Psyllid ID: psy7503


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120------2130------2140------2150------2160------2170------2180------2190------2200------2210------2220------2230------2240------2250------2260------2270------2280------2290------2300------2310------2320------2330------2340------2350------2360------2370------2380------2390------2400------2410------2420------2430------2440------2450------2460------2470------2480------2490------2500------2510------2520------2530------2540------2550------2560------2570------2580------2590------2600------2610------2620------2630------2640------2650------2660------2670------2680------2690------2700------2710---
MSLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVWQQSGNLKET
cccccHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHcccccccEEEEEccccccccccccccccccccccEEEccEEEEEcEEEccccEEEEEEEEEEEcccccccccccEEEEEEEcccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHHHEEcccccccccHHHcccccccccccccccccEEEHHHccccEEEEEcccccccHHHHHHHHHHccEcEEEEccccEEccEEcccccccccccccEEEccEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccEEEcccccccccHcccccEEEcccccEcccccccccccccccccccEEEccccccccEccccEccccEEEEEccccccEEccccccccEEEEccccccccccccEccccEEEEEEcccccEEccccccccEEEcccccccccccccccccccccccccccccEccccEccccEEcccccccccccccEEccccccEEEEEccccEccccccccccccccccccccEEEEEEcccccEEEEEEccccEcccccccccEEEccccccccccccccccccccccEccccccccccccccccccccccccccccEccEEcccccEEEEEEcccccccccccccccHHccccccccccccEcccccEEEcccccccccccccEccccccccccccccEEEEEEEcccccccEEEccccccccEEEccccEEEEEEEcccccEEEEEccccEEEEcccccccEEccEEccccEEEEccccccccEEEEEccccEEEEEccccccEEEEEcccccEEEEEEcccccccccEEccccEEEEEEEcccccccccEcccccccccccccccccccEEccccEEEEEEEcccccccccEccccEEEEEEcccccccccccccccEEEcccccccccccccEccccEEEEEccccccccccccccccEEEEEEcccccccccccccccEEEEEEcccccccccccccccEEEEEcccccccccccccccccEEccccccccccccccccccEEEEEEccccccccccEccccEEEEEEccccccccccccccccEEEcccccccccccccccccEEEEEEccccccccccccccccEEcEcccccccccccccccccEEEEEccccccccccEccccEEEcccccccccccccEccccEEEEEccccccccccccccccEEEEEEcccccEEcccEcccccEEcccccccccccccccccccEEEEEEccccEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEccEEccccEEEEcccccccccccccccccEEEEEEcccccEEccccccccEEEEcccccccccccccccccEEEEEEccccccccccccccccEEEEEEcccccccccccccccEEEEEcccccccccccccccEEEcccccccEEEcccEccccEEEcEcccccccccccccccccEccccccccccccccccccccEcccccccccccccccccccccEEEEEcccccccccccccccEEEEEccccccccccEccccEEEccccccccEcccccccccEEEEEEcccccEEccccccccEEEEccccccccccccccccccEEcEcccccccccccccccccEEEEEEccccccccccccccccccEEccccccccccccccccEEccccccccccccccccccEEEcccccccccccccEccccEEEccccccccEccccccccccEEcEccccccccccccccccEEEEEEcccccEccccEcccccEEEEcccccccccccccccccEEEEEccccccccccEcccccEEEEEccccccccccEcccccEEEEcccccccccccccccccEEEEEEccccEEcccEcccccEEEEEccccccccccEcccccEEEEcccccEEEEEEEcccccEEccccccccEEEEEEccccEEEEEEccccccccccEcccccEccccccccEEEEEEEcccccEEEEcccccEEEEEEEcccccEEEcccccccEEEEEEccccEEEEcccccccEEEEEEcccccEEEcccccccEccEEEccccEEEEEEEccccEEEEEEccccEEEEcccccccEEEEEEcccccEEEccccccEEEEEEEcccccEEEEEcccccEEEEEEccccEEEEccccccEEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEEcccEEEEEEEccccEEEEcccccccEEEEEEcccccEEEcccccccEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEEccccEEEEEEcccccEEEcccccccEEEEEEccccEEEEccccccHEEEEEEccccEEEEEccccccEEEEEEcccccEEEccccccEEEEEEEccccEEEEcccccccEEEEEEccccEEEEcccccccEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEEcccEEEEEEEccccEEEEcccccccEEEEEEccccEEEEccccccEEEEEEEccccEEEEEEcccccEEcEEEccccEEEEEEccccEEEEEEEccccEEEEccccccEEEcccccccc
mslknkqkvqkplncifpqhiLTLTkwenknrhkstKQYINGGLLnyihcffptgpmqntVEDFWRMVWEQQTLVIIMTTRVIERGrnkcaqywpgtegtkmthgdflvttecvtsspdyvlsSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLTLcntkvnitesspdyVLSSLtlcntkvclsglpdsvwqqsgnlket
mslknkqkvqkplncifpqhiltltkwenknrHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSglpdsvwqqsgnlket
MSLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVWQQSGNLKET
***********PLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVW*********
**********KPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNT**********YVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKV****SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLC********************************************************LS***********TESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTL*********SSPDYVLSSLTLC***************************************************************************YVLSSLTLCNT*********************************L*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PDYVLSSL****************************************************************************************************************************************************************************************************************************GLPDSV**********
*********QKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVWQ********
MSLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN***NITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVWQQS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVCLSGLPDSVWQQSGNLKET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query2713 2.2.26 [Sep-21-2011]
P234712315 Receptor-type tyrosine-pr yes N/A 0.028 0.032 0.474 8e-17
P085751304 Receptor-type tyrosine-pr no N/A 0.028 0.059 0.456 1e-16
Q626562316 Receptor-type tyrosine-pr yes N/A 0.028 0.033 0.468 6e-16
P068001291 Receptor-type tyrosine-pr no N/A 0.028 0.060 0.444 2e-15
P041571273 Receptor-type tyrosine-pr no N/A 0.028 0.061 0.444 5e-15
Q059091442 Receptor-type tyrosine-pr no N/A 0.030 0.056 0.452 9e-15
Q9IBD81216 Receptor-type tyrosine-pr N/A N/A 0.035 0.079 0.376 2e-14
Q641Z2593 Tyrosine-protein phosphat no N/A 0.043 0.200 0.376 4e-14
O35239593 Tyrosine-protein phosphat no N/A 0.043 0.200 0.376 5e-14
P43378593 Tyrosine-protein phosphat no N/A 0.043 0.200 0.376 6e-14
>sp|P23471|PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens GN=PTPRZ1 PE=1 SV=4 Back     alignment and function desciption
 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 2/78 (2%)

Query: 55   GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECV 114
            GP+++T EDFWRM+WE    VI+M T ++E+GR KC QYWP  +G++  +G+FLVT + V
Sbjct: 1802 GPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWP-ADGSE-EYGNFLVTQKSV 1859

Query: 115  TSSPDYVLSSLTLCNTKV 132
                 Y + + TL NTK+
Sbjct: 1860 QVLAYYTVRNFTLRNTKI 1877




May be involved in the regulation of specific developmental processes in the CNS.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P08575|PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens GN=PTPRC PE=1 SV=2 Back     alignment and function description
>sp|Q62656|PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus GN=Ptprz1 PE=1 SV=1 Back     alignment and function description
>sp|P06800|PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus GN=Ptprc PE=1 SV=3 Back     alignment and function description
>sp|P04157|PTPRC_RAT Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus GN=Ptprc PE=2 SV=2 Back     alignment and function description
>sp|Q05909|PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus GN=Ptprg PE=1 SV=1 Back     alignment and function description
>sp|Q9IBD8|PTPRC_CYPCA Receptor-type tyrosine-protein phosphatase C OS=Cyprinus carpio GN=ptprc PE=2 SV=1 Back     alignment and function description
>sp|Q641Z2|PTN9_RAT Tyrosine-protein phosphatase non-receptor type 9 OS=Rattus norvegicus GN=Ptpn9 PE=2 SV=1 Back     alignment and function description
>sp|O35239|PTN9_MOUSE Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus GN=Ptpn9 PE=2 SV=2 Back     alignment and function description
>sp|P43378|PTN9_HUMAN Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens GN=PTPN9 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2713
258597183881 probable protein [Plasmodium falciparum 0.281 0.867 0.334 1e-42
1608809402228 chromosome segregation ATPase-like prote 0.708 0.862 0.173 2e-36
292618776 3307 PREDICTED: neuroblast differentiation-as 0.569 0.467 0.224 4e-32
307212646660 Tyrosine-protein phosphatase non-recepto 0.039 0.162 0.470 5e-19
332029240663 Tyrosine-protein phosphatase non-recepto 0.037 0.152 0.504 6e-19
322802958526 hypothetical protein SINV_02788 [Solenop 0.037 0.192 0.504 1e-18
345479465658 PREDICTED: tyrosine-protein phosphatase 0.036 0.151 0.490 1e-18
380023057659 PREDICTED: tyrosine-protein phosphatase 0.036 0.150 0.504 2e-18
383855968659 PREDICTED: tyrosine-protein phosphatase 0.036 0.150 0.495 2e-18
110758020660 PREDICTED: tyrosine-protein phosphatase 0.036 0.15 0.504 2e-18
>gi|258597183|ref|XP_001347709.2| probable protein [Plasmodium falciparum 3D7] gi|254832584|gb|AAN35622.2| probable protein [Plasmodium falciparum 3D7] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 314/940 (33%), Positives = 398/940 (42%), Gaps = 176/940 (18%)

Query: 107  FLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 166
            F+V  + V  SPDY L  + L +T       SPDY L  + L +T      SSPDY L  
Sbjct: 113  FVVLPDTVYFSPDYTLRLIQLPDTMYF----SPDYTLRLVQLPDTMY----SSPDYTLRL 164

Query: 167  LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYV 226
            + L  T      SSPDY L  + L +T       SPD  L  + L +T       SPD  
Sbjct: 165  IQLPGTMY----SSPDYSLRLVQLPDTMYF----SPDCTLRLVQLPDTMY----VSPDCT 212

Query: 227  LSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP 286
            L  + L +T      SSPDY L  + L +T       SPDY L  + L +T       SP
Sbjct: 213  LRLVQLPDTMY----SSPDYTLRLIQLPDTMYF----SPDYTLRLVQLPDTMYF----SP 260

Query: 287  DYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 346
            DY L  + L +T       SPDY L  + L  T       SPDY L  + L +T      
Sbjct: 261  DYSLPFVVLPDT----VYVSPDYTLRLIQLPGTMYF----SPDYTLRLIQLPDTMYF--- 309

Query: 347  SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVN 406
             SPDY L  + L +T       SPD  L  + L +T      SSPDY L  + L  T   
Sbjct: 310  -SPDYSLRLVQLPDTMYF----SPDCTLRLVQLPDTMY----SSPDYSLRLIQLPGTMYF 360

Query: 407  ITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNT 466
                SPDY L  + L +T      SSPDY L  + L +T       SPDY L  + L +T
Sbjct: 361  ----SPDYSLRLMQLPDT----VYSSPDYSLRLVQLPDTMYF----SPDYTLRLVQLPDT 408

Query: 467  KVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTL 526
                   SPDY L  + L +T       SPDY L  + L +T       SPDY L  + L
Sbjct: 409  MYF----SPDYSLPFVGLPDTMY----VSPDYTLRLVQLPDTMYF----SPDYTLRLIQL 456

Query: 527  CNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 586
             +T       SPDY L  + L  T       SPDY L  + L +T       SPDY L  
Sbjct: 457  PDTMYF----SPDYTLRLIQLPGTMYF----SPDYTLRLVQLPDTMYF----SPDYTLPF 504

Query: 587  LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYV 646
            + L +T       SPDY L  + L  T      SSPDY L  + L +T       SPD  
Sbjct: 505  VVLPDTMYF----SPDYTLRLIQLPGTMY----SSPDYTLRLIQLPDTMYF----SPDCT 552

Query: 647  LSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP 706
            L  + L +T       SPD  L  + L +T      SSPD  L  + L +T       SP
Sbjct: 553  LRLVQLPDTMY----VSPDCTLRLVQLPDTMY----SSPDCTLRLVQLPDT----VYFSP 600

Query: 707  DYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE 766
            D  L  + L +T       SPDY L  + L  T      SSPDY L  + L +T      
Sbjct: 601  DCTLPFVVLPDT----VYFSPDYTLRLIQLPGTMY----SSPDYTLRLIQLPDTMYF--- 649

Query: 767  SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVN 826
             SPD  L  + L +T       SPD  L  + L +T       SPDY L  + L +T   
Sbjct: 650  -SPDCTLRLVQLPDT----VYFSPDCTLPFVVLPDT----VYFSPDYTLRLIQLPDTMYF 700

Query: 827  ITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNT 886
                SPDY L  + L +T       SP+Y L  + L  T       SPDY L  + L +T
Sbjct: 701  ----SPDYTLPFVVLPDTMYF----SPEYTLRLIQLPGTMYF----SPDYSLRLVQLPDT 748

Query: 887  KVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTL 946
                   SPDY L  + L +T      SSP Y L  + L +T      SSPDY L  + L
Sbjct: 749  MYF----SPDYSLRLVQLPDTMY----SSPGYTLPFVVLPDTMY----SSPDYTLRLIQL 796

Query: 947  CNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSS 1006
             +T       SPD  L  + L +T       SPDY L  + L +T       SPDY L  
Sbjct: 797  PDT----VYFSPDCTLPFVVLPDT----VYFSPDYTLRLIQLPDTMYF----SPDYSLRL 844

Query: 1007 LTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVL 1046
            + L +T       SPDY L  + L +T      SSP Y L
Sbjct: 845  VQLPDTMYF----SPDYSLRLVQLPDTMY----SSPGYTL 876




Source: Plasmodium falciparum 3D7

Species: Plasmodium falciparum

Genus: Plasmodium

Family:

Order: Haemosporida

Class: Aconoidasida

Phylum: Apicomplexa

Superkingdom: Eukaryota

>gi|160880940|ref|YP_001559908.1| chromosome segregation ATPase-like protein [Clostridium phytofermentans ISDg] gi|160429606|gb|ABX43169.1| Chromosome segregation ATPase-like protein [Clostridium phytofermentans ISDg] Back     alignment and taxonomy information
>gi|292618776|ref|XP_684581.4| PREDICTED: neuroblast differentiation-associated protein AHNAK [Danio rerio] Back     alignment and taxonomy information
>gi|307212646|gb|EFN88349.1| Tyrosine-protein phosphatase non-receptor type 9 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332029240|gb|EGI69223.1| Tyrosine-protein phosphatase non-receptor type 9 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322802958|gb|EFZ23095.1| hypothetical protein SINV_02788 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345479465|ref|XP_001606932.2| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380023057|ref|XP_003695346.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Apis florea] Back     alignment and taxonomy information
>gi|383855968|ref|XP_003703482.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|110758020|ref|XP_394701.3| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2713
POMBASE|SPBPJ4664.02 3971 SPBPJ4664.02 "cell surface gly 0.890 0.608 0.315 2.5e-195
ZFIN|ZDB-GENE-040426-1562 5655 si:ch73-343m12.1 "si:ch73-343m 0.904 0.434 0.219 3e-58
UNIPROTKB|Q02505 2541 MUC3A "Mucin-3A" [Homo sapiens 0.664 0.709 0.241 8.8e-51
ZFIN|ZDB-GENE-041001-1848328 si:dkey-30j22.1 "si:dkey-30j22 0.881 0.287 0.215 1e-49
FB|FBgn005258016 Muc14A "Mucin 14A" [Drosophila 0.915 155.1 0.208 1.3e-44
FB|FBgn0036181 3135 Muc68Ca "Mucin 68Ca" [Drosophi 0.873 0.755 0.237 1.3e-43
DICTYBASE|DDB_G02778531710 ecmA "extracellular matrix pro 0.468 0.742 0.209 4.3e-39
UNIPROTKB|Q685J3 4493 MUC17 "Mucin-17" [Homo sapiens 0.899 0.542 0.231 2.5e-38
MGI|MGI:2153525 3443 Muc4 "mucin 4" [Mus musculus ( 0.789 0.622 0.212 1.2e-36
CGD|CAL00038741404 PGA55 [Candida albicans (taxid 0.342 0.661 0.239 8.8e-34
POMBASE|SPBPJ4664.02 SPBPJ4664.02 "cell surface glycoprotein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
 Score = 1926 (683.0 bits), Expect = 2.5e-195, P = 2.5e-195
 Identities = 877/2784 (31%), Positives = 1294/2784 (46%)

Query:   109 VTTECVTSSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 162
             +T+  V +S   + SS T+ NT   IT S+       ++S T  NT   IT SS      
Sbjct:   468 ITSSSVLNSSTPITSS-TVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSST 526

Query:   163 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 216
              ++S T  NT  +IT SS       ++S T+ NT   IT SS       ++S T+ NT  
Sbjct:   527 PITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTST 586

Query:   217 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 270
              IT  S       ++S T+ N+   IT SS       ++S T  NT   IT SS   VL+
Sbjct:   587 PITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSS---VLN 643

Query:   271 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 327
             S T   +   +  S+P   ++S T  NT   IT SS       ++S T  NT   IT SS
Sbjct:   644 SSTPITSSSVLNSSTP---ITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSS 700

Query:   328 ---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKV 384
                    ++S T  NT   IT SS   VL+S T   +   +  S+P   ++S ++ N+  
Sbjct:   701 VLNSSTAITSSTALNTSTPITSSS---VLNSSTPITSSTALNTSTP---ITSSSVLNSST 754

Query:   385 NITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLT 441
              IT SS   +L+S T   +   +  S+P   ++S T+ NT   IT SS       ++S T
Sbjct:   755 PITSSS---ILNSSTPITSSSVLNSSTP---ITSSTVVNTSTPITSSSVLNSSTPITSST 808

Query:   442 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 498
             + N+   IT SS   VL+S T   +   +  S+P   ++S T+ N+   IT SS      
Sbjct:   809 VLNSSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSSSVLNSST 862

Query:   499 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 552
              ++S T  NT   IT SS       ++S T+ NT   IT S+       ++S T  NT  
Sbjct:   863 PITSSTALNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 922

Query:   553 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 609
              IT SS       ++S T  NT   IT SS   VL+S T   +   +  S+P   ++S T
Sbjct:   923 PITSSSVLNSSTPITSSTGLNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 976

Query:   610 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 663
               NT   IT SS       ++S ++ NT   IT SS       ++S T  NT   IT SS
Sbjct:   977 ALNTSTPITSSSVLNSSTPITSSSVLNTSTPITSSSVLNSSTAITSSTALNTSTPITSSS 1036

Query:   664 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLT 714
                    ++S T+ NT   IT S+       ++S T  NT   IT SS       ++S T
Sbjct:  1037 VLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSST 1096

Query:   715 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 771
             + N+   IT SS   VL+S T   +   +  S+P   ++S T  NT   IT SS      
Sbjct:  1097 VLNSSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTALNTSTPITSSSVLNSST 1150

Query:   772 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 831
              ++S T+ NT   IT S+   V++S T   +   +  S+P   ++S T+ NT   IT S+
Sbjct:  1151 PITSSTVVNTSTPITSST---VVNSSTPITSSTVVNTSTP---ITSSTVVNTSTPITSST 1204

Query:   832 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 885
                    ++S T+ NT   IT SS       ++S ++ N+   IT SS   VL+S T   
Sbjct:  1205 VVNSSTPITSSTVLNTSTPITSSSVLNSSTPITSSSILNSSTPITSSS---VLNSSTPIT 1261

Query:   886 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 939
             +   +  S+P   ++S T  NT + IT SS       ++S T  NT  +IT SS      
Sbjct:  1262 SSTVVNSSTP---ITSSTALNTSIPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSST 1318

Query:   940 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 999
              ++S T+ NT   IT SS   VL+S T   +   +  S+P   ++S T+ NT   IT S+
Sbjct:  1319 PITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNSSTP---ITSSTVVNTSTPITSST 1372

Query:  1000 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1056
                V+++ T   +   +  S+P   ++S T+ N+   IT SS       ++S T+ NT  
Sbjct:  1373 ---VVNTSTPITSSTVVNSSTP---ITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 1426

Query:  1057 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 1110
              IT S+       ++S T+ NT   IT SS       ++S T+ NT   IT S+   V++
Sbjct:  1427 PITSSTVVNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSST---VVN 1483

Query:  1111 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 1167
             S T   +   +  S+P   ++S T+ NT   IT S+       ++S T+ NT   IT SS
Sbjct:  1484 SSTPITSSTVVNTSTP---ITSSTVVNTSTPITSSTVVNSSTPITSSTVLNTSTPITSSS 1540

Query:  1168 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1224
                VL+S T   +   +  S+P   ++S T+ NT   IT SS       ++S T  NT  
Sbjct:  1541 ---VLNSSTPITSSSVLNSSTP---ITSSTVVNTSTPITSSSVVNSSTPITSSTALNTST 1594

Query:  1225 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 1281
              IT SS       ++S T  NT   IT SS   VL+S T   +   +  S+P   ++S T
Sbjct:  1595 PITSSSVLNSSTPITSSTALNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 1648

Query:  1282 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 1335
               NT   IT S+       ++S T+ NT   IT S+       ++S T  NT   IT SS
Sbjct:  1649 ALNTSPPITSSTVVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSS 1708

Query:  1336 ---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKV 1392
                    ++S T+ NT   IT S+   V++S T   +   +  S+P   ++S T  NT  
Sbjct:  1709 VLNSSTPITSSTVVNTSTPITSST---VVNSSTPITSSTVVNSSTP---ITSSTALNTST 1762

Query:  1393 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1443
              IT SS       ++S T  NT   IT SS       ++S T  NT   IT SS      
Sbjct:  1763 PITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSST 1822

Query:  1444 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1497
              ++S T+ NT   IT S+       ++S T  NT   IT SS       ++S T  NT  
Sbjct:  1823 PITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTST 1882

Query:  1498 NITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 1557
              IT SS   VL+S T   +   +  S+P   ++S T  NT   IT SS   VL+S T   
Sbjct:  1883 PITSSS---VLNSSTPITSSTVLNSSTP---ITSSTALNTSTPITSSS---VLNSSTPIT 1933

Query:  1558 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1611
             +   +  S+P   ++S T+ N+   IT SS       ++S T  NT   IT SS      
Sbjct:  1934 SSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSST 1990

Query:  1612 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1665
              ++S ++ NT   IT SS       ++S T+ NT   IT S+       ++S T  NT  
Sbjct:  1991 PITSSSVLNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 2050

Query:  1666 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 1722
              IT SS       ++S T  NT   IT SS   VL+S T   +   +  S+P   ++S T
Sbjct:  2051 PITSSSVLNSSTPITSSTALNTSTPITSSS---VLNSSTPITSSTVLNSSTP---ITSST 2104

Query:  1723 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDY 1779
               NT   IT SS   VL+S T   +   +  S+P   ++S T+ N+   IT SS      
Sbjct:  2105 ALNTSTPITSSS---VLNSSTPITSSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSST 2158

Query:  1780 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 1839
              ++S T  NT   IT SS   VL+S T   +   +  S+P   ++S T+ NT   IT S+
Sbjct:  2159 PITSSTALNTSTPITSSS---VLNSSTPITSSTVVNSSTP---ITSSTVVNTSTPITSST 2212

Query:  1840 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 1896
                V+++ T   +   +  S+P   ++S T+ N+   IT SS       ++S T+ NT  
Sbjct:  2213 ---VVNTSTPITSSTVVNSSTP---ITSSTVLNSSTPITSSSVLNSSTPITSSTVVNTST 2266

Query:  1897 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 1947
              IT S+       ++S T+ NT   IT S+       ++S T  NT   IT SS      
Sbjct:  2267 PITSSTVVNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSST 2326

Query:  1948 VLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS 2007
              ++S T+ NT   IT SS   VL+S T   +   +  S+P   ++S T  NT  +IT SS
Sbjct:  2327 PITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTALNTSTSITSSS 2380

Query:  2008 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCN 2061
                    ++S T+ NT   IT SS       ++S T+ NT  +IT SS   VL+S T   
Sbjct:  2381 VLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTSITSSS---VLNSSTPIT 2437

Query:  2062 TKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESSPDYVLS 2118
             +   +  S+P   ++S T+ N+   IT SS       ++S T  NT   IT SS   VL+
Sbjct:  2438 SSSVLNSSTP---ITSSTVVNSSTPITSSSVLNSSTPITSSTALNTSTPITSSS---VLN 2491

Query:  2119 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDY 2178
             S T   +   +  S+P   ++S T+ N+   IT S+   VL+S T   +   +  S+P  
Sbjct:  2492 SSTPITSSTVVNTSTP---ITSSTVVNSSTPITSST---VLNSSTPITSSSVLNSSTP-- 2543

Query:  2179 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 2232
              ++S T+ NT   IT S+       ++SLT  N+   IT SS       ++S T+ NT  
Sbjct:  2544 -ITSSTVVNTSTPITSSTVVNSSTPITSLTALNSSTPITSSSVLNSSTPITSSTVVNTST 2602

Query:  2233 NITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDY 2283
              IT S+       ++S T  NT   IT SS       ++S T  NT  +IT SS      
Sbjct:  2603 PITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSST 2662

Query:  2284 VLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKV 2337
              ++S T+ NT   IT SS       ++S T+ NT   IT S+       ++S T  NT  
Sbjct:  2663 PITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTST 2722

Query:  2338 NITESS---PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLT 2394
              IT SS       ++S T+ NT   IT SS   VL+S T   +   +  S+P   ++S T
Sbjct:  2723 PITSSSVLNSSTPITSSTVVNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSST 2776

Query:  2395 LCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSPDYVLS 2454
               NT   IT SS   VL+S T   +   +  S+P   ++S T+ N+   IT S+   VL+
Sbjct:  2777 ALNTSTPITSSS---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSST---VLN 2827

Query:  2455 SLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 2511
             S T   +   +  S+P   ++S T  NT   IT SS       ++S T  NT  +IT SS
Sbjct:  2828 SSTPITSSSVLNSSTP---ITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSS 2884

Query:  2512 ---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLT 2562
                    ++S T+ NT   IT SS       ++S T+ NT   IT S+       ++S T
Sbjct:  2885 VLNSSTPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSST 2944

Query:  2563 LCNTKVNITESS---PDYVLSSLTLCNTKVNITESS---PDYVLSSLTLCNTKVNITESS 2616
               NT   IT SS       ++S T  NT  +IT SS       ++S T+ NT   IT SS
Sbjct:  2945 ALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSSTPITSSTVVNTSTPITSSS 3004

Query:  2617 PDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITESSP---DYVLSSLTLCNTKV 2673
                VL+S T   +   +  S+P   ++S T+ N+   IT S+       ++S T+ N+  
Sbjct:  3005 ---VLNSSTPITSSTVVNTSTP---ITSSTVVNSSTPITSSTALNTSTPITSSTVLNSST 3058

Query:  2674 NITESSPDYVLSSLTLCNTKVCLS 2697
              IT SS   VL+S T   +   L+
Sbjct:  3059 PITSSS---VLNSSTPITSSTALN 3079


GO:0005886 "plasma membrane" evidence=IEA
GO:0007155 "cell adhesion" evidence=NAS
GO:0010339 "external side of cell wall" evidence=NAS
GO:0016740 "transferase activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=IEA
ZFIN|ZDB-GENE-040426-1562 si:ch73-343m12.1 "si:ch73-343m12.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q02505 MUC3A "Mucin-3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-184 si:dkey-30j22.1 "si:dkey-30j22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0052580 Muc14A "Mucin 14A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036181 Muc68Ca "Mucin 68Ca" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277853 ecmA "extracellular matrix protein ST430" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q685J3 MUC17 "Mucin-17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2153525 Muc4 "mucin 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
CGD|CAL0003874 PGA55 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2713
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 7e-29
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 5e-28
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 2e-27
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 8e-14
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 2e-11
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 7e-10
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 1e-06
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 1e-06
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 6e-04
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
 Score =  116 bits (294), Expect = 7e-29
 Identities = 48/102 (47%), Positives = 61/102 (59%), Gaps = 11/102 (10%)

Query: 39  YINGGLLNYIHCFFPT-------GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCA 91
           YIN    +YI  + P        GP+ NTVEDFWRMVWEQ+  VI+M T ++E+GR KCA
Sbjct: 28  YINA---SYIDGYNPPKAYIATQGPLPNTVEDFWRMVWEQKVPVIVMLTELVEKGREKCA 84

Query: 92  QYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVN 133
           QYWP  EG+ +T+GD  VT        DY + +L L NT   
Sbjct: 85  QYWPEEEGS-LTYGDITVTLVSEEKLDDYTVRTLKLSNTGTG 125


The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231

>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 2713
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02738320 hypothetical protein; Provisional 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG4228|consensus1087 100.0
KOG0792|consensus1144 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
KOG0790|consensus600 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
KOG0791|consensus374 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
KOG0793|consensus1004 100.0
KOG4228|consensus1087 100.0
KOG0789|consensus415 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.37
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.37
PTZ00242166 protein tyrosine phosphatase; Provisional 98.44
PTZ00393241 protein tyrosine phosphatase; Provisional 97.9
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 97.49
KOG1720|consensus225 96.83
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 96.77
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 96.59
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 95.95
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 95.0
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 94.41
KOG2836|consensus173 94.27
KOG2283|consensus434 93.94
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 93.33
PRK12361547 hypothetical protein; Provisional 91.59
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 90.25
COG5350172 Predicted protein tyrosine phosphatase [General fu 88.43
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 86.63
KOG1717|consensus343 86.45
KOG1718|consensus198 81.97
KOG1719|consensus183 80.5
PLN02727986 NAD kinase 80.3
KOG1716|consensus285 80.12
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.9e-48  Score=427.91  Aligned_cols=217  Identities=20%  Similarity=0.284  Sum_probs=194.4

Q ss_pred             CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503           2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII   77 (2713)
Q Consensus         2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV   77 (2713)
                      +.+++|+.||||.+++|+|+.|+.+..    ..+++||||||||+|+   ++|| ||||+++|++|||+||||+++++||
T Consensus        47 ~~~~~N~~KNRy~~i~~~D~tRV~L~~----~~~~~dYINAsyI~g~~~~~~fIatQ~Pl~~T~~dFW~MVw~~~~~vIV  122 (303)
T PHA02742         47 SLELKNMKKCRYPDAPCFDRNRVILKI----EDGGDDFINASYVDGHNAKGRFICTQAPLEETALDFWQAIFQDQVRVIV  122 (303)
T ss_pred             ccChhhhhcCCCCCCCCCCCCEEEeCC----CCCCCCcEEEeeecCCCCCCeEEEECCCCcccHHHHHHHHhhcCCCeEE
Confidence            567899999999999999999997654    2236899999999998   7999 9999999999999999999999999


Q ss_pred             EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503          78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE  157 (2713)
Q Consensus        78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP  157 (2713)
                      ||++..|.|++||++|||.++++.+.||+|.|++.++....+|..|.|.+.+.+.++.|.|+||||++|||+|     +|
T Consensus       123 mLt~~~E~g~~kc~~YWp~~~~~~~~~g~~~V~~~~~~~~~~~~~~~l~l~~~~~~~~r~V~h~~y~~Wpd~g-----vP  197 (303)
T PHA02742        123 MITKIMEDGKEACYPYWMPHERGKATHGEFKIKTKKIKSFRNYAVTNLCLTDTNTGASLDIKHFAYEDWPHGG-----LP  197 (303)
T ss_pred             EcchhhhCCeeeccccCCCCCCCceEEEEEEEEEEEEEEcCCEEEEEEEEEECCCCceEEEEEEEECCCCCCC-----cC
Confidence            9999999999999999999888889999999999999999999999999998777899999999999999999     78


Q ss_pred             CChHHHHHHHHHHHhhcC----------CCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhcccccccccce
Q psy7503         158 SSPDYVLSSLTLCNTKVN----------ITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTKVN  217 (2713)
Q Consensus       158 SSPESFLDFLEEVRKSKn----------qpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTKVD  217 (2713)
                      .++..|++|+..+++.+.          ....+||||||+||+||||+|++          ...+|..-....+|..|..
T Consensus       198 ~~~~~~l~~i~~v~~~~~~~~~~~~~~~~~~~~PIvVHCsaGvGRTGtF~aid~~i~~~~~~~~v~v~~~V~~lR~qR~~  277 (303)
T PHA02742        198 RDPNKFLDFVLAVREADLKADVDIKGENIVKEPPILVHCSAGLDRAGAFCAIDICISKYNERAIIPLLSIVRDLRKQRHN  277 (303)
T ss_pred             CCHHHHHHHHHHHHHHhhhccccccccccCCCCCeEEECCCCCchhHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhccc
Confidence            899999999999987432          11348999999999999999997          3344555567788999999


Q ss_pred             eeccchhhhh
Q psy7503         218 ITESSPDYVL  227 (2713)
Q Consensus       218 ITESseDYVF  227 (2713)
                      +.++.++|+|
T Consensus       278 ~Vqt~~QY~F  287 (303)
T PHA02742        278 CLSLPQQYIF  287 (303)
T ss_pred             ccCCHHHHHH
Confidence            9999999998



>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2713
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-15
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-15
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 6e-15
1ygr_A610 Crystal Structure Of The Tandem Phosphatase Domain 6e-15
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 9e-15
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-14
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-14
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 4e-14
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 6e-14
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 8e-14
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 1e-13
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 3e-13
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 4e-13
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 5e-13
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 5e-13
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-13
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 9e-13
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 9e-13
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 9e-13
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 9e-13
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 9e-13
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-13
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 1e-12
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 1e-12
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 1e-12
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 1e-12
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 1e-12
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 1e-12
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 1e-12
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 1e-12
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-12
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 1e-12
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-12
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 1e-12
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 1e-12
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-12
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 1e-12
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 1e-12
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-12
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 1e-12
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-12
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-12
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-12
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 2e-12
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 3e-12
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 4e-12
2jjd_A599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 5e-12
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 6e-12
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 6e-12
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 6e-12
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 6e-12
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 6e-12
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 1e-11
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 1e-11
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-11
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-11
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-11
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 2e-11
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 2e-11
1fpr_A284 Crystal Structure Of The Complex Formed Between The 2e-11
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-11
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 2e-11
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 2e-11
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 2e-11
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-11
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 2e-11
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-11
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 2e-11
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 2e-11
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 3e-11
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 4e-11
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 6e-11
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 7e-11
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 1e-10
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 1e-09
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 1e-09
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-09
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 2e-09
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 2e-09
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 2e-09
2qcj_A313 Native Structure Of Lyp Length = 313 2e-09
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 8e-09
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 8e-09
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 2e-08
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 3e-08
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 3e-08
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 3e-08
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 4e-08
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 6e-08
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 1e-07
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 2e-07
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 2e-07
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-07
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 2e-07
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 2e-15, Method: Composition-based stats. Identities = 37/78 (47%), Positives = 53/78 (67%), Gaps = 2/78 (2%) Query: 55 GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECV 114 GP+++T EDFWRM+WEQ T +IIM T ++E+GR KC QYWP TE T+ +G+ +VT + Sbjct: 108 GPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWP-TENTE-EYGNIIVTLKST 165 Query: 115 TSSPDYVLSSLTLCNTKV 132 Y + ++ NTKV Sbjct: 166 KIHACYTVRRFSIRNTKV 183
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2713
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-36
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 3e-35
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 5e-35
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 5e-35
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 5e-35
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 5e-35
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-34
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 2e-34
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 4e-34
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 9e-34
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-33
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 2e-33
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 3e-33
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 7e-33
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-32
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 2e-32
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-32
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 2e-32
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 2e-32
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 3e-32
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-27
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-31
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 3e-31
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 8e-31
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-30
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-30
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 2e-30
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 2e-26
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 3e-30
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 5e-27
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 3e-30
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 2e-24
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 5e-30
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-29
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 2e-28
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 9e-27
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 3e-20
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-04
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
 Score =  141 bits (357), Expect = 1e-36
 Identities = 39/102 (38%), Positives = 56/102 (54%), Gaps = 10/102 (9%)

Query: 39  YINGGLLNYIHCFFPT-------GPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCA 91
           YIN    +++  +          GP++NT  DFW MVWEQ+ LVI+MTTR  E GR KC 
Sbjct: 82  YINA---SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCG 138

Query: 92  QYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVN 133
           QYWP  + +++  G   VT   V +   Y  ++L + NT+  
Sbjct: 139 QYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEER 180


>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2713
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.8
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.57
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.47
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 98.95
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 98.56
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 98.08
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.04
3cm3_A176 Late protein H1, dual specificity protein phosphat 97.87
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 97.84
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 97.8
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 97.76
2q05_A195 Late protein H1, dual specificity protein phosphat 97.74
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 97.68
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.5
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 97.46
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 97.28
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 97.25
1xri_A151 AT1G05000; structural genomics, protein structure 97.22
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 97.16
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 96.96
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 96.91
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 96.87
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 96.87
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 96.8
2hcm_A164 Dual specificity protein phosphatase; structural g 96.75
2oud_A177 Dual specificity protein phosphatase 10; A central 96.7
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 96.7
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 96.68
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 96.6
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 96.37
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 96.37
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 96.14
2hxp_A155 Dual specificity protein phosphatase 9; human phos 96.09
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 95.98
3emu_A161 Leucine rich repeat and phosphatase domain contain 95.47
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 95.42
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 95.35
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 94.88
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 94.66
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 93.12
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 90.75
2f46_A156 Hypothetical protein; structural genomics, joint c 89.22
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-51  Score=449.72  Aligned_cols=219  Identities=22%  Similarity=0.348  Sum_probs=198.6

Q ss_pred             CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503           2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII   77 (2713)
Q Consensus         2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV   77 (2713)
                      +.+++|+.||||.+|+|+|+.||++..  ..+.+++||||||||+|+   ++|| ||||+++|++|||+||||+++.+||
T Consensus        47 ~~~~~N~~KNRy~dI~pyD~tRV~L~~--~~~~~~sdYINAs~I~g~~~~~~yIaTQgPl~~T~~dFW~MVwe~~~~~IV  124 (314)
T 4ge6_A           47 SMSPGNLEKNRYGDVPCLDQTRVKLTK--RSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIV  124 (314)
T ss_dssp             HHSTTTGGGCSCTTCCCCTTTBCCCCC--CSSSCCCSCCSEEEEEETTEEEEEEEECCCCGGGHHHHHHHHHHTTCCEEE
T ss_pred             ccChhhhccCCCCCcCCCcCcEEEccC--CCCCCCCceEEeecccCCCCCCeEEEECCCcHHHHHHHHHHHHhcCCceEE
Confidence            357899999999999999999998764  345677899999999999   7899 9999999999999999999999999


Q ss_pred             EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503          78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE  157 (2713)
Q Consensus        78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP  157 (2713)
                      ||+...|+++.||++|||.+.++.+.||.|+|++.++....+|+.|.|++.+.+.++.|.|+||||++|||+|     +|
T Consensus       125 mLt~~~E~g~~kC~~YwP~~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~~~~~~~~~~r~V~h~~y~~WPd~g-----vP  199 (314)
T 4ge6_A          125 MTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYG-----VP  199 (314)
T ss_dssp             ECSCSEETTEECCCCCSCCSTTCEEEETTEEEEEEEEEECSSEEEEEEEEEETTTTEEEEEEEEEECCSCSSS-----CC
T ss_pred             EcccccccceecccccCcCCCCCceecccEEEEEEEEEEcCCceEEEEeeecccCCcceEEEEEEeCCCCCCC-----CC
Confidence            9999999999999999999999999999999999999999999999999999888999999999999999999     68


Q ss_pred             CChHHHHHHHHHHHhhcC------------CCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhccccccccc
Q psy7503         158 SSPDYVLSSLTLCNTKVN------------ITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTK  215 (2713)
Q Consensus       158 SSPESFLDFLEEVRKSKn------------qpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTK  215 (2713)
                      .++..+++|++.|++.+.            ..+.+||||||+||+||||+||+          +..+|..-.+..+|..|
T Consensus       200 ~~~~~ll~~i~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCSaGvGRTGtfiaid~~l~~l~~~~~vdv~~~V~~lR~qR  279 (314)
T 4ge6_A          200 SSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQR  279 (314)
T ss_dssp             SCSHHHHHHHHHHHHHHHHHHHHSCCC----CCSCCEEEECSSSSHHHHHHHHHHHHHHHHHHHSCBCHHHHHHHHTTTS
T ss_pred             CCHHHHHHHHHHHHHHHhhhhccccccccccCCCCCEEEECCCCCcHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhc
Confidence            899999999999986542            23458999999999999999997          34456555667899999


Q ss_pred             ceeeccchhhhh
Q psy7503         216 VNITESSPDYVL  227 (2713)
Q Consensus       216 VDITESseDYVF  227 (2713)
                      ..++++.++|+|
T Consensus       280 ~~mVqt~~QY~F  291 (314)
T 4ge6_A          280 AFSIQTPEQYYF  291 (314)
T ss_dssp             TTCSCSHHHHHH
T ss_pred             ccccCCHHHHHH
Confidence            999999999988



>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 2713
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 9e-18
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 5e-17
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 4e-15
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 7e-15
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-14
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 3e-14
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-14
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 6e-14
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 1e-13
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-13
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 4e-13
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 9e-13
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-10
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 6e-05
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-04
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: SptP tyrosine phosphatase, catalytic domain
species: Salmonella typhimurium [TaxId: 90371]
 Score = 83.2 bits (205), Expect = 9e-18
 Identities = 10/99 (10%), Positives = 29/99 (29%), Gaps = 8/99 (8%)

Query: 39  YIN------GGLLNYIHCFFPTGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQ 92
            +        G    +   +P     + +E   +M+ E++   +++ T   +    +   
Sbjct: 34  PVPVNTLTFDGKPVALAGSYPK-NTPDALEAHMKMLLEKECSCLVVLTSEDQMQAKQLPP 92

Query: 93  YWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTK 131
           Y+ G   T              +        ++ L   +
Sbjct: 93  YFRG-SYTFGEVHTNSQKVSSASQGEAIDQYNMQLSCGE 130


>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2713
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.57
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.4
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 98.31
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 98.28
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 97.96
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 97.53
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 96.16
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 95.94
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 95.73
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 95.7
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 88.16
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Protein-tyrosine phosphatase alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.9e-49  Score=412.98  Aligned_cols=217  Identities=21%  Similarity=0.355  Sum_probs=198.5

Q ss_pred             CccccccCCCCCCCCCCCCceeEeeccccCCCCCCCCceEEeecccC---Ccce-ecCCCccChHhHHhhhhccCCCEEE
Q psy7503           2 SLKNKQKVQKPLNCIFPQHILTLTKWENKNRHKSTKQYINGGLLNYI---HCFF-PTGPMQNTVEDFWRMVWEQQTLVII   77 (2713)
Q Consensus         2 GLKNENKNKNRYNDILPYDRVRVKL~RVKInGDPGSDYINASFVDGY---KKYI-TQGPLPDTIEDFWRMVWEENVEVIV   77 (2713)
                      |-.|+|+.||||.+++|+|+.||.+..  .++.+++||||||||+|+   ++|| ||+|+++|++|||+||||+++++||
T Consensus         4 ~~lp~N~~KNRy~di~p~D~sRV~L~~--~~~~~~~dYINAs~V~g~~~~~~yI~tQ~P~~~T~~dFW~Mv~~~~~~~IV   81 (245)
T d1p15a_           4 GNLPANMKKNRVLQIIPYEFNRVIIPV--KRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIV   81 (245)
T ss_dssp             GGSTTTSTTCSCSSCCCCTTSBCCCCC--CSSSSSTTCCSEEEECCSSCTTCEEEECCCCSSSHHHHHHHHHHTTCCEEE
T ss_pred             ccCccccccCCCCCCCCCcCCEEEecC--CCCCCCCceEEEEeecCCCCCCeeEEECCCCccchhhHhhheecCCCCEEE
Confidence            568999999999999999999998765  234567899999999999   7899 9999999999999999999999999


Q ss_pred             EcCCcccCCcccccccCCCCCCCeeEEeeEEEEEeeEEeCCceEEEEEEeeccccCceeEEEEEEECCCCCCCCcCccCC
Q psy7503          78 MTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNITE  157 (2713)
Q Consensus        78 MLTpLSEKGKEKC~QYWPTEEGEpLKYGKFTVTLKKVEQKpDYTVRTLKVTNTKnGESRTVTHFQYTSWPDHGVPVNIVP  157 (2713)
                      ||++..|.++.+|.+|||.+  +...+|+|+|++.++...++++.|.|.|...+.+++|.|+||||++||++|     .|
T Consensus        82 mL~~~~e~~~~~~~~y~p~~--~~~~~~~~~v~~~~~~~~~~~~~r~l~l~~~~~~~~~~v~~~~y~~Wpd~~-----~P  154 (245)
T d1p15a_          82 MLTELEERGQEKCAQYWPSD--GLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVG-----IP  154 (245)
T ss_dssp             ECSCSCSSSSCCSCCCSCSS--SCCEETTEECCSCCCEECSSEEEEEEEEECSSCCEEEEEEEEEECCSCSSS-----CC
T ss_pred             EEeccccCCCcccccccCCC--CceEeccEEEEEEEEEEcCCceEEEEEEEECCCCceEEEEEEEecCCCccC-----CC
Confidence            99999999999999999976  688899999999999999999999999998888999999999999999998     67


Q ss_pred             CChHHHHHHHHHHHhhcCCCCCCCeEEEcCCCCCceeEEEc----------ccchhhhhcccccccccceeeccchhhhh
Q psy7503         158 SSPDYVLSSLTLCNTKVNITESSPDYVLSSLTLCNTKVNIT----------ESSPDYVLSSLTLCNTKVNITESSPDYVL  227 (2713)
Q Consensus       158 SSPESFLDFLEEVRKSKnqpRSGPIVVHCSAGVGRTGVFIT----------eSSPDYVLSsLTLCNTKVDITESseDYVF  227 (2713)
                      .++..+++|++++++.+.....+||+|||++|+||||+|++          ...+|..-.++.+|..|..+.++.++|.|
T Consensus       155 ~~~~~~l~~~~~v~~~~~~~~~~PivVHCs~G~gRsg~f~a~~~~~~~l~~~~~vdv~~~v~~lR~qR~~~vqt~~QY~f  234 (245)
T d1p15a_         155 SDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEF  234 (245)
T ss_dssp             SSSCSHHHHHHHHHHHTTTTTSCCEEEESSSSSHHHHHHHHHHHHHHHHHHHSCCCTTHHHHHHHTTSTTSSCSTTTTHH
T ss_pred             CCHHHHHHHHHHHHhhhccCCCCCEEEEcCCCCccccHHHHHHHHHHHHHcCCCcCHHHHHHHHHHhcccccCCHHHHHH
Confidence            78889999999999887666779999999999999999996          45677777778899999999999999988



>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure