Psyllid ID: psy752


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISVSMMSCDGDTSDLGGLSYIKKECNLNNIQCSPSSQRLYSPS
ccEEEccccccccccccccccccHHHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccHHHccHHHHHHHHHHcccccccccccccccccccEcccccHHHccccHHcccccccccccccccccccccccccHHHHHccHHccccccccEEEccccHHHccccc
nieytcpasndceiNKRRRKACQACRFQKCLRKGmlkegvrldrvrggrqkyrrnpdllsqqwppnksipsledlerNTEISVSmmscdgdtsdlgglsyikkecnlnniqcspssqrlysps
nieytcpasndceinkrRRKACQACRfqkclrkgmlkegvrldrvrggrqkyrrnpdllsqqwppnksipsleDLERNTEISVSMMSCDGDTSDLGGLSYIKKEcnlnniqcspssqrlysps
NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISVSMMSCDGDTSDLGGLSYIKKECNLNNIQCSPSSQRLYSPS
************EINKRRRKACQACRFQKCLRKGMLKEGVRLDR**************************************************LGGLSYIKKECNLNNI*************
NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGML****************************************************************************SPS***L****
NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISVSMMSCDGDTSDLGGLSYIKKECNLNNIQCS**********
*IEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKE*V******************************SLEDLERNTEISVSMMSCDGDTSDLGGLSYIKKECNLNNIQCSPSSQRLYS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEDLERNTEISVSMMSCDGDTSDLGGLSYIKKECNLNNIQCSPSSQRLYSPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q6QMY5 422 Steroid hormone receptor yes N/A 0.520 0.151 0.765 2e-24
P11474 423 Steroid hormone receptor yes N/A 0.471 0.137 0.827 2e-24
Q5QJV7 422 Steroid hormone receptor yes N/A 0.471 0.137 0.827 3e-24
O08580 422 Steroid hormone receptor yes N/A 0.471 0.137 0.827 3e-24
P11475 433 Steroid hormone receptor no N/A 0.544 0.154 0.698 4e-23
Q5RAM2 435 Estrogen-related receptor no N/A 0.463 0.131 0.807 7e-23
P62510 458 Estrogen-related receptor no N/A 0.463 0.124 0.807 7e-23
P62509 458 Estrogen-related receptor no N/A 0.463 0.124 0.807 7e-23
P62508 458 Estrogen-related receptor no N/A 0.463 0.124 0.807 7e-23
O95718 508 Steroid hormone receptor no N/A 0.544 0.131 0.698 7e-23
>sp|Q6QMY5|ERR1_CANFA Steroid hormone receptor ERR1 OS=Canis familiaris GN=ESRRA PE=2 SV=1 Back     alignment and function desciption
 Score =  111 bits (277), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/64 (76%), Positives = 56/64 (87%)

Query: 1   NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLS 60
           +IEY+CPASN+CEI KRRRKACQACRF KCLR GMLKEGVRLDRVRGGRQKY+R P++  
Sbjct: 110 SIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDP 169

Query: 61  QQWP 64
             +P
Sbjct: 170 LPFP 173




Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. May function as a modulator of the estrogen signaling pathway in the uterus.
Canis familiaris (taxid: 9615)
>sp|P11474|ERR1_HUMAN Steroid hormone receptor ERR1 OS=Homo sapiens GN=ESRRA PE=1 SV=3 Back     alignment and function description
>sp|Q5QJV7|ERR1_RAT Steroid hormone receptor ERR1 OS=Rattus norvegicus GN=Esrra PE=2 SV=2 Back     alignment and function description
>sp|O08580|ERR1_MOUSE Steroid hormone receptor ERR1 OS=Mus musculus GN=Esrra PE=1 SV=4 Back     alignment and function description
>sp|P11475|ERR2_RAT Steroid hormone receptor ERR2 OS=Rattus norvegicus GN=Esrrb PE=2 SV=1 Back     alignment and function description
>sp|Q5RAM2|ERR3_PONAB Estrogen-related receptor gamma OS=Pongo abelii GN=ESRRG PE=2 SV=1 Back     alignment and function description
>sp|P62510|ERR3_RAT Estrogen-related receptor gamma OS=Rattus norvegicus GN=Esrrg PE=2 SV=1 Back     alignment and function description
>sp|P62509|ERR3_MOUSE Estrogen-related receptor gamma OS=Mus musculus GN=Esrrg PE=1 SV=1 Back     alignment and function description
>sp|P62508|ERR3_HUMAN Estrogen-related receptor gamma OS=Homo sapiens GN=ESRRG PE=1 SV=1 Back     alignment and function description
>sp|O95718|ERR2_HUMAN Steroid hormone receptor ERR2 OS=Homo sapiens GN=ESRRB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
242021609 448 retinoid X receptor, putative [Pediculus 0.764 0.209 0.656 4e-27
259906648 401 estrogen receptor-like protein [Teleogry 0.471 0.144 0.965 1e-26
345496190 438 PREDICTED: steroid hormone receptor ERR2 0.739 0.207 0.62 2e-25
308756033 470 estrogen-related receptor [Tachypleus tr 0.601 0.157 0.783 2e-25
391338687 452 PREDICTED: estrogen-related receptor gam 0.463 0.126 0.929 2e-25
241727058 406 estrogen receptor beta, putative [Ixodes 0.463 0.140 0.964 4e-25
283825466 500 estrogen-related receptor [Scylla parama 0.707 0.174 0.666 7e-25
213513284 415 estrogen-related receptor [Tribolium cas 0.463 0.137 0.929 1e-24
383863647 434 PREDICTED: steroid hormone receptor ERR2 0.739 0.209 0.61 1e-24
170053275 446 estrogen-related receptor [Culex quinque 0.455 0.125 0.946 2e-24
>gi|242021609|ref|XP_002431237.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212516486|gb|EEB18499.1| retinoid X receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 75/102 (73%), Gaps = 8/102 (7%)

Query: 1   NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL-- 58
           NIEYTCPA+NDCEINKRRRKACQACRFQKCLR GMLKEGVRLDRVRGGRQKYRRN D   
Sbjct: 147 NIEYTCPAANDCEINKRRRKACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRNTDTPY 206

Query: 59  -LSQQWPPNKSIPSLED---LERNT--EISVSMMSCDGDTSD 94
            +    P    +PSLED   LE  +  E  +S+M+ D   +D
Sbjct: 207 QIHSMLPLKPYLPSLEDNKILEALSLNEPDISVMAQDISNAD 248




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|259906648|gb|ACW84414.1| estrogen receptor-like protein [Teleogryllus emma] Back     alignment and taxonomy information
>gi|345496190|ref|XP_001604033.2| PREDICTED: steroid hormone receptor ERR2 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|308756033|gb|ADO51071.1| estrogen-related receptor [Tachypleus tridentatus] Back     alignment and taxonomy information
>gi|391338687|ref|XP_003743687.1| PREDICTED: estrogen-related receptor gamma-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|241727058|ref|XP_002404502.1| estrogen receptor beta, putative [Ixodes scapularis] gi|215505447|gb|EEC14941.1| estrogen receptor beta, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|283825466|gb|ADB43256.1| estrogen-related receptor [Scylla paramamosain] Back     alignment and taxonomy information
>gi|213513284|ref|NP_001135406.1| estrogen-related receptor [Tribolium castaneum] gi|270011014|gb|EFA07462.1| estrogen-related receptor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383863647|ref|XP_003707291.1| PREDICTED: steroid hormone receptor ERR2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|170053275|ref|XP_001862599.1| estrogen-related receptor [Culex quinquefasciatus] gi|167873854|gb|EDS37237.1| estrogen-related receptor [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0035849 496 ERR "estrogen-related receptor 0.455 0.112 0.928 2.2e-28
UNIPROTKB|F1MBX3 422 ESRRA "Uncharacterized protein 0.471 0.137 0.827 6e-25
UNIPROTKB|Q6QMY5 422 ESRRA "Steroid hormone recepto 0.471 0.137 0.827 6e-25
UNIPROTKB|F1RQP2 422 ESRRA "Uncharacterized protein 0.471 0.137 0.827 6e-25
MGI|MGI:1346831 422 Esrra "estrogen related recept 0.471 0.137 0.827 6e-25
RGD|1583866 422 Esrra "estrogen related recept 0.471 0.137 0.827 6e-25
UNIPROTKB|P11474 423 ESRRA "Steroid hormone recepto 0.471 0.137 0.827 6.2e-25
ZFIN|ZDB-GENE-990415-68 436 esrra "estrogen-related recept 0.674 0.190 0.635 1e-23
UNIPROTKB|F1PFF7 613 ESRRA "Steroid hormone recepto 0.471 0.094 0.827 1.1e-23
UNIPROTKB|F1NBB9 438 ESRRB "Uncharacterized protein 0.569 0.159 0.693 1.4e-22
FB|FBgn0035849 ERR "estrogen-related receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 288 (106.4 bits), Expect = 2.2e-28, Sum P(3) = 2.2e-28
 Identities = 52/56 (92%), Positives = 54/56 (96%)

Query:     1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNP 56
             NIEYTCPA+N+CEINKRRRKACQACRFQKCL  GMLKEGVRLDRVRGGRQKYRRNP
Sbjct:   158 NIEYTCPANNECEINKRRRKACQACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNP 213


GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS;NAS
GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005496 "steroid binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IDA
UNIPROTKB|F1MBX3 ESRRA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QMY5 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQP2 ESRRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1346831 Esrra "estrogen related receptor, alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1583866 Esrra "estrogen related receptor, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P11474 ESRRA "Steroid hormone receptor ERR1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-68 esrra "estrogen-related receptor alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFF7 ESRRA "Steroid hormone receptor ERR1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBB9 ESRRB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P11474ERR1_HUMANNo assigned EC number0.82750.47150.1371yesN/A
Q6QMY5ERR1_CANFANo assigned EC number0.76560.52030.1516yesN/A
Q19345NHR25_CAEELNo assigned EC number0.520.40650.0874yesN/A
O08580ERR1_MOUSENo assigned EC number0.82750.47150.1374yesN/A
Q5QJV7ERR1_RATNo assigned EC number0.82750.47150.1374yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
cd0717097 cd07170, NR_DBD_ERR, DNA-binding domain of estroge 1e-33
cd0715575 cd07155, NR_DBD_ER_like, DNA-binding domain of est 1e-18
cd0716793 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain 4e-18
cd0691672 cd06916, NR_DBD_like, DNA-binding domain of nuclea 2e-17
pfam0010570 pfam00105, zf-C4, Zinc finger, C4 type (two domain 1e-14
cd0716890 cd07168, NR_DBD_DHR4_like, DNA-binding domain of e 1e-14
cd0696185 cd06961, NR_DBD_TR, DNA-binding domain of thyroid 2e-14
cd0717182 cd07171, NR_DBD_ER, DNA-binding domain of estrogen 5e-13
cd0696975 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the 4e-12
smart0039970 smart00399, ZnF_C4, c4 zinc finger in nuclear horm 8e-12
cd0696076 cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto 3e-11
cd0715672 cd07156, NR_DBD_VDR_like, The DNA-binding domain o 8e-11
cd0716990 cd07169, NR_DBD_GCNF_like, DNA-binding domain of G 2e-10
cd0717974 cd07179, 2DBD_NR_DBD2, The second DNA-binding doma 3e-10
cd0715786 cd07157, 2DBD_NR_DBD1, The first DNA-binding domai 2e-09
cd0696485 cd06964, NR_DBD_RAR, DNA-binding domain of retinoi 2e-09
cd0695677 cd06956, NR_DBD_RXR, DNA-binding domain of retinoi 2e-09
cd0696787 cd06967, NR_DBD_TR2_like, DNA-binding domain of th 3e-09
cd0716478 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of 9e-09
cd0696694 cd06966, NR_DBD_CAR, DNA-binding domain of constit 2e-08
cd0716287 cd07162, NR_DBD_PXR, DNA-binding domain of pregnan 7e-08
cd0716581 cd07165, NR_DBD_DmE78_like, DNA-binding domain of 1e-07
cd0717278 cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco 2e-07
cd0696895 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi 2e-07
cd06955107 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin 4e-07
cd0695873 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi 6e-07
cd0696373 cd06963, NR_DBD_GR_like, The DNA binding domain of 8e-07
cd0715473 cd07154, NR_DBD_PNR_like, The DNA-binding domain o 9e-07
cd0696584 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi 2e-06
cd0715873 cd07158, NR_DBD_Ppar_like, The DNA-binding domain 3e-06
cd0716689 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV 8e-06
cd0717382 cd07173, NR_DBD_AR, DNA-binding domain of androgen 1e-05
cd0695782 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of 2e-05
cd0716392 cd07163, NR_DBD_TLX, DNA-binding domain of Tailles 4e-05
cd0697092 cd06970, NR_DBD_PNR, DNA-binding domain of the pho 6e-05
cd0716191 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson 1e-04
cd0696284 cd06962, NR_DBD_FXR, DNA-binding domain of Farneso 0.001
cd0695973 cd06959, NR_DBD_EcR_like, The DNA-binding domain o 0.004
>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
 Score =  112 bits (281), Expect = 1e-33
 Identities = 46/58 (79%), Positives = 52/58 (89%)

Query: 1  NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL 58
          NIEY+CPA+N+CEI KRRRK+CQACRF KCL+ GMLKEGVRLDRVRGGRQKY+R  D 
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDA 95


DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 97

>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) Back     alignment and domain information
>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG4215|consensus 432 99.6
KOG4217|consensus 605 99.6
cd0717097 NR_DBD_ERR DNA-binding domain of estrogen related 99.48
cd0696185 NR_DBD_TR DNA-binding domain of thyroid hormone re 99.48
cd0716990 NR_DBD_GCNF_like DNA-binding domain of Germ cell n 99.45
cd0716793 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 99.44
cd0716890 NR_DBD_DHR4_like DNA-binding domain of ecdysone-in 99.42
cd0696485 NR_DBD_RAR DNA-binding domain of retinoic acid rec 99.4
KOG4846|consensus 538 99.39
cd0716581 NR_DBD_DmE78_like DNA-binding domain of Drosophila 99.38
cd0716478 NR_DBD_PNR_like_1 DNA-binding domain of the photor 99.38
cd0696787 NR_DBD_TR2_like DNA-binding domain of the TR2 and 99.38
cd0715575 NR_DBD_ER_like DNA-binding domain of estrogen rece 99.38
cd0695677 NR_DBD_RXR DNA-binding domain of retinoid X recept 99.38
cd0695782 NR_DBD_PNR_like_2 DNA-binding domain of the photor 99.37
cd0716689 NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep 99.37
cd0696076 NR_DBD_HNF4A DNA-binding domain of heptocyte nucle 99.36
cd07160101 NR_DBD_LXR DNA-binding domain of Liver X receptors 99.35
cd0696694 NR_DBD_CAR DNA-binding domain of constitutive andr 99.34
cd0716191 NR_DBD_EcR DNA-binding domain of Ecdysone receptor 99.33
cd0696284 NR_DBD_FXR DNA-binding domain of Farnesoid X recep 99.33
cd0717182 NR_DBD_ER DNA-binding domain of estrogen receptors 99.33
cd0716392 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is 99.32
cd0696895 NR_DBD_ROR DNA-binding domain of Retinoid-related 99.32
cd0697092 NR_DBD_PNR DNA-binding domain of the photoreceptor 99.31
KOG4218|consensus 475 99.28
cd0716287 NR_DBD_PXR DNA-binding domain of pregnane X recept 99.27
KOG4216|consensus 479 99.27
cd0715786 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of 99.26
cd0696975 NR_DBD_NGFI-B DNA-binding domain of the orphan nuc 99.25
cd06955107 NR_DBD_VDR DNA-binding domain of vitamin D recepto 99.25
cd0717974 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o 99.25
cd0695873 NR_DBD_COUP_TF DNA-binding domain of chicken ovalb 99.23
cd0691672 NR_DBD_like DNA-binding domain of nuclear receptor 99.23
cd0715873 NR_DBD_Ppar_like The DNA-binding domain of peroxis 99.22
cd0715672 NR_DBD_VDR_like The DNA-binding domain of vitamin 99.22
cd0696584 NR_DBD_Ppar DNA-binding domain of peroxisome proli 99.21
cd0695973 NR_DBD_EcR_like The DNA-binding domain of Ecdysone 99.21
cd0715473 NR_DBD_PNR_like The DNA-binding domain of the phot 99.21
cd0696373 NR_DBD_GR_like The DNA binding domain of GR_like n 99.2
cd0717278 NR_DBD_GR_PR DNA-binding domain of glucocorticoid 99.14
cd0717382 NR_DBD_AR DNA-binding domain of androgen receptor 99.12
smart0039970 ZnF_C4 c4 zinc finger in nuclear hormone receptors 99.03
PF0010570 zf-C4: Zinc finger, C4 type (two domains); InterPr 98.92
>KOG4215|consensus Back     alignment and domain information
Probab=99.60  E-value=2.5e-16  Score=125.64  Aligned_cols=52  Identities=42%  Similarity=0.896  Sum_probs=47.8

Q ss_pred             CCceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccc
Q psy752            1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKY   52 (123)
Q Consensus         1 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~   52 (123)
                      +..|+|+++.+|.|||..|+.||||||+||+.+||.++|||++|++.+..+.
T Consensus        53 ~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERDrIg~Rr~  104 (432)
T KOG4215|consen   53 NHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERDRIGSRRP  104 (432)
T ss_pred             cceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccccccccCC
Confidence            3579999999999999999999999999999999999999999998877443



>KOG4217|consensus Back     alignment and domain information
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1lo1_A98 Estrogen Related Receptor 2 Dna Binding Domain In C 1e-21
2ff0_A102 Solution Structure Of Steroidogenic Factor 1 Dna Bi 1e-10
2a66_A113 Human Liver Receptor Homologue Dna-Binding Domain ( 4e-10
1hcq_A84 The Crystal Structure Of The Estrogen Receptor Dna- 4e-10
1cit_A89 Dna-Binding Mechanism Of The Monomeric Orphan Nucle 3e-09
3dzu_A 467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 3e-08
1hcp_A76 Dna Recognition By The Oestrogen Receptor: From Sol 9e-08
1ynw_B99 Crystal Structure Of Vitamin D Receptor And 9-Cis R 1e-07
1dsz_B85 Structure Of The RxrRAR DNA-Binding Domain Heterodi 2e-07
4aa6_A71 The Oestrogen Receptor Recognizes An Imperfectly Pa 3e-07
4aa6_E71 The Oestrogen Receptor Recognizes An Imperfectly Pa 3e-07
1by4_A82 Structure And Mechanism Of The Homodimeric Assembly 2e-06
1ynw_A110 Crystal Structure Of Vitamin D Receptor And 9-Cis R 2e-06
1rxr_A83 High Resolution Solution Structure Of The Retinoid 2e-06
1dsz_A86 Structure Of The RxrRAR DNA-Binding Domain Heterodi 2e-06
1r0n_A81 Crystal Structure Of Heterodimeric Ecdsyone Recepto 4e-06
1kb2_A110 Crystal Structure Of Vdr Dna-Binding Domain Bound T 5e-06
2ebl_A89 Solution Structure Of The Zinc Finger, C4-type Doma 2e-05
1hra_A80 The Solution Structure Of The Human Retinoic Acid R 2e-05
3dzu_D 419 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 3e-05
2han_A93 Structural Basis Of Heterodimeric Ecdysteroid Recep 3e-05
1r0o_A86 Crystal Structure Of The Heterodimeric Ecdysone Rec 3e-05
4hn5_A117 Gr Dna Binding Domain - Tslp Ngre Complex Length = 4e-05
2nll_A66 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 6e-05
3g9p_B90 Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 6e-05
3g6t_A91 Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L 7e-05
1gdc_A72 Refined Solution Structure Of The Glucocorticoid Re 7e-05
2gda_A72 Refined Solution Structure Of The Glucocorticoid Re 7e-05
1r4o_A92 Crystallographic Analysis Of The Interaction Of The 7e-05
1r4r_B92 Crystallographic Analysis Of The Interaction Of The 8e-05
1rgd_A71 Structure Refinement Of The Glucocorticoid Receptor 8e-05
1glu_A81 Crystallographic Analysis Of The Interaction Of The 9e-05
4hn6_A114 Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl 3e-04
1hlz_A94 Crystal Structure Of The Orphan Nuclear Receptor Re 3e-04
3cbb_A78 Crystal Structure Of Hepatocyte Nuclear Factor 4alp 4e-04
2c7a_A78 Structure Of The Progesterone Receptor-Dna Complex 4e-04
1r4i_A105 Crystal Structure Of Androgen Receptor Dna-Binding 6e-04
>pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 Back     alignment and structure

Iteration: 1

Score = 98.2 bits (243), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 45/57 (78%), Positives = 51/57 (89%) Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 57 NIEY+CPA+N+CEI KRRRK+CQACRF K L+ GMLKEGVRLDRVRGGRQKY+R D Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94
>pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 Back     alignment and structure
>pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 Back     alignment and structure
>pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 Back     alignment and structure
>pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 Back     alignment and structure
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure
>pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 Back     alignment and structure
>pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 Back     alignment and structure
>pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 Back     alignment and structure
>pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 Back     alignment and structure
>pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 Back     alignment and structure
>pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 Back     alignment and structure
>pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 Back     alignment and structure
>pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 Back     alignment and structure
>pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 Back     alignment and structure
>pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 Back     alignment and structure
>pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 Back     alignment and structure
>pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 Back     alignment and structure
>pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 Back     alignment and structure
>pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 Back     alignment and structure
>pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 Back     alignment and structure
>pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 Back     alignment and structure
>pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 Back     alignment and structure
>pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 Back     alignment and structure
>pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 Back     alignment and structure
>pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 Back     alignment and structure
>pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 Back     alignment and structure
>pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 Back     alignment and structure
>pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 Back     alignment and structure
>pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 Back     alignment and structure
>pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 1e-24
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 2e-23
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 3e-23
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 2e-21
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 7e-21
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 4e-20
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 1e-19
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 1e-19
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 1e-19
2han_A93 Protein ultraspiracle; transcription regulation, t 2e-19
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 4e-19
2han_B119 Ecdysone receptor; transcription regulation, trans 2e-17
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 1e-16
2nll_B103 Protein (thyroid hormone receptor); complex (trans 2e-16
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 2e-16
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 4e-16
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 9e-16
3dzy_D 419 Peroxisome proliferator-activated receptor gamma; 3e-15
1z5x_E 310 Ecdysone receptor ligand binding domain; ponastero 3e-07
1ovl_A 271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 4e-07
1lbd_A 282 RXR_LBD, retinoid X receptor; transcription factor 5e-06
2hc4_A 302 Vitamin D receptor; alpha helical sandwich, gene r 5e-05
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 Back     alignment and structure
 Score = 89.0 bits (221), Expect = 1e-24
 Identities = 45/57 (78%), Positives = 51/57 (89%)

Query: 1  NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD 57
          NIEY+CPA+N+CEI KRRRK+CQACRF K L+ GMLKEGVRLDRVRGGRQKY+R  D
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLD 94


>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure
>1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 Back     alignment and structure
>2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 99.57
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 99.53
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 99.52
2han_A93 Protein ultraspiracle; transcription regulation, t 99.52
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 99.51
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 99.51
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 99.49
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 99.49
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 99.48
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 99.46
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 99.44
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 99.44
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 99.43
4hn5_A117 Glucocorticoid receptor; glucocorticoid receptor, 99.41
2han_B119 Ecdysone receptor; transcription regulation, trans 99.39
2nll_B103 Protein (thyroid hormone receptor); complex (trans 99.36
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 99.33
2lze_A87 A primordial catalytic fold generated by in vitro 99.31
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 99.3
3dzy_D 419 Peroxisome proliferator-activated receptor gamma; 99.13
1lbd_A 282 RXR_LBD, retinoid X receptor; transcription factor 97.61
1ovl_A 271 Orphan nuclear receptor NURR1 (MSe 414, 496, 511); 94.63
1xdk_B 303 RAR-beta, retinoic acid receptor, beta; nuclear re 89.87
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
Probab=99.57  E-value=3.3e-16  Score=104.28  Aligned_cols=56  Identities=79%  Similarity=1.389  Sum_probs=49.6

Q ss_pred             CCceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccccCCC
Q psy752            1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNP   56 (123)
Q Consensus         1 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~~~~~   56 (123)
                      +..|.|..+++|.|++..|..|++|||+|||++||++++||.+|+++++++.++..
T Consensus        38 ~~~y~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~R~~~~r~k~~~~~   93 (98)
T 1lo1_A           38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRL   93 (98)
T ss_dssp             TCCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSCCTTCCCCCC---
T ss_pred             cCccccCccccccccccccccccchhHHHHhHcCCCHHHeecccccCcccccCCCC
Confidence            35789999999999999999999999999999999999999999999988876653



>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Back     alignment and structure
>4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Back     alignment and structure
>1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Back     alignment and structure
>1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1lo1a_90 g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi 4e-14
d1cita_89 g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b 9e-13
d1dszb_84 g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- 4e-11
d1kb2a_89 g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin 2e-10
d2hanb183 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do 2e-10
d1a6ya_78 g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b 5e-10
d1dsza_75 g.39.1.2 (A:) Retinoic acid receptor DNA-binding d 1e-08
d1r4ia_74 g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve 4e-08
d1lata_71 g.39.1.2 (A:) Glucocorticoid receptor DNA-binding 4e-07
d2nllb_103 g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D 5e-07
d1hcqa_74 g.39.1.2 (A:) Estrogen receptor DNA-binding domain 6e-07
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Steroid hormone receptor Err2 DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.8 bits (147), Expect = 4e-14
 Identities = 43/53 (81%), Positives = 49/53 (92%)

Query: 1  NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYR 53
          NIEY+CPA+N+CEI KRRRK+CQACRF K L+ GMLKEGVRLDRVRGGRQKY+
Sbjct: 38 NIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK 90


>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1lo1a_90 Steroid hormone receptor Err2 DNA-binding domain { 99.51
d2hanb183 Ecdysone receptor DNA-binding domain {Fruit fly (D 99.42
d1cita_89 Orphan nuclear receptor NGFI-B DNA-binding domain 99.42
d1dszb_84 Retinoid X receptor (RXR-alpha) DNA-binding domain 99.41
d1kb2a_89 Vitamin D3 receptor, VDR, DNA-binding domain {Huma 99.38
d1dsza_75 Retinoic acid receptor DNA-binding domain {Human ( 99.36
d1a6ya_78 Orphan nuclear receptor reverb DNA-binding domain 99.34
d2nllb_103 Thyroid hormone receptor (TR-beta) DNA-binding dom 99.27
d1r4ia_74 Androgen receptor {Rat (Rattus norvegicus) [TaxId: 99.19
d1lata_71 Glucocorticoid receptor DNA-binding domain {Rat (R 99.11
d1hcqa_74 Estrogen receptor DNA-binding domain {Human and ch 99.07
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Steroid hormone receptor Err2 DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51  E-value=8.8e-16  Score=99.22  Aligned_cols=51  Identities=82%  Similarity=1.465  Sum_probs=47.1

Q ss_pred             CceecCCCCCcccccccccccccccchhhhhccccccccccccccCccccc
Q psy752            2 IEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKY   52 (123)
Q Consensus         2 ~~y~C~~~~~C~i~~~~r~~C~~CR~~kCl~~GM~~~~V~~~r~~~~~~~~   52 (123)
                      ..|.|..+++|.++...|..|++|||+|||++||++++||.+|++.+++++
T Consensus        39 ~~~~c~~~~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq~~r~~~~r~k~   89 (90)
T d1lo1a_          39 IEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKY   89 (90)
T ss_dssp             CCCCCSSCSCCCCCHHHHHHCHHHHHHHHHHHTCCGGGSCSSCCTTCCCCC
T ss_pred             CccchhcCCCCccCCCCccccchhhHHHHHHcCCCHHHhccccccccccCC
Confidence            468899999999999999999999999999999999999999998777765



>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Back     information, alignment and structure