Psyllid ID: psy7503
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 2713 | ||||||
| 258597183 | 881 | probable protein [Plasmodium falciparum | 0.281 | 0.867 | 0.334 | 1e-42 | |
| 160880940 | 2228 | chromosome segregation ATPase-like prote | 0.708 | 0.862 | 0.173 | 2e-36 | |
| 292618776 | 3307 | PREDICTED: neuroblast differentiation-as | 0.569 | 0.467 | 0.224 | 4e-32 | |
| 307212646 | 660 | Tyrosine-protein phosphatase non-recepto | 0.039 | 0.162 | 0.470 | 5e-19 | |
| 332029240 | 663 | Tyrosine-protein phosphatase non-recepto | 0.037 | 0.152 | 0.504 | 6e-19 | |
| 322802958 | 526 | hypothetical protein SINV_02788 [Solenop | 0.037 | 0.192 | 0.504 | 1e-18 | |
| 345479465 | 658 | PREDICTED: tyrosine-protein phosphatase | 0.036 | 0.151 | 0.490 | 1e-18 | |
| 380023057 | 659 | PREDICTED: tyrosine-protein phosphatase | 0.036 | 0.150 | 0.504 | 2e-18 | |
| 383855968 | 659 | PREDICTED: tyrosine-protein phosphatase | 0.036 | 0.150 | 0.495 | 2e-18 | |
| 110758020 | 660 | PREDICTED: tyrosine-protein phosphatase | 0.036 | 0.15 | 0.504 | 2e-18 |
| >gi|258597183|ref|XP_001347709.2| probable protein [Plasmodium falciparum 3D7] gi|254832584|gb|AAN35622.2| probable protein [Plasmodium falciparum 3D7] | Back alignment and taxonomy information |
|---|
Score = 183 bits (464), Expect = 1e-42, Method: Compositional matrix adjust.
Identities = 314/940 (33%), Positives = 398/940 (42%), Gaps = 176/940 (18%)
Query: 107 FLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 166
F+V + V SPDY L + L +T SPDY L + L +T SSPDY L
Sbjct: 113 FVVLPDTVYFSPDYTLRLIQLPDTMYF----SPDYTLRLVQLPDTMY----SSPDYTLRL 164
Query: 167 LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYV 226
+ L T SSPDY L + L +T SPD L + L +T SPD
Sbjct: 165 IQLPGTMY----SSPDYSLRLVQLPDTMYF----SPDCTLRLVQLPDTMY----VSPDCT 212
Query: 227 LSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP 286
L + L +T SSPDY L + L +T SPDY L + L +T SP
Sbjct: 213 LRLVQLPDTMY----SSPDYTLRLIQLPDTMYF----SPDYTLRLVQLPDTMYF----SP 260
Query: 287 DYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 346
DY L + L +T SPDY L + L T SPDY L + L +T
Sbjct: 261 DYSLPFVVLPDT----VYVSPDYTLRLIQLPGTMYF----SPDYTLRLIQLPDTMYF--- 309
Query: 347 SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVN 406
SPDY L + L +T SPD L + L +T SSPDY L + L T
Sbjct: 310 -SPDYSLRLVQLPDTMYF----SPDCTLRLVQLPDTMY----SSPDYSLRLIQLPGTMYF 360
Query: 407 ITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNT 466
SPDY L + L +T SSPDY L + L +T SPDY L + L +T
Sbjct: 361 ----SPDYSLRLMQLPDT----VYSSPDYSLRLVQLPDTMYF----SPDYTLRLVQLPDT 408
Query: 467 KVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTL 526
SPDY L + L +T SPDY L + L +T SPDY L + L
Sbjct: 409 MYF----SPDYSLPFVGLPDTMY----VSPDYTLRLVQLPDTMYF----SPDYTLRLIQL 456
Query: 527 CNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 586
+T SPDY L + L T SPDY L + L +T SPDY L
Sbjct: 457 PDTMYF----SPDYTLRLIQLPGTMYF----SPDYTLRLVQLPDTMYF----SPDYTLPF 504
Query: 587 LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYV 646
+ L +T SPDY L + L T SSPDY L + L +T SPD
Sbjct: 505 VVLPDTMYF----SPDYTLRLIQLPGTMY----SSPDYTLRLIQLPDTMYF----SPDCT 552
Query: 647 LSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP 706
L + L +T SPD L + L +T SSPD L + L +T SP
Sbjct: 553 LRLVQLPDTMY----VSPDCTLRLVQLPDTMY----SSPDCTLRLVQLPDT----VYFSP 600
Query: 707 DYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 766
D L + L +T SPDY L + L T SSPDY L + L +T
Sbjct: 601 DCTLPFVVLPDT----VYFSPDYTLRLIQLPGTMY----SSPDYTLRLIQLPDTMYF--- 649
Query: 767 SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVN 826
SPD L + L +T SPD L + L +T SPDY L + L +T
Sbjct: 650 -SPDCTLRLVQLPDT----VYFSPDCTLPFVVLPDT----VYFSPDYTLRLIQLPDTMYF 700
Query: 827 ITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNT 886
SPDY L + L +T SP+Y L + L T SPDY L + L +T
Sbjct: 701 ----SPDYTLPFVVLPDTMYF----SPEYTLRLIQLPGTMYF----SPDYSLRLVQLPDT 748
Query: 887 KVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTL 946
SPDY L + L +T SSP Y L + L +T SSPDY L + L
Sbjct: 749 MYF----SPDYSLRLVQLPDTMY----SSPGYTLPFVVLPDTMY----SSPDYTLRLIQL 796
Query: 947 CNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 1006
+T SPD L + L +T SPDY L + L +T SPDY L
Sbjct: 797 PDT----VYFSPDCTLPFVVLPDT----VYFSPDYTLRLIQLPDTMYF----SPDYSLRL 844
Query: 1007 LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVL 1046
+ L +T SPDY L + L +T SSP Y L
Sbjct: 845 VQLPDTMYF----SPDYSLRLVQLPDTMY----SSPGYTL 876
|
Source: Plasmodium falciparum 3D7 Species: Plasmodium falciparum Genus: Plasmodium Family: Order: Haemosporida Class: Aconoidasida Phylum: Apicomplexa Superkingdom: Eukaryota |
| >gi|160880940|ref|YP_001559908.1| chromosome segregation ATPase-like protein [Clostridium phytofermentans ISDg] gi|160429606|gb|ABX43169.1| Chromosome segregation ATPase-like protein [Clostridium phytofermentans ISDg] | Back alignment and taxonomy information |
|---|
| >gi|292618776|ref|XP_684581.4| PREDICTED: neuroblast differentiation-associated protein AHNAK [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|307212646|gb|EFN88349.1| Tyrosine-protein phosphatase non-receptor type 9 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332029240|gb|EGI69223.1| Tyrosine-protein phosphatase non-receptor type 9 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322802958|gb|EFZ23095.1| hypothetical protein SINV_02788 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|345479465|ref|XP_001606932.2| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380023057|ref|XP_003695346.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383855968|ref|XP_003703482.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|110758020|ref|XP_394701.3| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 2713 | ||||||
| POMBASE|SPBPJ4664.02 | 3971 | SPBPJ4664.02 "cell surface gly | 0.890 | 0.608 | 0.315 | 2.5e-195 | |
| ZFIN|ZDB-GENE-040426-1562 | 5655 | si:ch73-343m12.1 "si:ch73-343m | 0.904 | 0.434 | 0.219 | 3e-58 | |
| UNIPROTKB|Q02505 | 2541 | MUC3A "Mucin-3A" [Homo sapiens | 0.664 | 0.709 | 0.241 | 8.8e-51 | |
| ZFIN|ZDB-GENE-041001-184 | 8328 | si:dkey-30j22.1 "si:dkey-30j22 | 0.881 | 0.287 | 0.215 | 1e-49 | |
| FB|FBgn0052580 | 16 | Muc14A "Mucin 14A" [Drosophila | 0.915 | 155.1 | 0.208 | 1.3e-44 | |
| FB|FBgn0036181 | 3135 | Muc68Ca "Mucin 68Ca" [Drosophi | 0.873 | 0.755 | 0.237 | 1.3e-43 | |
| DICTYBASE|DDB_G0277853 | 1710 | ecmA "extracellular matrix pro | 0.468 | 0.742 | 0.209 | 4.3e-39 | |
| UNIPROTKB|Q685J3 | 4493 | MUC17 "Mucin-17" [Homo sapiens | 0.899 | 0.542 | 0.231 | 2.5e-38 | |
| MGI|MGI:2153525 | 3443 | Muc4 "mucin 4" [Mus musculus ( | 0.789 | 0.622 | 0.212 | 1.2e-36 | |
| CGD|CAL0003874 | 1404 | PGA55 [Candida albicans (taxid | 0.342 | 0.661 | 0.239 | 8.8e-34 |
| POMBASE|SPBPJ4664.02 SPBPJ4664.02 "cell surface glycoprotein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Score = 1926 (683.0 bits), Expect = 2.5e-195, P = 2.5e-195
Identities = 877/2784 (31%), Positives = 1294/2784 (46%)
Query: 109 VTTECVTSSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 162
+T+ V +S + SS T+ NT IT S+ ++S T NT IT SS
Sbjct: 468 ITSSSVLNSSTPITSS-TVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSST 526
Query: 163 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 216
++S T NT +IT SS ++S T+ NT IT SS ++S T+ NT
Sbjct: 527 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 586
Query: 217 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 270
IT S ++S T+ N+ IT SS ++S T NT IT SS VL+
Sbjct: 587 PITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSS---VLN 643
Query: 271 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 327
S T + + S+P ++S T NT IT SS ++S T NT IT SS
Sbjct: 644 SSTPITSSSVLNSSTP---ITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSS 700
Query: 328 ---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKV 384
++S T NT IT SS VL+S T + + S+P ++S ++ N+
Sbjct: 701 VLNSSTAITSSTALNTSTPITSSS---VLNSSTPITSSTALNTSTP---ITSSSVLNSST 754
Query: 385 NITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLT 441
IT SS +L+S T + + S+P ++S T+ NT IT SS ++S T
Sbjct: 755 PITSSS---ILNSSTPITSSSVLNSSTP---ITSSTVVNTSTPITSSSVLNSSTPITSST 808
Query: 442 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 498
+ N+ IT SS VL+S T + + S+P ++S T+ N+ IT SS
Sbjct: 809 VLNSSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSSSVLNSST 862
Query: 499 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 552
++S T NT IT SS ++S T+ NT IT S+ ++S T NT
Sbjct: 863 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 922
Query: 553 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 609
IT SS ++S T NT IT SS VL+S T + + S+P ++S T
Sbjct: 923 PITSSSVLNSSTPITSSTGLNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 976
Query: 610 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 663
NT IT SS ++S ++ NT IT SS ++S T NT IT SS
Sbjct: 977 ALNTSTPITSSSVLNSSTPITSSSVLNTSTPITSSSVLNSSTAITSSTALNTSTPITSSS 1036
Query: 664 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLT 714
++S T+ NT IT S+ ++S T NT IT SS ++S T
Sbjct: 1037 VLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSST 1096
Query: 715 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 771
+ N+ IT SS VL+S T + + S+P ++S T NT IT SS
Sbjct: 1097 VLNSSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTALNTSTPITSSSVLNSST 1150
Query: 772 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 831
++S T+ NT IT S+ V++S T + + S+P ++S T+ NT IT S+
Sbjct: 1151 PITSSTVVNTSTPITSST---VVNSSTPITSSTVVNTSTP---ITSSTVVNTSTPITSST 1204
Query: 832 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 885
++S T+ NT IT SS ++S ++ N+ IT SS VL+S T
Sbjct: 1205 VVNSSTPITSSTVLNTSTPITSSSVLNSSTPITSSSILNSSTPITSSS---VLNSSTPIT 1261
Query: 886 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 939
+ + S+P ++S T NT + IT SS ++S T NT +IT SS
Sbjct: 1262 SSTVVNSSTP---ITSSTALNTSIPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSST 1318
Query: 940 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 999
++S T+ NT IT SS VL+S T + + S+P ++S T+ NT IT S+
Sbjct: 1319 PITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNSSTP---ITSSTVVNTSTPITSST 1372
Query: 1000 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1056
V+++ T + + S+P ++S T+ N+ IT SS ++S T+ NT
Sbjct: 1373 ---VVNTSTPITSSTVVNSSTP---ITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 1426
Query: 1057 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 1110
IT S+ ++S T+ NT IT SS ++S T+ NT IT S+ V++
Sbjct: 1427 PITSSTVVNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSST---VVN 1483
Query: 1111 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 1167
S T + + S+P ++S T+ NT IT S+ ++S T+ NT IT SS
Sbjct: 1484 SSTPITSSTVVNTSTP---ITSSTVVNTSTPITSSTVVNSSTPITSSTVLNTSTPITSSS 1540
Query: 1168 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1224
VL+S T + + S+P ++S T+ NT IT SS ++S T NT
Sbjct: 1541 ---VLNSSTPITSSSVLNSSTP---ITSSTVVNTSTPITSSSVVNSSTPITSSTALNTST 1594
Query: 1225 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 1281
IT SS ++S T NT IT SS VL+S T + + S+P ++S T
Sbjct: 1595 PITSSSVLNSSTPITSSTALNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 1648
Query: 1282 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 1335
NT IT S+ ++S T+ NT IT S+ ++S T NT IT SS
Sbjct: 1649 ALNTSPPITSSTVVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSS 1708
Query: 1336 ---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKV 1392
++S T+ NT IT S+ V++S T + + S+P ++S T NT
Sbjct: 1709 VLNSSTPITSSTVVNTSTPITSST---VVNSSTPITSSTVVNSSTP---ITSSTALNTST 1762
Query: 1393 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1443
IT SS ++S T NT IT SS ++S T NT IT SS
Sbjct: 1763 PITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSST 1822
Query: 1444 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1497
++S T+ NT IT S+ ++S T NT IT SS ++S T NT
Sbjct: 1823 PITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTST 1882
Query: 1498 NITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 1557
IT SS VL+S T + + S+P ++S T NT IT SS VL+S T
Sbjct: 1883 PITSSS---VLNSSTPITSSTVLNSSTP---ITSSTALNTSTPITSSS---VLNSSTPIT 1933
Query: 1558 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1611
+ + S+P ++S T+ N+ IT SS ++S T NT IT SS
Sbjct: 1934 SSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSST 1990
Query: 1612 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1665
++S ++ NT IT SS ++S T+ NT IT S+ ++S T NT
Sbjct: 1991 PITSSSVLNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 2050
Query: 1666 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 1722
IT SS ++S T NT IT SS VL+S T + + S+P ++S T
Sbjct: 2051 PITSSSVLNSSTPITSSTALNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 2104
Query: 1723 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 1779
NT IT SS VL+S T + + S+P ++S T+ N+ IT SS
Sbjct: 2105 ALNTSTPITSSS---VLNSSTPITSSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSST 2158
Query: 1780 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 1839
++S T NT IT SS VL+S T + + S+P ++S T+ NT IT S+
Sbjct: 2159 PITSSTALNTSTPITSSS---VLNSSTPITSSTVVNSSTP---ITSSTVVNTSTPITSST 2212
Query: 1840 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1896
V+++ T + + S+P ++S T+ N+ IT SS ++S T+ NT
Sbjct: 2213 ---VVNTSTPITSSTVVNSSTP---ITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 2266
Query: 1897 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1947
IT S+ ++S T+ NT IT S+ ++S T NT IT SS
Sbjct: 2267 PITSSTVVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSST 2326
Query: 1948 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 2007
++S T+ NT IT SS VL+S T + + S+P ++S T NT +IT SS
Sbjct: 2327 PITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTALNTSTSITSSS 2380
Query: 2008 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 2061
++S T+ NT IT SS ++S T+ NT +IT SS VL+S T
Sbjct: 2381 VLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTSITSSS---VLNSSTPIT 2437
Query: 2062 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 2118
+ + S+P ++S T+ N+ IT SS ++S T NT IT SS VL+
Sbjct: 2438 SSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSS---VLN 2491
Query: 2119 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDY 2178
S T + + S+P ++S T+ N+ IT S+ VL+S T + + S+P
Sbjct: 2492 SSTPITSSTVVNTSTP---ITSSTVVNSSTPITSST---VLNSSTPITSSSVLNSSTP-- 2543
Query: 2179 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 2232
++S T+ NT IT S+ ++SLT N+ IT SS ++S T+ NT
Sbjct: 2544 -ITSSTVVNTSTPITSSTVVNSSTPITSLTALNSSTPITSSSVLNSSTPITSSTVVNTST 2602
Query: 2233 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 2283
IT S+ ++S T NT IT SS ++S T NT +IT SS
Sbjct: 2603 PITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSST 2662
Query: 2284 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 2337
++S T+ NT IT SS ++S T+ NT IT S+ ++S T NT
Sbjct: 2663 PITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 2722
Query: 2338 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 2394
IT SS ++S T+ NT IT SS VL+S T + + S+P ++S T
Sbjct: 2723 PITSSSVLNSSTPITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSST 2776
Query: 2395 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLS 2454
NT IT SS VL+S T + + S+P ++S T+ N+ IT S+ VL+
Sbjct: 2777 ALNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSST---VLN 2827
Query: 2455 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 2511
S T + + S+P ++S T NT IT SS ++S T NT +IT SS
Sbjct: 2828 SSTPITSSSVLNSSTP---ITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSS 2884
Query: 2512 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLT 2562
++S T+ NT IT SS ++S T+ NT IT S+ ++S T
Sbjct: 2885 VLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSST 2944
Query: 2563 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 2616
NT IT SS ++S T NT +IT SS ++S T+ NT IT SS
Sbjct: 2945 ALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSS 3004
Query: 2617 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP---DYVLSSLTLCNTKV 2673
VL+S T + + S+P ++S T+ N+ IT S+ ++S T+ N+
Sbjct: 3005 ---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSSTALNTSTPITSSTVLNSST 3058
Query: 2674 NITESSPDYVLSSLTLCNTKVCLS 2697
IT SS VL+S T + L+
Sbjct: 3059 PITSSS---VLNSSTPITSSTALN 3079
|
|
| ZFIN|ZDB-GENE-040426-1562 si:ch73-343m12.1 "si:ch73-343m12.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q02505 MUC3A "Mucin-3A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041001-184 si:dkey-30j22.1 "si:dkey-30j22.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0052580 Muc14A "Mucin 14A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036181 Muc68Ca "Mucin 68Ca" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0277853 ecmA "extracellular matrix protein ST430" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q685J3 MUC17 "Mucin-17" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2153525 Muc4 "mucin 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003874 PGA55 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 2713 | |||
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 7e-29 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 5e-28 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 2e-27 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 8e-14 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 2e-11 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 7e-10 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 1e-06 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 1e-06 | |
| PHA02740 | 298 | PHA02740, PHA02740, protein tyrosine phosphatase; | 6e-04 |
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
Score = 116 bits (294), Expect = 7e-29
Identities = 48/102 (47%), Positives = 61/102 (59%), Gaps = 11/102 (10%)
Query: 39 YINGGLLNYIHCFFPT-------GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCA 91
YIN +YI + P GP+ NTVEDFWRMVWEQ+ VI+M T ++E+GR KCA
Sbjct: 28 YINA---SYIDGYNPPKAYIATQGPLPNTVEDFWRMVWEQKVPVIVMLTELVEKGREKCA 84
Query: 92 QYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVN 133
QYWP EG+ +T+GD VT DY + +L L NT
Sbjct: 85 QYWPEEEGS-LTYGDITVTLVSEEKLDDYTVRTLKLSNTGTG 125
|
The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231 |
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 2713 | |||
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 100.0 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 100.0 | |
| KOG4228|consensus | 1087 | 100.0 | ||
| KOG0792|consensus | 1144 | 100.0 | ||
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 100.0 | |
| KOG0790|consensus | 600 | 100.0 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 100.0 | |
| KOG0791|consensus | 374 | 100.0 | ||
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 100.0 | |
| KOG0793|consensus | 1004 | 100.0 | ||
| KOG4228|consensus | 1087 | 100.0 | ||
| KOG0789|consensus | 415 | 100.0 | ||
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 100.0 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.37 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.37 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 98.44 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 97.9 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 97.49 | |
| KOG1720|consensus | 225 | 96.83 | ||
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 96.77 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 96.59 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 95.95 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 95.0 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 94.41 | |
| KOG2836|consensus | 173 | 94.27 | ||
| KOG2283|consensus | 434 | 93.94 | ||
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 93.33 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 91.59 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 90.25 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 88.43 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 86.63 | |
| KOG1717|consensus | 343 | 86.45 | ||
| KOG1718|consensus | 198 | 81.97 | ||
| KOG1719|consensus | 183 | 80.5 | ||
| PLN02727 | 986 | NAD kinase | 80.3 | |
| KOG1716|consensus | 285 | 80.12 |
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-48 Score=427.91 Aligned_cols=217 Identities=20% Similarity=0.284 Sum_probs=194.4
Q ss_pred CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503 2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII 77 (2713)
Q Consensus 2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV 77 (2713)
+.+++|+.||||.+++|+|+.|+.+.. ..+++||||||||+|+ ++|| ||||+++|++|||+||||+++++||
T Consensus 47 ~~~~~N~~KNRy~~i~~~D~tRV~L~~----~~~~~dYINAsyI~g~~~~~~fIatQ~Pl~~T~~dFW~MVw~~~~~vIV 122 (303)
T PHA02742 47 SLELKNMKKCRYPDAPCFDRNRVILKI----EDGGDDFINASYVDGHNAKGRFICTQAPLEETALDFWQAIFQDQVRVIV 122 (303)
T ss_pred ccChhhhhcCCCCCCCCCCCCEEEeCC----CCCCCCcEEEeeecCCCCCCeEEEECCCCcccHHHHHHHHhhcCCCeEE
Confidence 567899999999999999999997654 2236899999999998 7999 9999999999999999999999999
Q ss_pred EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503 78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 157 (2713)
Q Consensus 78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP 157 (2713)
||++..|.|++||++|||.++++.+.||+|.|++.++....+|..|.|.+.+.+.++.|.|+||||++|||+| +|
T Consensus 123 mLt~~~E~g~~kc~~YWp~~~~~~~~~g~~~V~~~~~~~~~~~~~~~l~l~~~~~~~~r~V~h~~y~~Wpd~g-----vP 197 (303)
T PHA02742 123 MITKIMEDGKEACYPYWMPHERGKATHGEFKIKTKKIKSFRNYAVTNLCLTDTNTGASLDIKHFAYEDWPHGG-----LP 197 (303)
T ss_pred EcchhhhCCeeeccccCCCCCCCceEEEEEEEEEEEEEEcCCEEEEEEEEEECCCCceEEEEEEEECCCCCCC-----cC
Confidence 9999999999999999999888889999999999999999999999999998777899999999999999999 78
Q ss_pred CChHHHHHHHHHHHhhcC----------CCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhcccccccccce
Q psy7503 158 SSPDYVLSSLTLCNTKVN----------ITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTKVN 217 (2713)
Q Consensus 158 SSPESFLDFLEEVRKSKn----------qpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTKVD 217 (2713)
.++..|++|+..+++.+. ....+||||||+||+||||+|++ ...+|..-....+|..|..
T Consensus 198 ~~~~~~l~~i~~v~~~~~~~~~~~~~~~~~~~~PIvVHCsaGvGRTGtF~aid~~i~~~~~~~~v~v~~~V~~lR~qR~~ 277 (303)
T PHA02742 198 RDPNKFLDFVLAVREADLKADVDIKGENIVKEPPILVHCSAGLDRAGAFCAIDICISKYNERAIIPLLSIVRDLRKQRHN 277 (303)
T ss_pred CCHHHHHHHHHHHHHHhhhccccccccccCCCCCeEEECCCCCchhHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhccc
Confidence 899999999999987432 11348999999999999999997 3344555567788999999
Q ss_pred eeccchhhhh
Q psy7503 218 ITESSPDYVL 227 (2713)
Q Consensus 218 ITESseDYVF 227 (2713)
+.++.++|+|
T Consensus 278 ~Vqt~~QY~F 287 (303)
T PHA02742 278 CLSLPQQYIF 287 (303)
T ss_pred ccCCHHHHHH
Confidence 9999999998
|
|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 2713 | ||||
| 3qcm_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 2e-15 | ||
| 3qcl_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 4e-15 | ||
| 2pa5_A | 314 | Crystal Structure Of Human Protein Tyrosine Phospha | 6e-15 | ||
| 1ygr_A | 610 | Crystal Structure Of The Tandem Phosphatase Domain | 6e-15 | ||
| 3qcb_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 9e-15 | ||
| 2h4v_A | 320 | Crystal Structure Of The Human Tyrosine Receptor Ph | 1e-14 | ||
| 2pbn_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 3e-14 | ||
| 2cfv_A | 316 | Crystal Structure Of Human Protein Tyrosine Phospha | 4e-14 | ||
| 2nz6_A | 316 | Crystal Structure Of The Ptprj Inactivating Mutant | 6e-14 | ||
| 2nlk_A | 627 | Crystal Structure Of D1 And D2 Catalytic Domains Of | 8e-14 | ||
| 1nwl_A | 298 | Crystal Structure Of The Ptp1b Complexed With Sp734 | 1e-13 | ||
| 2c7s_A | 313 | Crystal Structure Of Human Protein Tyrosine Phospha | 3e-13 | ||
| 3i36_A | 342 | Crystal Structure Of Rat Protein Tyrosine Phosphata | 4e-13 | ||
| 2i75_A | 320 | Crystal Structure Of Human Protein Tyrosine Phospha | 5e-13 | ||
| 1p15_A | 253 | Crystal Structure Of The D2 Domain Of Rptpa Length | 5e-13 | ||
| 4i8n_A | 354 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 9e-13 | ||
| 1oeo_X | 321 | Ptp1b With The Catalytic Cysteine Oxidized To Sulfo | 9e-13 | ||
| 1a5y_A | 330 | Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate | 9e-13 | ||
| 3sme_A | 300 | Structure Of Ptp1b Inactivated By H2o2BICARBONATE L | 9e-13 | ||
| 3zv2_A | 320 | Human Protein-Tyrosine Phosphatase 1b C215a, S216a | 9e-13 | ||
| 3eu0_A | 327 | Crystal Structure Of The S-Nitrosylated Cys215 Of P | 9e-13 | ||
| 1g1f_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 9e-13 | ||
| 2f6f_A | 302 | The Structure Of The S295f Mutant Of Human Ptp1b Le | 1e-12 | ||
| 1een_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-12 | ||
| 1bzc_A | 321 | Human Ptp1b Catalytic Domain Complexed With Tpi Len | 1e-12 | ||
| 1aax_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-12 | ||
| 2cma_A | 327 | Structural Basis For Inhibition Of Protein Tyrosine | 1e-12 | ||
| 1nl9_A | 321 | Potent, Selective Protein Tyrosine Phosphatase 1b I | 1e-12 | ||
| 1ptu_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-12 | ||
| 1bzh_A | 298 | Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 | 1e-12 | ||
| 1ptv_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-12 | ||
| 1g7g_A | 298 | Human Ptp1b Catalytic Domain Complexes With Pnu1793 | 1e-12 | ||
| 2cm2_A | 304 | Structure Of Protein Tyrosine Phosphatase 1b (P2121 | 1e-12 | ||
| 3qkp_A | 321 | Protein Tyrosine Phosphatase 1b - Apo W179f Mutant | 1e-12 | ||
| 1l8g_A | 321 | Crystal Structure Of Ptp1b Complexed With 7-(1,1-di | 1e-12 | ||
| 2azr_A | 299 | Crystal Structure Of Ptp1b With Bicyclic Thiophene | 1e-12 | ||
| 1g7f_A | 298 | Human Ptp1b Catalytic Domain Complexed With Pnu1774 | 1e-12 | ||
| 1bzj_A | 297 | Human Ptp1b Complexed With Tpicooh Length = 297 | 1e-12 | ||
| 1ecv_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-12 | ||
| 2nt7_A | 299 | Crystal Structure Of Ptp1b-inhibitor Complex Length | 1e-12 | ||
| 2hy3_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 1e-12 | ||
| 1pa1_A | 310 | Crystal Structure Of The C215d Mutant Of Protein Ty | 1e-12 | ||
| 3cwe_A | 290 | Ptp1b In Complex With A Phosphonic Acid Inhibitor L | 1e-12 | ||
| 2fjm_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-12 | ||
| 1lqf_A | 295 | Structure Of Ptp1b In Complex With A Peptidic Bisph | 1e-12 | ||
| 1i57_A | 310 | Crystal Structure Of Apo Human Ptp1b (C215s) Mutant | 1e-12 | ||
| 1q6j_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-12 | ||
| 1c86_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-12 | ||
| 1gfy_A | 298 | Residue 259 Is A Key Determinant Of Substrate Speci | 2e-12 | ||
| 2ooq_A | 286 | Crystal Structure Of The Human Receptor Phosphatase | 3e-12 | ||
| 3s3e_A | 307 | Crystal Structure Of The Catalytic Domain Of Ptp10d | 4e-12 | ||
| 2jjd_A | 599 | Protein Tyrosine Phosphatase, Receptor Type, E Isof | 5e-12 | ||
| 1rpm_A | 278 | Human Receptor Protein Tyrosine Phosphatase Mu, Dom | 6e-12 | ||
| 1yfo_A | 302 | Receptor Protein Tyrosine Phosphatase Alpha, Domain | 6e-12 | ||
| 2shp_A | 525 | Tyrosine Phosphatase Shp-2 Length = 525 | 6e-12 | ||
| 3o5x_A | 276 | Crystal Structure Of The Oncogenic Tyrosine Phospha | 6e-12 | ||
| 3b7o_A | 316 | Crystal Structure Of The Human Tyrosine Phosphatase | 6e-12 | ||
| 2fh7_A | 595 | Crystal Structure Of The Phosphatase Domains Of Hum | 1e-11 | ||
| 1lar_A | 575 | Crystal Structure Of The Tandem Phosphatase Domains | 1e-11 | ||
| 4gs0_A | 308 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-11 | ||
| 4gry_A | 288 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-11 | ||
| 2b3o_A | 532 | Crystal Structure Of Human Tyrosine Phosphatase Shp | 2e-11 | ||
| 3ps5_A | 595 | Crystal Structure Of The Full-Length Human Protein | 2e-11 | ||
| 1gwz_A | 299 | Crystal Structure Of The Catalytic Domain Of The Pr | 2e-11 | ||
| 1fpr_A | 284 | Crystal Structure Of The Complex Formed Between The | 2e-11 | ||
| 1zc0_A | 309 | Crystal Structure Of Human Hematopoietic Tyrosine P | 2e-11 | ||
| 2a3k_A | 296 | Crystal Structure Of The Human Protein Tyrosine Pho | 2e-11 | ||
| 3o4s_A | 308 | Crystal Structure Of Heptp With A Closed Wpd Loop A | 2e-11 | ||
| 3d42_A | 308 | Crystal Structure Of Heptp In Complex With A Monoph | 2e-11 | ||
| 2qdm_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 2e-11 | ||
| 2qdc_A | 309 | Crystal Structure Of The Heptp Catalytic Domain D23 | 2e-11 | ||
| 2hvl_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 2e-11 | ||
| 2gp0_A | 309 | Heptp Catalytic Domain (Residues 44-339), S225d Mut | 2e-11 | ||
| 3a5k_A | 304 | Crystal Structure Of Protein-Tyrosine Phosphatase 1 | 2e-11 | ||
| 2h03_A | 291 | Structural Studies Of Protein Tyrosine Phosphatase | 3e-11 | ||
| 2ahs_A | 295 | Crystal Structure Of The Catalytic Domain Of Human | 4e-11 | ||
| 2h02_A | 313 | Structural Studies Of Protein Tyrosine Phosphatase | 6e-11 | ||
| 3sr9_A | 583 | Crystal Structure Of Mouse Ptpsigma Length = 583 | 7e-11 | ||
| 2bzl_A | 325 | Crystal Structure Of The Human Protein Tyrosine Pho | 1e-10 | ||
| 2b49_A | 287 | Crystal Structure Of The Catalytic Domain Of Protei | 1e-09 | ||
| 3brh_A | 310 | Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To | 1e-09 | ||
| 2nv5_A | 299 | Crystal Structure Of A C-Terminal Phosphatase Domai | 1e-09 | ||
| 2p6x_A | 309 | Crystal Structure Of Human Tyrosine Phosphatase Ptp | 2e-09 | ||
| 3h2x_A | 302 | Crystal Structure Of The Human Lymphoid Tyrosine Ph | 2e-09 | ||
| 3olr_A | 313 | Ptpn22 In Complex With Consensus Phospho-Tyrosine P | 2e-09 | ||
| 2qcj_A | 313 | Native Structure Of Lyp Length = 313 | 2e-09 | ||
| 2oc3_A | 303 | Crystal Structure Of The Catalytic Domain Of Human | 8e-09 | ||
| 1wch_A | 315 | Crystal Structure Of Ptpl1 Human Tyrosine Phosphata | 8e-09 | ||
| 2bv5_A | 282 | Crystal Structure Of The Human Protein Tyrosine Pho | 2e-08 | ||
| 2i1y_A | 301 | Crystal Structure Of The Phosphatase Domain Of Huma | 3e-08 | ||
| 2cjz_A | 305 | Crystal Structure Of The C472s Mutant Of Human Prot | 3e-08 | ||
| 2bij_A | 305 | Crystal Structure Of The Human Protein Tyrosine Pho | 3e-08 | ||
| 1jln_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 4e-08 | ||
| 2a8b_A | 283 | Crystal Structure Of The Catalytic Domain Of Human | 6e-08 | ||
| 2qep_A | 304 | Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be | 1e-07 | ||
| 1l8k_A | 314 | T Cell Protein-Tyrosine Phosphatase Structure Lengt | 2e-07 | ||
| 2gjt_A | 295 | Crystal Structure Of The Human Receptor Phosphatase | 2e-07 | ||
| 2g59_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 2e-07 | ||
| 2pi7_A | 312 | Structure Of The Catalytic Domain Of The Chick Reti | 2e-07 |
| >pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 | Back alignment and structure |
|
| >pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 | Back alignment and structure |
| >pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 | Back alignment and structure |
| >pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 | Back alignment and structure |
| >pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 | Back alignment and structure |
| >pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 | Back alignment and structure |
| >pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 | Back alignment and structure |
| >pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 | Back alignment and structure |
| >pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 | Back alignment and structure |
| >pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 | Back alignment and structure |
| >pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 | Back alignment and structure |
| >pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 | Back alignment and structure |
| >pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 | Back alignment and structure |
| >pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 | Back alignment and structure |
| >pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 | Back alignment and structure |
| >pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 | Back alignment and structure |
| >pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 | Back alignment and structure |
| >pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 | Back alignment and structure |
| >pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 | Back alignment and structure |
| >pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 | Back alignment and structure |
| >pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 | Back alignment and structure |
| >pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 | Back alignment and structure |
| >pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 | Back alignment and structure |
| >pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 | Back alignment and structure |
| >pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 | Back alignment and structure |
| >pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 | Back alignment and structure |
| >pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 | Back alignment and structure |
| >pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 | Back alignment and structure |
| >pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 | Back alignment and structure |
| >pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 | Back alignment and structure |
| >pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 | Back alignment and structure |
| >pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 | Back alignment and structure |
| >pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 | Back alignment and structure |
| >pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 | Back alignment and structure |
| >pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 | Back alignment and structure |
| >pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 | Back alignment and structure |
| >pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 | Back alignment and structure |
| >pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 | Back alignment and structure |
| >pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 | Back alignment and structure |
| >pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 | Back alignment and structure |
| >pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 | Back alignment and structure |
| >pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 | Back alignment and structure |
| >pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 | Back alignment and structure |
| >pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 | Back alignment and structure |
| >pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 | Back alignment and structure |
| >pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 | Back alignment and structure |
| >pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 | Back alignment and structure |
| >pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 | Back alignment and structure |
| >pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 | Back alignment and structure |
| >pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 | Back alignment and structure |
| >pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 | Back alignment and structure |
| >pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 | Back alignment and structure |
| >pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 | Back alignment and structure |
| >pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 | Back alignment and structure |
| >pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 | Back alignment and structure |
| >pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 | Back alignment and structure |
| >pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 | Back alignment and structure |
| >pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 | Back alignment and structure |
| >pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 | Back alignment and structure |
| >pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 | Back alignment and structure |
| >pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 | Back alignment and structure |
| >pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 | Back alignment and structure |
| >pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 | Back alignment and structure |
| >pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 | Back alignment and structure |
| >pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 | Back alignment and structure |
| >pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 | Back alignment and structure |
| >pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 | Back alignment and structure |
| >pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 | Back alignment and structure |
| >pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 | Back alignment and structure |
| >pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 | Back alignment and structure |
| >pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 | Back alignment and structure |
| >pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 | Back alignment and structure |
| >pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 | Back alignment and structure |
| >pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 | Back alignment and structure |
| >pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 | Back alignment and structure |
| >pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 | Back alignment and structure |
| >pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 | Back alignment and structure |
| >pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 | Back alignment and structure |
| >pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 | Back alignment and structure |
| >pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 | Back alignment and structure |
| >pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 | Back alignment and structure |
| >pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 | Back alignment and structure |
| >pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 | Back alignment and structure |
| >pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 | Back alignment and structure |
| >pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 | Back alignment and structure |
| >pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 | Back alignment and structure |
| >pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 | Back alignment and structure |
| >pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 | Back alignment and structure |
| >pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 | Back alignment and structure |
| >pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 | Back alignment and structure |
| >pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 | Back alignment and structure |
| >pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 | Back alignment and structure |
| >pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 | Back alignment and structure |
| >pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 | Back alignment and structure |
| >pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 | Back alignment and structure |
| >pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 2713 | |||
| 2pa5_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 1e-36 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 3e-35 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 5e-35 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 5e-35 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 5e-35 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 5e-35 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 1e-34 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 2e-34 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 4e-34 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 9e-34 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 1e-33 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 2e-33 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 3e-33 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 7e-33 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 1e-32 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 2e-32 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 2e-32 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 2e-32 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 2e-32 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 3e-32 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 2e-27 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 1e-31 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 3e-31 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 8e-31 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 1e-30 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 1e-30 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 2e-30 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 2e-26 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 3e-30 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 5e-27 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 3e-30 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 2e-24 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 5e-30 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 4e-29 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 2e-28 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 9e-27 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 3e-20 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 |
| >2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
Score = 141 bits (357), Expect = 1e-36
Identities = 39/102 (38%), Positives = 56/102 (54%), Gaps = 10/102 (9%)
Query: 39 YINGGLLNYIHCFFPT-------GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCA 91
YIN +++ + GP++NT DFW MVWEQ+ LVI+MTTR E GR KC
Sbjct: 82 YINA---SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCG 138
Query: 92 QYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVN 133
QYWP + +++ G VT V + Y ++L + NT+
Sbjct: 139 QYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEER 180
|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 2713 | |||
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 100.0 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 100.0 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 100.0 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 100.0 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 100.0 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 100.0 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 100.0 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 100.0 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 100.0 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 100.0 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 100.0 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 100.0 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 100.0 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 100.0 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 100.0 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 100.0 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 100.0 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 100.0 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 100.0 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 100.0 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 100.0 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 100.0 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 100.0 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 100.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.8 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.57 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.47 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 98.95 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 98.56 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 98.08 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 98.04 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 97.87 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 97.84 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 97.8 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 97.76 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 97.74 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 97.68 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.5 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 97.46 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 97.28 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 97.25 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 97.22 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 97.16 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 96.96 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 96.91 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 96.87 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 96.87 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 96.8 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 96.75 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 96.7 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 96.7 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 96.68 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 96.6 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 96.37 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 96.37 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 96.14 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 96.09 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 95.98 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 95.47 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 95.42 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 95.35 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 94.88 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 94.66 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 93.12 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 90.75 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 89.22 |
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-51 Score=449.72 Aligned_cols=219 Identities=22% Similarity=0.348 Sum_probs=198.6
Q ss_pred CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503 2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII 77 (2713)
Q Consensus 2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV 77 (2713)
+.+++|+.||||.+|+|+|+.||++.. ..+.+++||||||||+|+ ++|| ||||+++|++|||+||||+++.+||
T Consensus 47 ~~~~~N~~KNRy~dI~pyD~tRV~L~~--~~~~~~sdYINAs~I~g~~~~~~yIaTQgPl~~T~~dFW~MVwe~~~~~IV 124 (314)
T 4ge6_A 47 SMSPGNLEKNRYGDVPCLDQTRVKLTK--RSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIV 124 (314)
T ss_dssp HHSTTTGGGCSCTTCCCCTTTBCCCCC--CSSSCCCSCCSEEEEEETTEEEEEEEECCCCGGGHHHHHHHHHHTTCCEEE
T ss_pred ccChhhhccCCCCCcCCCcCcEEEccC--CCCCCCCceEEeecccCCCCCCeEEEECCCcHHHHHHHHHHHHhcCCceEE
Confidence 357899999999999999999998764 345677899999999999 7899 9999999999999999999999999
Q ss_pred EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503 78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 157 (2713)
Q Consensus 78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP 157 (2713)
||+...|+++.||++|||.+.++.+.||.|+|++.++....+|+.|.|++.+.+.++.|.|+||||++|||+| +|
T Consensus 125 mLt~~~E~g~~kC~~YwP~~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~~~~~~~~~~r~V~h~~y~~WPd~g-----vP 199 (314)
T 4ge6_A 125 MTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYG-----VP 199 (314)
T ss_dssp ECSCSEETTEECCCCCSCCSTTCEEEETTEEEEEEEEEECSSEEEEEEEEEETTTTEEEEEEEEEECCSCSSS-----CC
T ss_pred EcccccccceecccccCcCCCCCceecccEEEEEEEEEEcCCceEEEEeeecccCCcceEEEEEEeCCCCCCC-----CC
Confidence 9999999999999999999999999999999999999999999999999999888999999999999999999 68
Q ss_pred CChHHHHHHHHHHHhhcC------------CCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhccccccccc
Q psy7503 158 SSPDYVLSSLTLCNTKVN------------ITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTK 215 (2713)
Q Consensus 158 SSPESFLDFLEEVRKSKn------------qpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTK 215 (2713)
.++..+++|++.|++.+. ..+.+||||||+||+||||+||+ +..+|..-.+..+|..|
T Consensus 200 ~~~~~ll~~i~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCSaGvGRTGtfiaid~~l~~l~~~~~vdv~~~V~~lR~qR 279 (314)
T 4ge6_A 200 SSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQR 279 (314)
T ss_dssp SCSHHHHHHHHHHHHHHHHHHHHSCCC----CCSCCEEEECSSSSHHHHHHHHHHHHHHHHHHHSCBCHHHHHHHHTTTS
T ss_pred CCHHHHHHHHHHHHHHHhhhhccccccccccCCCCCEEEECCCCCcHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhc
Confidence 899999999999986542 23458999999999999999997 34456555667899999
Q ss_pred ceeeccchhhhh
Q psy7503 216 VNITESSPDYVL 227 (2713)
Q Consensus 216 VDITESseDYVF 227 (2713)
..++++.++|+|
T Consensus 280 ~~mVqt~~QY~F 291 (314)
T 4ge6_A 280 AFSIQTPEQYYF 291 (314)
T ss_dssp TTCSCSHHHHHH
T ss_pred ccccCCHHHHHH
Confidence 999999999988
|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 2713 | ||||
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 9e-18 | |
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 5e-17 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 4e-15 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 7e-15 | |
| d1fpra_ | 284 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 2e-14 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 3e-14 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 3e-14 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 6e-14 | |
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 1e-13 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 1e-13 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 4e-13 | |
| d1lara1 | 317 | c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie | 9e-13 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 1e-10 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 6e-05 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-04 |
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: SptP tyrosine phosphatase, catalytic domain species: Salmonella typhimurium [TaxId: 90371]
Score = 83.2 bits (205), Expect = 9e-18
Identities = 10/99 (10%), Positives = 29/99 (29%), Gaps = 8/99 (8%)
Query: 39 YIN------GGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQ 92
+ G + +P + +E +M+ E++ +++ T + +
Sbjct: 34 PVPVNTLTFDGKPVALAGSYPK-NTPDALEAHMKMLLEKECSCLVVLTSEDQMQAKQLPP 92
Query: 93 YWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTK 131
Y+ G T + ++ L +
Sbjct: 93 YFRG-SYTFGEVHTNSQKVSSASQGEAIDQYNMQLSCGE 130
|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 2713 | |||
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 100.0 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 100.0 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 100.0 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 100.0 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 100.0 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 100.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 100.0 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 100.0 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 100.0 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 100.0 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 100.0 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.57 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.4 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 98.31 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 98.28 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 97.96 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 97.53 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 96.16 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 95.94 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 95.73 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 95.7 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 88.16 |
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Protein-tyrosine phosphatase alpha species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.9e-49 Score=412.98 Aligned_cols=217 Identities=21% Similarity=0.355 Sum_probs=198.5
Q ss_pred CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503 2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII 77 (2713)
Q Consensus 2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV 77 (2713)
|-.|+|+.||||.+++|+|+.||.+.. .++.+++||||||||+|+ ++|| ||+|+++|++|||+||||+++++||
T Consensus 4 ~~lp~N~~KNRy~di~p~D~sRV~L~~--~~~~~~~dYINAs~V~g~~~~~~yI~tQ~P~~~T~~dFW~Mv~~~~~~~IV 81 (245)
T d1p15a_ 4 GNLPANMKKNRVLQIIPYEFNRVIIPV--KRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIV 81 (245)
T ss_dssp GGSTTTSTTCSCSSCCCCTTSBCCCCC--CSSSSSTTCCSEEEECCSSCTTCEEEECCCCSSSHHHHHHHHHHTTCCEEE
T ss_pred ccCccccccCCCCCCCCCcCCEEEecC--CCCCCCCceEEEEeecCCCCCCeeEEECCCCccchhhHhhheecCCCCEEE
Confidence 568999999999999999999998765 234567899999999999 7899 9999999999999999999999999
Q ss_pred EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503 78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 157 (2713)
Q Consensus 78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP 157 (2713)
||++..|.++.+|.+|||.+ +...+|+|+|++.++...++++.|.|.|...+.+++|.|+||||++||++| .|
T Consensus 82 mL~~~~e~~~~~~~~y~p~~--~~~~~~~~~v~~~~~~~~~~~~~r~l~l~~~~~~~~~~v~~~~y~~Wpd~~-----~P 154 (245)
T d1p15a_ 82 MLTELEERGQEKCAQYWPSD--GLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVG-----IP 154 (245)
T ss_dssp ECSCSCSSSSCCSCCCSCSS--SCCEETTEECCSCCCEECSSEEEEEEEEECSSCCEEEEEEEEEECCSCSSS-----CC
T ss_pred EEeccccCCCcccccccCCC--CceEeccEEEEEEEEEEcCCceEEEEEEEECCCCceEEEEEEEecCCCccC-----CC
Confidence 99999999999999999976 688899999999999999999999999998888999999999999999998 67
Q ss_pred CChHHHHHHHHHHHhhcCCCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhcccccccccceeeccchhhhh
Q psy7503 158 SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTKVNITESSPDYVL 227 (2713)
Q Consensus 158 SSPESFLDFLEEVRKSKnqpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTKVDITESseDYVF 227 (2713)
.++..+++|++++++.+.....+||+|||++|+||||+|++ ...+|..-.++.+|..|..+.++.++|.|
T Consensus 155 ~~~~~~l~~~~~v~~~~~~~~~~PivVHCs~G~gRsg~f~a~~~~~~~l~~~~~vdv~~~v~~lR~qR~~~vqt~~QY~f 234 (245)
T d1p15a_ 155 SDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEF 234 (245)
T ss_dssp SSSCSHHHHHHHHHHHTTTTTSCCEEEESSSSSHHHHHHHHHHHHHHHHHHHSCCCTTHHHHHHHTTSTTSSCSTTTTHH
T ss_pred CCHHHHHHHHHHHHhhhccCCCCCEEEEcCCCCccccHHHHHHHHHHHHHcCCCcCHHHHHHHHHHhcccccCCHHHHHH
Confidence 78889999999999887666779999999999999999996 45677777778899999999999999988
|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|