Psyllid ID: psy752
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 242021609 | 448 | retinoid X receptor, putative [Pediculus | 0.764 | 0.209 | 0.656 | 4e-27 | |
| 259906648 | 401 | estrogen receptor-like protein [Teleogry | 0.471 | 0.144 | 0.965 | 1e-26 | |
| 345496190 | 438 | PREDICTED: steroid hormone receptor ERR2 | 0.739 | 0.207 | 0.62 | 2e-25 | |
| 308756033 | 470 | estrogen-related receptor [Tachypleus tr | 0.601 | 0.157 | 0.783 | 2e-25 | |
| 391338687 | 452 | PREDICTED: estrogen-related receptor gam | 0.463 | 0.126 | 0.929 | 2e-25 | |
| 241727058 | 406 | estrogen receptor beta, putative [Ixodes | 0.463 | 0.140 | 0.964 | 4e-25 | |
| 283825466 | 500 | estrogen-related receptor [Scylla parama | 0.707 | 0.174 | 0.666 | 7e-25 | |
| 213513284 | 415 | estrogen-related receptor [Tribolium cas | 0.463 | 0.137 | 0.929 | 1e-24 | |
| 383863647 | 434 | PREDICTED: steroid hormone receptor ERR2 | 0.739 | 0.209 | 0.61 | 1e-24 | |
| 170053275 | 446 | estrogen-related receptor [Culex quinque | 0.455 | 0.125 | 0.946 | 2e-24 |
| >gi|242021609|ref|XP_002431237.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212516486|gb|EEB18499.1| retinoid X receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 125 bits (313), Expect = 4e-27, Method: Compositional matrix adjust.
Identities = 67/102 (65%), Positives = 75/102 (73%), Gaps = 8/102 (7%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL-- 58
NIEYTCPA+NDCEINKRRRKACQACRFQKCLR GMLKEGVRLDRVRGGRQKYRRN D
Sbjct: 147 NIEYTCPAANDCEINKRRRKACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRNTDTPY 206
Query: 59 -LSQQWPPNKSIPSLED---LERNT--EISVSMMSCDGDTSD 94
+ P +PSLED LE + E +S+M+ D +D
Sbjct: 207 QIHSMLPLKPYLPSLEDNKILEALSLNEPDISVMAQDISNAD 248
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|259906648|gb|ACW84414.1| estrogen receptor-like protein [Teleogryllus emma] | Back alignment and taxonomy information |
|---|
| >gi|345496190|ref|XP_001604033.2| PREDICTED: steroid hormone receptor ERR2 isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|308756033|gb|ADO51071.1| estrogen-related receptor [Tachypleus tridentatus] | Back alignment and taxonomy information |
|---|
| >gi|391338687|ref|XP_003743687.1| PREDICTED: estrogen-related receptor gamma-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|241727058|ref|XP_002404502.1| estrogen receptor beta, putative [Ixodes scapularis] gi|215505447|gb|EEC14941.1| estrogen receptor beta, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|283825466|gb|ADB43256.1| estrogen-related receptor [Scylla paramamosain] | Back alignment and taxonomy information |
|---|
| >gi|213513284|ref|NP_001135406.1| estrogen-related receptor [Tribolium castaneum] gi|270011014|gb|EFA07462.1| estrogen-related receptor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383863647|ref|XP_003707291.1| PREDICTED: steroid hormone receptor ERR2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|170053275|ref|XP_001862599.1| estrogen-related receptor [Culex quinquefasciatus] gi|167873854|gb|EDS37237.1| estrogen-related receptor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| FB|FBgn0035849 | 496 | ERR "estrogen-related receptor | 0.455 | 0.112 | 0.928 | 2.2e-28 | |
| UNIPROTKB|F1MBX3 | 422 | ESRRA "Uncharacterized protein | 0.471 | 0.137 | 0.827 | 6e-25 | |
| UNIPROTKB|Q6QMY5 | 422 | ESRRA "Steroid hormone recepto | 0.471 | 0.137 | 0.827 | 6e-25 | |
| UNIPROTKB|F1RQP2 | 422 | ESRRA "Uncharacterized protein | 0.471 | 0.137 | 0.827 | 6e-25 | |
| MGI|MGI:1346831 | 422 | Esrra "estrogen related recept | 0.471 | 0.137 | 0.827 | 6e-25 | |
| RGD|1583866 | 422 | Esrra "estrogen related recept | 0.471 | 0.137 | 0.827 | 6e-25 | |
| UNIPROTKB|P11474 | 423 | ESRRA "Steroid hormone recepto | 0.471 | 0.137 | 0.827 | 6.2e-25 | |
| ZFIN|ZDB-GENE-990415-68 | 436 | esrra "estrogen-related recept | 0.674 | 0.190 | 0.635 | 1e-23 | |
| UNIPROTKB|F1PFF7 | 613 | ESRRA "Steroid hormone recepto | 0.471 | 0.094 | 0.827 | 1.1e-23 | |
| UNIPROTKB|F1NBB9 | 438 | ESRRB "Uncharacterized protein | 0.569 | 0.159 | 0.693 | 1.4e-22 |
| FB|FBgn0035849 ERR "estrogen-related receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 288 (106.4 bits), Expect = 2.2e-28, Sum P(3) = 2.2e-28
Identities = 52/56 (92%), Positives = 54/56 (96%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNP 56
NIEYTCPA+N+CEINKRRRKACQACRFQKCL GMLKEGVRLDRVRGGRQKYRRNP
Sbjct: 158 NIEYTCPANNECEINKRRRKACQACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNP 213
|
|
| UNIPROTKB|F1MBX3 ESRRA "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6QMY5 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQP2 ESRRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1346831 Esrra "estrogen related receptor, alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1583866 Esrra "estrogen related receptor, alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11474 ESRRA "Steroid hormone receptor ERR1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990415-68 esrra "estrogen-related receptor alpha" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PFF7 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBB9 ESRRB "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 1e-33 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 1e-18 | |
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 4e-18 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 2e-17 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 1e-14 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 1e-14 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 2e-14 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 5e-13 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 4e-12 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 8e-12 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 3e-11 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 8e-11 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 2e-10 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 3e-10 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 2e-09 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 2e-09 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 2e-09 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 3e-09 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 9e-09 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 2e-08 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 7e-08 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 1e-07 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 2e-07 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 2e-07 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 4e-07 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 6e-07 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 8e-07 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 9e-07 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 2e-06 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 3e-06 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 8e-06 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 1e-05 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 2e-05 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 4e-05 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 6e-05 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 1e-04 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 0.001 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 0.004 |
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Score = 112 bits (281), Expect = 1e-33
Identities = 46/58 (79%), Positives = 52/58 (89%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 58
NIEY+CPA+N+CEI KRRRK+CQACRF KCL+ GMLKEGVRLDRVRGGRQKY+R D
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDA 95
|
DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 97 |
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| KOG4215|consensus | 432 | 99.6 | ||
| KOG4217|consensus | 605 | 99.6 | ||
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 99.48 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 99.48 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 99.45 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 99.44 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 99.42 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 99.4 | |
| KOG4846|consensus | 538 | 99.39 | ||
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 99.38 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 99.38 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 99.38 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 99.38 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 99.38 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 99.37 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 99.37 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 99.36 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 99.35 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 99.34 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 99.33 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 99.33 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 99.33 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 99.32 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 99.32 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 99.31 | |
| KOG4218|consensus | 475 | 99.28 | ||
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 99.27 | |
| KOG4216|consensus | 479 | 99.27 | ||
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 99.26 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 99.25 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 99.25 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 99.25 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 99.23 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 99.23 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 99.22 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 99.22 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 99.21 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 99.21 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 99.21 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 99.2 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 99.14 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 99.12 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 99.03 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 98.92 |
| >KOG4215|consensus | Back alignment and domain information |
|---|
Probab=99.60 E-value=2.5e-16 Score=125.64 Aligned_cols=52 Identities=42% Similarity=0.896 Sum_probs=47.8
Q ss_pred CCceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccc
Q psy752 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKY 52 (123)
Q Consensus 1 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~ 52 (123)
+..|+|+++.+|.|||..|+.||||||+||+.+||.++|||++|++.+..+.
T Consensus 53 ~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERDrIg~Rr~ 104 (432)
T KOG4215|consen 53 NHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERDRIGSRRP 104 (432)
T ss_pred cceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccccccccCC
Confidence 3579999999999999999999999999999999999999999998877443
|
|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 123 | ||||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 1e-21 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 1e-10 | ||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 4e-10 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 4e-10 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 3e-09 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 3e-08 | ||
| 1hcp_A | 76 | Dna Recognition By The Oestrogen Receptor: From Sol | 9e-08 | ||
| 1ynw_B | 99 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 1e-07 | ||
| 1dsz_B | 85 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 2e-07 | ||
| 4aa6_A | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 3e-07 | ||
| 4aa6_E | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 3e-07 | ||
| 1by4_A | 82 | Structure And Mechanism Of The Homodimeric Assembly | 2e-06 | ||
| 1ynw_A | 110 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 2e-06 | ||
| 1rxr_A | 83 | High Resolution Solution Structure Of The Retinoid | 2e-06 | ||
| 1dsz_A | 86 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 2e-06 | ||
| 1r0n_A | 81 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 4e-06 | ||
| 1kb2_A | 110 | Crystal Structure Of Vdr Dna-Binding Domain Bound T | 5e-06 | ||
| 2ebl_A | 89 | Solution Structure Of The Zinc Finger, C4-type Doma | 2e-05 | ||
| 1hra_A | 80 | The Solution Structure Of The Human Retinoic Acid R | 2e-05 | ||
| 3dzu_D | 419 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 3e-05 | ||
| 2han_A | 93 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 3e-05 | ||
| 1r0o_A | 86 | Crystal Structure Of The Heterodimeric Ecdysone Rec | 3e-05 | ||
| 4hn5_A | 117 | Gr Dna Binding Domain - Tslp Ngre Complex Length = | 4e-05 | ||
| 2nll_A | 66 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 6e-05 | ||
| 3g9p_B | 90 | Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 | 6e-05 | ||
| 3g6t_A | 91 | Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L | 7e-05 | ||
| 1gdc_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 7e-05 | ||
| 2gda_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 7e-05 | ||
| 1r4o_A | 92 | Crystallographic Analysis Of The Interaction Of The | 7e-05 | ||
| 1r4r_B | 92 | Crystallographic Analysis Of The Interaction Of The | 8e-05 | ||
| 1rgd_A | 71 | Structure Refinement Of The Glucocorticoid Receptor | 8e-05 | ||
| 1glu_A | 81 | Crystallographic Analysis Of The Interaction Of The | 9e-05 | ||
| 4hn6_A | 114 | Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl | 3e-04 | ||
| 1hlz_A | 94 | Crystal Structure Of The Orphan Nuclear Receptor Re | 3e-04 | ||
| 3cbb_A | 78 | Crystal Structure Of Hepatocyte Nuclear Factor 4alp | 4e-04 | ||
| 2c7a_A | 78 | Structure Of The Progesterone Receptor-Dna Complex | 4e-04 | ||
| 1r4i_A | 105 | Crystal Structure Of Androgen Receptor Dna-Binding | 6e-04 |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
|
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 | Back alignment and structure |
| >pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 | Back alignment and structure |
| >pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 | Back alignment and structure |
| >pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 | Back alignment and structure |
| >pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 | Back alignment and structure |
| >pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 | Back alignment and structure |
| >pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 | Back alignment and structure |
| >pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 | Back alignment and structure |
| >pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 | Back alignment and structure |
| >pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 | Back alignment and structure |
| >pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 | Back alignment and structure |
| >pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 | Back alignment and structure |
| >pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 | Back alignment and structure |
| >pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 | Back alignment and structure |
| >pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 | Back alignment and structure |
| >pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 | Back alignment and structure |
| >pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 | Back alignment and structure |
| >pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 | Back alignment and structure |
| >pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 | Back alignment and structure |
| >pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 | Back alignment and structure |
| >pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 | Back alignment and structure |
| >pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 | Back alignment and structure |
| >pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 | Back alignment and structure |
| >pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 | Back alignment and structure |
| >pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 1e-24 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 2e-23 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 3e-23 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 2e-21 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 7e-21 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 4e-20 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 1e-19 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 1e-19 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 1e-19 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 2e-19 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 4e-19 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 2e-17 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 1e-16 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 2e-16 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-16 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 4e-16 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 9e-16 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 3e-15 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 3e-07 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 4e-07 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 5e-06 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 5e-05 |
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
Score = 89.0 bits (221), Expect = 1e-24
Identities = 45/57 (78%), Positives = 51/57 (89%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 57
NIEY+CPA+N+CEI KRRRK+CQACRF K L+ GMLKEGVRLDRVRGGRQKY+R D
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94
|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 99.57 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 99.53 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 99.52 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 99.52 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 99.51 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 99.51 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 99.49 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 99.49 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 99.48 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 99.46 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 99.44 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 99.44 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 99.43 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 99.41 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 99.39 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 99.36 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.33 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 99.31 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 99.3 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.13 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 97.61 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 94.63 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 89.87 |
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
Probab=99.57 E-value=3.3e-16 Score=104.28 Aligned_cols=56 Identities=79% Similarity=1.389 Sum_probs=49.6
Q ss_pred CCceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccccCCC
Q psy752 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNP 56 (123)
Q Consensus 1 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~~~~~ 56 (123)
+..|.|..+++|.|++..|..|++|||+|||++||++++||.+|+++++++.++..
T Consensus 38 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~R~~~~r~k~~~~~ 93 (98)
T 1lo1_A 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRL 93 (98)
T ss_dssp TCCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSCCTTCCCCCC---
T ss_pred cCccccCccccccccccccccccchhHHHHhHcCCCHHHeecccccCcccccCCCC
Confidence 35789999999999999999999999999999999999999999999988876653
|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 123 | ||||
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 4e-14 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 9e-13 | |
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 4e-11 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 2e-10 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 2e-10 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 5e-10 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 1e-08 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 4e-08 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 4e-07 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 5e-07 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 6e-07 |
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Steroid hormone receptor Err2 DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 60.8 bits (147), Expect = 4e-14
Identities = 43/53 (81%), Positives = 49/53 (92%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYR 53
NIEY+CPA+N+CEI KRRRK+CQACRF K L+ GMLKEGVRLDRVRGGRQKY+
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK 90
|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 99.51 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 99.42 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 99.42 | |
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 99.41 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 99.38 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 99.36 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 99.34 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 99.27 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 99.19 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 99.11 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 99.07 |
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Steroid hormone receptor Err2 DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51 E-value=8.8e-16 Score=99.22 Aligned_cols=51 Identities=82% Similarity=1.465 Sum_probs=47.1
Q ss_pred CceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccc
Q psy752 2 IEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKY 52 (123)
Q Consensus 2 ~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~ 52 (123)
..|.|..+++|.++...|..|++|||+|||++||++++||.+|++.+++++
T Consensus 39 ~~~~c~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~r~~~~r~k~ 89 (90)
T d1lo1a_ 39 IEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKY 89 (90)
T ss_dssp CCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSCCTTCCCCC
T ss_pred CccchhcCCCCccCCCCccccchhhHHHHHHcCCCHHHhccccccccccCC
Confidence 468899999999999999999999999999999999999999998777765
|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|