeEEEEecchhHHHHHHHHhCCCHHHhhhcccCCCCcEEEEECCCCcCcc
Confidence            99999999989999999999999999999999999999999999999999999999999999887665

>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>KOG0235|consensus Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>KOG4609|consensus Back     alignment and domain information
>KOG0235|consensus Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>KOG0234|consensus Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>KOG4754|consensus Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>KOG3734|consensus Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>KOG0234|consensus Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>KOG3734|consensus Back     alignment and domain information
>cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG4609|consensus Back     alignment and domain information
>KOG4754|consensus Back     alignment and domain information
>PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>KOG3720|consensus Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>PRK10172 phosphoanhydride phosphorylase; Provisional Back     alignment and domain information
>PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional Back     alignment and domain information
>KOG1057|consensus Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1yfk_A262 Crystal Structure Of Human B Type Phosphoglycerate 4e-70
1yfk_A262 Crystal Structure Of Human B Type Phosphoglycerate 8e-20
4emb_A274 Crystal Structure Of A Phosphoglycerate Mutase Gpma 1e-68
4emb_A274 Crystal Structure Of A Phosphoglycerate Mutase Gpma 1e-16
1t8p_A267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 1e-68
1t8p_A267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 4e-23
2hhj_A267 Human Bisphosphoglycerate Mutase Complexed With 2,3 1e-67
2hhj_A267 Human Bisphosphoglycerate Mutase Complexed With 2,3 4e-23
1xq9_A258 Structure Of Phosphoglycerate Mutase From Plasmodiu 3e-62
1xq9_A258 Structure Of Phosphoglycerate Mutase From Plasmodiu 7e-18
3kkk_A258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 3e-61
3kkk_A258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 2e-17
1e59_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 8e-61
1e59_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 4e-15
1e58_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 7e-60
1e58_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 3e-15
3ezn_A257 Crystal Structure Of Phosphoglyceromutase From Burk 2e-57
3ezn_A257 Crystal Structure Of Phosphoglyceromutase From Burk 1e-15
3lnt_A250 Crystal Structure Of Phosphoglyceromutase From Burk 2e-57
3lnt_A250 Crystal Structure Of Phosphoglyceromutase From Burk 2e-15
1qhf_A240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 2e-57
1qhf_A240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 2e-14
4pgm_A246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 3e-57
4pgm_A246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 2e-14
3fdz_B257 Crystal Structure Of Phosphoglyceromutase From Burk 2e-56
3fdz_B257 Crystal Structure Of Phosphoglyceromutase From Burk 1e-15
3d8h_A267 Crystal Structure Of Phosphoglycerate Mutase From C 4e-53
3d8h_A267 Crystal Structure Of Phosphoglycerate Mutase From C 9e-12
3pgm_A244 The Structure Of Yeast Phosphoglycerate Mutase At 0 9e-53
3pgm_A244 The Structure Of Yeast Phosphoglycerate Mutase At 0 4e-12
4eo9_A268 Crystal Structure Of A Phosphoglycerate Mutase Gpm1 4e-51
4eo9_A268 Crystal Structure Of A Phosphoglycerate Mutase Gpm1 8e-14
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 1e-50
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 2e-10
1rii_A265 Crystal Structure Of Phosphoglycerate Mutase From M 1e-49
1rii_A265 Crystal Structure Of Phosphoglycerate Mutase From M 2e-14
3dcy_A275 Crystal Structure A Tp53-Induced Glycolysis And Apo 1e-08
3e9c_A265 Structure Of A Tryptic Core Fragment Of Tigar From 2e-07
1h2e_A207 Bacillus Stearothermophilus Phoe (Previously Known 5e-07
1ebb_A202 Bacillus Stearothermophilus Yhfr Length = 202 5e-07
3e9e_A265 Structure Of Full-Length H11a Mutant Form Of Tigar 2e-06
3f3k_A265 The Structure Of Uncharacterized Protein Ykr043c Fr 5e-04
2a6p_A208 Structure Solution To 2.2 Angstrom And Functional C 7e-04
3lg2_A292 A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex 7e-04
>pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure 
Iteration: 1

 Score =  261 bits (667), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 167/246 (67%), Gaps = 3/246 (1%)
Query: 5   CYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSR 64
            Y LV++RHGES W   N F GWYD+ LS  G +EA   GQ LRD G++FD  FTS   R
Sbjct: 3   AYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKR 62
Query: 65  AQDTVQIILQELGQS-PEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVL 123
           A  T+  +L  + Q    V ++WRLNERHYG LTG NK + A K+G  QV+IWRRSYDV 
Sbjct: 63  AIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVP 122
Query: 124 PPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKK 183
           PPPM  DH +Y +I  +  +      EDQ P  ESLK+TI R LP+WNE I  +IK+GK+
Sbjct: 123 PPPMEPDHPFYSNISKDRRYA--DLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR 180
Query: 184 VLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVS 243
           VL+  HG SLRG+VKH+E LS+  IM+LN+PT IP VY+LD NL P KP QFL DEETV 
Sbjct: 181 VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR 240
Query: 244 KAMEKI 249
           KAME +
Sbjct: 241 KAMEAV 246
>pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure
>pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 Back     alignment and structure
>pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 Back     alignment and structure
>pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 Back     alignment and structure
>pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 Back     alignment and structure
>pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
>pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
>pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure
>pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure
>pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 Back     alignment and structure
>pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 Back     alignment and structure
>pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 Back     alignment and structure
>pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 Back     alignment and structure
>pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 Back     alignment and structure
>pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 Back     alignment and structure
>pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure
>pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure
>pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 Back     alignment and structure
>pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 Back     alignment and structure
>pdb|3DCY|A Chain A, Crystal Structure A Tp53-Induced Glycolysis And Apoptosis Regulator Protein From Homo Sapiens Length = 275 Back     alignment and structure
>pdb|3E9C|A Chain A, Structure Of A Tryptic Core Fragment Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 Back     alignment and structure
>pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 Back     alignment and structure
>pdb|3E9E|A Chain A, Structure Of Full-Length H11a Mutant Form Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>pdb|3F3K|A Chain A, The Structure Of Uncharacterized Protein Ykr043c From Saccharomyces Cerevisiae. Length = 265 Back     alignment and structure
>pdb|2A6P|A Chain A, Structure Solution To 2.2 Angstrom And Functional Characterisation Of The Open Reading Frame Rv3214 From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>pdb|3LG2|A Chain A, A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex Following Ligand Soaking Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 1e-141
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 5e-42
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 1e-139
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 7e-40
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-135
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-36
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 1e-135
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 9e-38
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 1e-135
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 2e-37
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-134
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 2e-37
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-134
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 4e-37
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 1e-134
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 1e-37
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 1e-134
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 1e-37
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-131
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 3e-36
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 1e-117
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 3e-27
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 2e-89
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 1e-19
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 2e-74
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 2e-15
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 2e-69
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 2e-09
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 6e-48
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 4e-20
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 1e-44
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 6e-07
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 5e-43
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 2e-42
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 1e-06
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 4e-41
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 2e-05
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 8e-37
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 2e-05
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 5e-34
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 6e-06
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 9e-32
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 3e-04
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 2e-28
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 9e-09
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 6e-26
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 3e-07
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 1e-21
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 2e-21
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 4e-20
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 7e-13
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 1e-12
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 Back     alignment and structure
 Score =  401 bits (1032), Expect = e-141
 Identities = 120/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 6   YTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRA 65
           Y L+MLRHGE  W K N FC W D KL+  G++EA   G+ L+   F+FD VFTS L+R+
Sbjct: 4   YKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRS 63

Query: 66  QDTVQIILQELGQS-PEVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLP 124
             T  +IL+ELGQ    V  SWRLNERHYG L G N+ QMA  +G EQV++WRRSY+V P
Sbjct: 64  IHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTP 123

Query: 125 PPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKV 184
           PP+ + H YYQ+I  +  +K+     DQ P +ESLK+ + R+LPYWNE IA E+ +GK +
Sbjct: 124 PPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTI 183

Query: 185 LVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSK 244
           L+  HG S R L+KH+E +SD +I+ + +PT +P + +LD NL    P QFL D+E +  
Sbjct: 184 LISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQA 243

Query: 245 AMEKI 249
           A++K+
Sbjct: 244 AIKKV 248
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Length = 173 Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Length = 161 Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Length = 172 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 100.0
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 100.0
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 100.0
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 100.0
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 100.0
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 100.0
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 100.0
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 100.0
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 100.0
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 100.0
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 100.0
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 100.0
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 100.0
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 100.0
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 100.0
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 100.0
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 100.0
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 100.0
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.97
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.97
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.97
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.97
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.97
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.97
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 99.94
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 99.94
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 99.88
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 99.88
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 99.85
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 99.85
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.84
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 99.84
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.84
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.83
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.82
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 99.81
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.81
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 99.79
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 99.79
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 99.76
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 99.75
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.72
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.72
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.72
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.71
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.69
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 99.68
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 99.66
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 99.65
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.59
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.57
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.56
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.54
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.52
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.43
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.31
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 99.08
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 98.69
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 98.46
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 97.78
1nd6_A354 Prostatic acid phosphatase; PAP, prostate, phospha 96.21
1dkq_A410 Phytase; histidine acid phosphatase fold, hydrolas 95.92
3ntl_A398 Acid glucose-1-phosphate phosphatase; histidine ac 95.9
3it3_A342 Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A 95.6
2wnh_A418 3-phytase; histidine acid phosphatase, hydrolase; 95.54
1qwo_A442 Phytase; alpha barrel, beta sandwich, orthogonal b 94.85
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 94.69
3k4q_A444 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex 94.44
2gfi_A458 Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces 93.25
1qfx_A460 Protein (PH 2.5 acid phosphatase); phosphomonoeste 85.53
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
Probab=100.00  E-value=8.8e-43  Score=317.54  Aligned_cols=247  Identities=55%  Similarity=0.941  Sum_probs=212.9

Q ss_pred             CCcEEEEEEeccCCCcCccCcccccCCCCCCHhhHHHHHHHHHHHHhcCCCcCEEEEcccHHHHHHHHHHHHHcCC-CCC
Q psy7395           3 EDCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQ-SPE   81 (365)
Q Consensus         3 ~~~~~i~lvRHGes~~n~~~~~~g~~D~~Lte~G~~Qa~~l~~~L~~~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~-~~~   81 (365)
                      |+|++||||||||+.+|..++++|+.|+|||+.|++||+.+|+.|+..+..++.|||||+.||+|||+++++.++. .++
T Consensus         1 m~M~~l~LvRHGqt~~n~~~~~~G~~D~pLt~~G~~QA~~l~~~L~~~~~~~d~i~sSpl~Ra~qTA~~i~~~~~~~~~~   80 (262)
T 1yfk_A            1 MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLP   80 (262)
T ss_dssp             --CEEEEEEECCCBTTTTTTBCCTTSCCCBCHHHHHHHHHHHHHHHHHTCCCSEEEECSCHHHHHHHHHHHHHTTCTTSC
T ss_pred             CCceEEEEEeCCCcccccccCcCCCCCCCCCHHHHHHHHHHHHHHHhCCCCCCEEEECCcHHHHHHHHHHHHhcCCCCCC
Confidence            4568999999999999999999999999999999999999999998777899999999999999999999998864 368


Q ss_pred             ceeccCccccccCCCCCCCHHHHHHHhcHHHHHHHHHhcCCCCCCCCCCcchhhhhhcCCCCcCCCCCCCCCCCCCCHHH
Q psy7395          82 VTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKE  161 (365)
Q Consensus        82 ~~~~~~L~E~~~g~~eg~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~p~~Es~~~  161 (365)
                      +.++++|+|++||.|+|++.+++...+|+..+..|..++...||++...+++++.+..|+.|.  +.....+|++||+.+
T Consensus        81 v~~~~~L~E~~~G~~eG~~~~ei~~~~~~~~~~~w~~~~~~~p~~~~~~~~~~~~i~~d~~~~--~~~~~~~p~gEs~~~  158 (262)
T 1yfk_A           81 VVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYA--DLTEDQLPSCESLKD  158 (262)
T ss_dssp             EEECGGGSCCCCGGGTTSBHHHHHHHHCHHHHHHHHHCSSCCCCCCCTTSTTHHHHHTCGGGT--TSCTTTSCSCCCHHH
T ss_pred             eeeCcccccccCcccCCCcHHHHHHHccHHHHHHHHhccccCCCccccccccccccccccccc--ccccCCCCCCCCHHH
Confidence            889999999999999999999999999999899999998888888887788887777777665  223346789999999


Q ss_pred             HHHHHHHHHHHHHHHhhhCCCEEEEEecchHHHHHHHHHcCCChhhhhcccCCCcceEEEEecCCCCCcCCCcccCChHH
Q psy7395         162 TIMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEET  241 (365)
Q Consensus       162 ~~~R~~~~~~~~i~~~~~~~~~iliV~Hg~t~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~S~  241 (365)
                      +.+|+..++++++......+++|+||+||++++.+++.++|.+...+..+.++||++++++++.+++.+....|.+|.++
T Consensus       159 ~~~Rv~~~l~~li~~~~~~~~~vlvVsHg~~ir~l~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~d~~~  238 (262)
T 1yfk_A          159 TIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEET  238 (262)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCEEEEECHHHHHHHHHHHHTCCHHHHHTCCCCSSSCEEEEECTTSCBSSCCEECSCHHH
T ss_pred             HHHHHHHHHHHHHHhhccCCCeEEEEcChHHHHHHHHHHhCCCHHHHhccCCCCCeEEEEEEcCCceEEecccccCCHHH
Confidence            99999999999444433567899999999999999999999998888888999999999999877665542267899999


Q ss_pred             HHHHHHHHhh
Q psy7395         242 VSKAMEKILK  251 (365)
Q Consensus       242 l~ra~~t~~~  251 (365)
                      +..+.+....
T Consensus       239 ~~~~~~~~~~  248 (262)
T 1yfk_A          239 VRKAMEAVAA  248 (262)
T ss_dssp             HHHHHCC---
T ss_pred             HHHHHHHhhh
Confidence            9888765443
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A Back     alignment and structure
>1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A Back     alignment and structure
>3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* Back     alignment and structure
>3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* Back     alignment and structure
>2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A Back     alignment and structure
>1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure
>3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A Back     alignment and structure
>2gfi_A Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces castellii} Back     alignment and structure
>1qfx_A Protein (PH 2.5 acid phosphatase); phosphomonoesterase, hydrolase; HET: NAG BMA MAN; 2.40A {Aspergillus niger} SCOP: c.60.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 3e-60
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 9e-14
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 9e-60
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 4e-08
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 9e-56
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 6e-11
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 6e-54
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 8e-52
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 1e-06
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 6e-41
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 2e-07
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 3e-20
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 3e-04
d1h2ea_207 c.60.1.1 (A:) Broad specificity phosphatase PhoE ( 5e-17
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 2e-14
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  192 bits (488), Expect = 3e-60
 Identities = 120/245 (48%), Positives = 165/245 (67%), Gaps = 1/245 (0%)

Query: 6   YTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRA 65
           Y L+MLRHGE  W K N FC W D KL+  G++EA   G+ L+   F+FD VFTS L+R+
Sbjct: 2   YKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRS 61

Query: 66  QDTVQIILQELGQSP-EVTKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLP 124
             T  +IL+ELGQ    V  SWRLNERHYG L G N+ QMA  +G EQV++WRRSY+V P
Sbjct: 62  IHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTP 121

Query: 125 PPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKETIMRVLPYWNENIATEIKQGKKV 184
           PP+ + H YYQ+I  +  +K+     DQ P +ESLK+ + R+LPYWNE IA E+ +GK +
Sbjct: 122 PPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTI 181

Query: 185 LVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETVSK 244
           L+  HG S R L+KH+E +SD +I+ + +PT +P + +LD NL    P QFL D+E +  
Sbjct: 182 LISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQA 241

Query: 245 AMEKI 249
           A++K+
Sbjct: 242 AIKKV 246
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 100.0
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 100.0
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 100.0
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 100.0
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 100.0
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 100.0
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 100.0
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 100.0
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 100.0
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.86
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.85
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.84
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.82
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.82
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.81
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.8
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.75
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.74
d1nd6a_342 Prostatic acid phosphatase {Human (Homo sapiens) [ 97.12
d1qwoa_435 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 97.0
d1ihpa_438 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 96.84
d1dkla_409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 96.71
d1nt4a_391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 96.53
d1qfxa_447 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 96.2
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.6e-43  Score=317.38  Aligned_cols=243  Identities=47%  Similarity=0.869  Sum_probs=206.7

Q ss_pred             CcEEEEEEeccCCCcCccCcccccCCCCCCHhhHHHHHHHHHHHHhcCCCcCEEEEcccHHHHHHHHHHHHHcCC-CCCc
Q psy7395           4 DCYTLVMLRHGESEWTKRNLFCGWYDSKLSENGIKEAHVAGQILRDEGFQFDHVFTSQLSRAQDTVQIILQELGQ-SPEV   82 (365)
Q Consensus         4 ~~~~i~lvRHGes~~n~~~~~~g~~D~~Lte~G~~Qa~~l~~~L~~~~~~~~~i~sSpl~Ra~qTA~~i~~~~~~-~~~~   82 (365)
                      .|++|||||||||.+|..++++|+.|+|||+.|++||+.+|+.|++.++.||.|||||+.||+|||+++....+. .+++
T Consensus         1 ~mtrl~LvRHGeT~~N~~~~~~G~~D~pLTe~G~~QA~~~~~~L~~~~~~~d~i~sS~L~Ra~~Ta~~i~~~~~~~~~~i   80 (247)
T d1e58a_           1 AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPV   80 (247)
T ss_dssp             CCEEEEEEECCCBHHHHTTBCCTTCCCCBCHHHHHHHHHHHHHHHHTTCCCSEEEECSSHHHHHHHHHHHHHHTCTTSCE
T ss_pred             CceEEEEEECCCChhhhcCceeCCCCCCcCHHHHHHHHHHHHHHHhcCCCcccchhhHHHHHHHHHHHHHhhcccccCch
Confidence            378999999999999999999999999999999999999999999888999999999999999999999887764 4688


Q ss_pred             eeccCccccccCCCCCCCHHHHHHHhcHHHHHHHHHhcCCCCCCCCCCcchhhhhhcCCCCcCCCCCCCCCCCCCCHHHH
Q psy7395          83 TKSWRLNERHYGDLTGYNKLQMANKYGLEQVQIWRRSYDVLPPPMTKDHKYYQDIITNPNFKIDGPNEDQFPHTESLKET  162 (365)
Q Consensus        83 ~~~~~L~E~~~g~~eg~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~p~~Es~~~~  162 (365)
                      ..+++|+|++||.|||++.+++.+++|++....|.......|.......+.+...  +....  .......|++||+.++
T Consensus        81 ~~~~~L~E~~~G~~eG~~~~ei~~~~~~e~~~~~~~~~~~~p~~~~~~~~~~~~~--~~~~~--~~~~~~~p~gEs~~~~  156 (247)
T d1e58a_          81 EKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGH--DPRYA--KLSEKELPLTESLALT  156 (247)
T ss_dssp             EECGGGCCCCCGGGTTCBHHHHHHHHCHHHHHHHHHCTTCCCCCCCTTSTTCGGG--SGGGT--TCCTTTSCSCCCHHHH
T ss_pred             heecchhhccccccCCCcHHHHHHHhHHHHHHHHhccccCCCccccccchhhhhh--hhhhc--ccccccCCcchhHHHH
Confidence            9999999999999999999999999999888888777666665444444333321  11111  3344568999999999


Q ss_pred             HHHHHHHHHHHHHHhhhCCCEEEEEecchHHHHHHHHHcCCChhhhhcccCCCcceEEEEecCCCCCcCCCcccCChHHH
Q psy7395         163 IMRVLPYWNENIATEIKQGKKVLVVTHGTSLRGLVKHIEQLSDAEIMKLNIPTAIPFVYKLDANLTPTKPRQFLCDEETV  242 (365)
Q Consensus       163 ~~R~~~~~~~~i~~~~~~~~~iliV~Hg~t~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~S~l  242 (365)
                      .+|+..++..++......+++|+||+||+++++++++++|.+...+..+.++||++++++++++++.+. ..|++|.+++
T Consensus       157 ~~Rv~~~~~~~i~~~~~~~~~ilvVtHg~~ir~ll~~~l~~~~~~~~~l~i~n~s~~i~~~~~~~~~~~-~~yL~d~~~~  235 (247)
T d1e58a_         157 IDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLK-RYYLGNADEI  235 (247)
T ss_dssp             HHHHHHHHHHTHHHHHHTTCCEEEEECHHHHHHHHHHHTTCCHHHHHHCCCCTTCCEEEEECTTCCEEE-EEECSCHHHH
T ss_pred             HHHHHhhhhhhhhHhhcCCCCEEEECcHHHHHHHHHHHcCCCHHHHhhccCCCCeEEEEEECCCCCEEe-eEeCCCHHHH
Confidence            999999999855655567899999999999999999999999999999999999999999998877654 3578999999


Q ss_pred             HHHHHHHhh
Q psy7395         243 SKAMEKILK  251 (365)
Q Consensus       243 ~ra~~t~~~  251 (365)
                      ..+.++...
T Consensus       236 ~~~~~~v~~  244 (247)
T d1e58a_         236 AAKAAAVAN  244 (247)
T ss_dssp             HHHTSCCCT
T ss_pred             HHHHHHHHh
Confidence            888766543
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure