Psyllid ID: psy7542


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MQMSSPWIPDIPSHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLKQNRRQKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
cccccccccccHHHHccccHHHHcccccccccccccccHHHcccccccccccHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHccHHHHHHHHHccccHHcccEEEEEcccccccccccHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcEEcccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccHHHHHHHHcccEEEEEEccccccccccccEEEEcHHHHHHHHccccccccccEEEccccccccccHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHccccccccccEEEEccHHHHHHHHHccHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHccccEEEEEEEEEEEEEEEEEEEcccccccccccccccEEEccccccccccccccccccHHHHHcccccEEEEEEccccEEEEcccccccccEEEEEEEEEEEEcccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccEEEEEEEEcccccccccccccccccccccEEEEcccccccccccccccEEEcccccccc
ccccccccHcHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccHHHHHHcccEEEEEccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHccHHHHHHHHHccHHHHHHEEEEcccccccccccccHHHHHHHHHHcEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccHEEEEcccccccHHHHHHHHHHccHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEccEEEccccccccccEcccccccEEEEEccccEEEEEEcccccEEcEccHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHHccccccEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHEEccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccEEEEcccccEEEEEcccHcHHHHHHHHHHHHHHHHHHHcccccEEEEcccccEEcccccccHHHHHHHHHcccHHEHHHHccccccEEcccccccccEEEEEEEEccccccccccccccccccHccccccccHHHHHHHHHHHHHHHHHccccHcEEEEEEEcccccccccccEEEEEEEEEEEEccccccccccccccccEccccEEEEcccccHcHHHcccccEEEcccHHHcc
mqmsspwipdipshlehlpdriasslkdkhifmtgasgfivkaipkkfkhlpdriSATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILlrpkknknsRERLEEIFQSPLYEALKKEQSESAIFekvipingdvavpdlgisaedRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVstaychpkekvleektypppvsphnvieKAELLSKNELELLKQELLQdfpngyaytkcLCEGVVTEYMEagmpcmilrpsiiipiwkdplpgwtdningptglliGAGKGIIRTmycdystcadflpvDVLVNGVLLSTWnflsnpgntmRVINLTANKDFQITWYDIIENGkdiarnkvplnnvlwypggamtnrgyepVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARqyllgeppetlpgakrhVRIMYYVHVITQVLLLGFFLWVlrhpgpkencisvsgyrliecekpYYVYVIHVRMFQQHYIVEKRYSELLSWHsegfglgildgkgkyayappysrtlkqNRRQKKRNCKYFIYQWLGlnnvlwypggamtntVNLYLYLDFgffqnktkfstpsfppkkirsnqpkvLDERRHLLEIYLKEMFKFGPSRNQVLAFLgvnsknsqpqpsislhhYHFVFrtktndyrtpvdssrpkriehlpvfivnpnidtlsqeygthdviVNGAMKAFY
mqmsspwipdipsHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTcenvkiyillrpkknknsrERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKvleektypppvsPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGkdiarnkvpLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPpysrtlkqnrrqKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTkfstpsfppkkirsnqpkvldERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNdyrtpvdssrpkriehlpvfIVNPNIDTLSQEYGTHDVIVNGAMKAFY
MQMSSPWIPDIPSHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIekaellsknelellkqellQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLkqnrrqkkrnCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
*********************IASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLR******************************AIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLE************VIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLK*****KKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTK********************ERRHLLEIYLKEMFKFGPSRNQVLAFLGVN*********ISLHHYHFVFRTKTNDYRT********RIEHLPVFIVNPNIDTLSQEYGTHDVIVNGA*****
****SPW**DI*****************************************DRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLKQNRRQKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSK*******ISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
MQMSSPWIPDIPSHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLKQNRRQKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
****SPWIPDIPSHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLKQNRRQKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMSSPWIPDIPSHLEHLPDRIASSLKDKHIFMTGASGFIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTNRGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQVLLLGFFLWVLRHPGPKENCISVSGYRLIECEKPYYVYVIHVRMFQQHYIVEKRYSELLSWHSEGFGLGILDGKGKYAYAPPYSRTLKQNRRQKKRNCKYFIYQWLGLNNVLWYPGGAMTNTVNLYLYLDFGFFQNKTKFSTPSFPPKKIRSNQPKVLDERRHLLEIYLKEMFKFGPSRNQVLAFLGVNSKNSQPQPSISLHHYHFVFRTKTNDYRTPVDSSRPKRIEHLPVFIVNPNIDTLSQEYGTHDVIVNGAMKAFY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query762 2.2.26 [Sep-21-2011]
A1ZAI5625 Putative fatty acyl-CoA r no N/A 0.576 0.702 0.347 2e-82
Q7ZXF5515 Fatty acyl-CoA reductase N/A N/A 0.581 0.860 0.365 9e-78
Q922J9515 Fatty acyl-CoA reductase yes N/A 0.582 0.862 0.361 5e-77
Q5R834515 Fatty acyl-CoA reductase yes N/A 0.582 0.862 0.357 5e-76
Q8WVX9515 Fatty acyl-CoA reductase yes N/A 0.582 0.862 0.357 5e-76
Q5ZM72515 Fatty acyl-CoA reductase yes N/A 0.580 0.858 0.362 6e-76
Q66H50515 Fatty acyl-CoA reductase yes N/A 0.581 0.860 0.350 8e-76
Q960W6516 Putative fatty acyl-CoA r no N/A 0.566 0.837 0.341 2e-73
Q7TNT2515 Fatty acyl-CoA reductase no N/A 0.583 0.864 0.321 1e-66
Q0P5J1515 Fatty acyl-CoA reductase no N/A 0.590 0.873 0.317 3e-65
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function desciption
 Score =  307 bits (786), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/481 (34%), Positives = 275/481 (57%), Gaps = 42/481 (8%)

Query: 62  KNIFITGASGFVGKVLLEKILRTCENVK-IYILLRPKKNKNSRERLEEIFQSPLYEALKK 120
           +++FITG +GF+GKVL+EK+LR+C  ++ IY+L+RPK+ +    RL E+  +PL+E+L++
Sbjct: 126 RSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNAPLFESLRQ 185

Query: 121 EQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLN 180
           E+ +     KVIPI+GD+   +LGIS +D+ +L   + +V+H AATV+FD+ ++  V +N
Sbjct: 186 EKPKE--LSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKLSVTIN 243

Query: 181 TRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNE 240
             GT+ ++ L  +M+ L   ++VSTAYC+     + E  Y PP +P ++I     L ++ 
Sbjct: 244 MLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINWLPEDI 303

Query: 241 LELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAG-MPCMILRPSIIIPIWKDPLPGWTDN 299
           L+ L   L+   PN Y +TK L E ++ +  EAG +P  I+RPSI+     +P  GW DN
Sbjct: 304 LDQLTPRLIGKRPNTYTFTKALAEHMLLK--EAGNLPVAIVRPSIVTASLNEPFAGWVDN 361

Query: 300 INGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLT 359
            NGPTGL+    KG+ RTM C+ +  AD +PVD+++N ++ + W   +   N + + N  
Sbjct: 362 FNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAWRTATRKSNNLLIYNCC 421

Query: 360 ANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAM-TNR------------------- 399
             +   I W + +++     R K PL   LWYP G +  NR                   
Sbjct: 422 TGQRNPIIWSEFVKHAMTSVR-KHPLEGCLWYPTGDLRMNRPMNTLNCIAKHFLPAYILD 480

Query: 400 ------GYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLHALRNMMNEKEAIRYEIAM 453
                 G +P +  V N+I K  +  EY+    W FK++N+HAL + ++ K+    EI +
Sbjct: 481 GVARIMGKKPFVVNVQNKIAKAVECLEYFATRQWRFKDDNVHALLHTLSPKD---REIFV 537

Query: 454 F--RDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYYVHVITQ---VLLLGFF 508
           F  R ++  K Y E  + G R++L  + PE+LP +++ +  +YY+H +T+   VLL   F
Sbjct: 538 FDVRHINWDK-YVERYVLGFREFLFKQRPESLPASRKRMLRLYYLHQLTKLVAVLLTWRF 596

Query: 509 L 509
           L
Sbjct: 597 L 597




Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: nEC: 2
>sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 Back     alignment and function description
>sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 Back     alignment and function description
>sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
328706792559 PREDICTED: putative fatty acyl-CoA reduc 0.612 0.835 0.492 1e-145
350423751517 PREDICTED: putative fatty acyl-CoA reduc 0.606 0.893 0.505 1e-144
340722988517 PREDICTED: putative fatty acyl-CoA reduc 0.606 0.893 0.505 1e-143
156551579517 PREDICTED: putative fatty acyl-CoA reduc 0.628 0.926 0.480 1e-140
66547347516 PREDICTED: putative fatty acyl-CoA reduc 0.635 0.937 0.471 1e-139
383858922517 PREDICTED: putative fatty acyl-CoA reduc 0.604 0.891 0.491 1e-139
298569765516 putative fatty acyl-CoA reductase [Apis 0.635 0.937 0.470 1e-138
298402913525 fatty-acyl CoA reductase 3 [Ostrinia nub 0.602 0.874 0.482 1e-135
307211548517 Fatty acyl-CoA reductase 1 [Harpegnathos 0.587 0.866 0.494 1e-135
332021355544 Putative fatty acyl-CoA reductase [Acrom 0.598 0.838 0.483 1e-134
>gi|328706792|ref|XP_001949683.2| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 245/497 (49%), Positives = 344/497 (69%), Gaps = 30/497 (6%)

Query: 43  AIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCENV-KIYILLRPKKNKN 101
            +P +  HLPDR+S T   K IFITG SGF+GKVL+EK+LR C ++ +IY+LLR KK  N
Sbjct: 23  VLPDELSHLPDRVSKTFVGKTIFITGGSGFLGKVLIEKLLRKCPDIERIYLLLRTKKGSN 82

Query: 102 SRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVY 161
            ++R+E IF S L++ LK E     +  KV PI GDV+ P+L I+  DR++L++T+ IVY
Sbjct: 83  PKQRVETIFSSVLFDYLK-ELRGVEVLNKVYPIAGDVSEPNLAINESDRRLLADTVQIVY 141

Query: 162 HIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYP 221
           H AAT+RFD+ ++  V LNTRGT+ +L L+K+M +LQ+FVYVST+YCH +EKVL EK YP
Sbjct: 142 HAAATIRFDEALKKAVLLNTRGTKMVLELAKEMKNLQVFVYVSTSYCHLEEKVLFEKAYP 201

Query: 222 PPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILR 281
           PP  PH +I+  E+L +  +E + +E+L  FPN YA+TKCL E +V E +EAG+PC+I R
Sbjct: 202 PPADPHKIIQSMEMLDEPFVETISKEILGSFPNSYAFTKCLSEHLVVEQIEAGLPCIIAR 261

Query: 282 PSIIIPIWKDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLS 341
           PSI+IPIWK+PLPGWTDNINGPTGLLIGAGKG+IRTM+C     AD+LPVD+ VNG++L 
Sbjct: 262 PSIVIPIWKEPLPGWTDNINGPTGLLIGAGKGVIRTMFCHNQGYADYLPVDITVNGIILF 321

Query: 342 TWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAMTN--- 398
           TWN++ N   T  + +LT+++++++TW +II+ GK I   +VPLN  +WYPGG+M +   
Sbjct: 322 TWNYIGNNDTTRTICHLTSSQEWRVTWQEIIDIGKSIVTTEVPLNGAVWYPGGSMKSSKL 381

Query: 399 -----------------------RGYEPVLKRVHNRIKKGFDIFEYYTKNSWSFKNENLH 435
                                   G +P L R+ +RI KGF++FEYY  N W F+NE++H
Sbjct: 382 VHNICVFFLHTIPAYFLDAVIYLSGNKPCLVRIQDRINKGFEVFEYYANNQWEFRNEHVH 441

Query: 436 ALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRIMYY 495
            +R +MN++E   Y++    D+D  + YF  CI  AR Y+L E P+TLP A+ H++IMYY
Sbjct: 442 YMRRIMNQREKFEYKVDG-NDMD-IRNYFRDCIMAARIYILKETPDTLPRARIHMKIMYY 499

Query: 496 VHVITQVLLLGFFLWVL 512
           V +I ++L     LW +
Sbjct: 500 VDIIAKILFFSLLLWTI 516




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350423751|ref|XP_003493580.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722988|ref|XP_003399881.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|156551579|ref|XP_001601970.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|66547347|ref|XP_624493.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383858922|ref|XP_003704948.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|298569765|gb|ADI87411.1| putative fatty acyl-CoA reductase [Apis mellifera] Back     alignment and taxonomy information
>gi|298402913|gb|ADI82776.1| fatty-acyl CoA reductase 3 [Ostrinia nubilalis] Back     alignment and taxonomy information
>gi|307211548|gb|EFN87626.1| Fatty acyl-CoA reductase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332021355|gb|EGI61729.1| Putative fatty acyl-CoA reductase [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
FB|FBgn0033464517 CG1441 [Drosophila melanogaste 0.450 0.663 0.511 1.5e-120
FB|FBgn0043792506 CG30427 [Drosophila melanogast 0.437 0.658 0.397 3.6e-82
FB|FBgn0034145625 CG5065 [Drosophila melanogaste 0.437 0.532 0.363 4e-81
FB|FBgn0039131531 CG12268 [Drosophila melanogast 0.442 0.634 0.376 2.4e-79
ZFIN|ZDB-GENE-060503-367515 si:dkey-97m3.1 "si:dkey-97m3.1 0.446 0.660 0.373 3.9e-77
FB|FBgn0029821494 CG4020 [Drosophila melanogaste 0.442 0.682 0.405 1.1e-76
FB|FBgn0039620517 CG1443 [Drosophila melanogaste 0.429 0.632 0.332 7.9e-75
RGD|1306647515 Far1 "fatty acyl CoA reductase 0.430 0.636 0.397 2.9e-74
UNIPROTKB|Q66H50515 Far1 "Fatty acyl-CoA reductase 0.430 0.636 0.397 2.9e-74
UNIPROTKB|E2R4R9514 FAR1 "Uncharacterized protein" 0.433 0.642 0.402 3.7e-74
FB|FBgn0033464 CG1441 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 938 (335.3 bits), Expect = 1.5e-120, Sum P(3) = 1.5e-120
 Identities = 177/346 (51%), Positives = 240/346 (69%)

Query:    53 DRISATLEHKNIFITGASGFVGKVLLEKILRTCENVK-IYILLRPKKNKNSRERLEEIFQ 111
             DRI+   + +++FITG +GF+GKVL+EK+LR+C  +K IY+L+RPKK K+ +ER+++IFQ
Sbjct:    26 DRIAECFKGRSLFITGGTGFLGKVLVEKLLRSCGGLKRIYLLIRPKKGKDPQERIKDIFQ 85

Query:   112 SPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDD 171
             + L++ +K+ + E  I ++V+ I GDV  P LGIS +D + L + + IVYH AATVRFD+
Sbjct:    86 NVLFDQVKQMRGEEHILQQVVAIAGDVLSPGLGISEKDLETLRQEVSIVYHCAATVRFDE 145

Query:   172 YMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIX 231
              ++  VF+NTRGT+ ML L+  + HL  F Y STAYCH   K L EK Y PP  PH V+ 
Sbjct:   146 PLRNAVFMNTRGTKYMLELALTLKHLDFFAYCSTAYCHLHVKTLYEKPYDPPADPHKVMQ 205

Query:   232 XXXXXXXXXXXXXXXXXXQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKD 291
                                  PN YAYTK L E +V E  E  +P +ILRPSI+IPIWK+
Sbjct:   206 ACEWLTDDEVATIERKVLGAIPNTYAYTKSLAEALVVEKFEE-LPAVILRPSIVIPIWKE 264

Query:   292 PLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTW-NFLSNPG 350
             P+PGWTDNINGPTGLLIGAGKG+IRTMYC+ S   DFLPVDV VNG+L+++W N  +   
Sbjct:   265 PIPGWTDNINGPTGLLIGAGKGVIRTMYCNSSGYGDFLPVDVAVNGILVASWRNITAGTD 324

Query:   351 NTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNVLWYPGGAM 396
              T RV ++T++ D +++W +IIE G+ +  NKVPLN V WYPGG+M
Sbjct:   325 KTNRVAHMTSSNDIKVSWAEIIELGRWVIENKVPLNGVAWYPGGSM 370


GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0043792 CG30427 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034145 CG5065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039131 CG12268 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-367 si:dkey-97m3.1 "si:dkey-97m3.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0029821 CG4020 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039620 CG1443 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1306647 Far1 "fatty acyl CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66H50 Far1 "Fatty acyl-CoA reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4R9 FAR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.n2LOW CONFIDENCE prediction!
3rd Layer1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 1e-109
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 4e-81
PLN02996491 PLN02996, PLN02996, fatty acyl-CoA reductase 1e-47
PLN02503605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 9e-35
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 3e-33
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 1e-25
TIGR01746367 TIGR01746, Thioester-redct, thioester reductase do 1e-24
COG3320382 COG3320, COG3320, Putative dehydrogenase domain of 7e-22
cd0907192 cd09071, FAR_C, C-terminal domain of fatty acyl Co 2e-17
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 2e-15
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-13
cd06880110 cd06880, PX_SNX22, The phosphoinositide binding Ph 1e-12
pfam0301594 pfam03015, Sterile, Male sterility protein 8e-11
cd08946200 cd08946, SDR_e, extended (e) SDRs 9e-10
TIGR034431389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 1e-09
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 3e-08
cd06880110 cd06880, PX_SNX22, The phosphoinositide binding Ph 2e-05
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 4e-05
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 2e-04
PLN02260668 PLN02260, PLN02260, probable rhamnose biosynthetic 3e-04
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 3e-04
cd06885104 cd06885, PX_SNX17_31, The phosphoinositide binding 4e-04
cd06093106 cd06093, PX_domain, The Phox Homology domain, a ph 0.002
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 0.003
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 0.004
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 0.004
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
 Score =  334 bits (859), Expect = e-109
 Identities = 126/322 (39%), Positives = 191/322 (59%), Gaps = 4/322 (1%)

Query: 62  KNIFITGASGFVGKVLLEKILRTCENV-KIYILLRPKKNKNSRERLEEIFQSPLYEALKK 120
           K++ ITGA+GF+GKVLLEK+LR+C ++ KIY+L+R K  +++ ERL E+ +  L++  + 
Sbjct: 1   KSVLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELLKDKLFDRGRN 60

Query: 121 EQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLN 180
                    K++PI GD++ P+LG+S ED Q L E ++I+ H AATV FD+ +   + +N
Sbjct: 61  LNPLF--ESKIVPIEGDLSEPNLGLSDEDLQTLIEEVNIIIHCAATVTFDERLDEALSIN 118

Query: 181 TRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNE 240
             GT  +L L+K+   L+ FV+VSTAY +   +++EEK YPPP  P  +I+  EL+   E
Sbjct: 119 VLGTLRLLELAKRCKKLKAFVHVSTAYVNGDRQLIEEKVYPPPADPEKLIDILELMDDLE 178

Query: 241 LELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIWKDPLPGWTDNI 300
           LE    +LL   PN Y +TK L E +V +     +P +I+RPSI+    K+P PGW DN 
Sbjct: 179 LERATPKLLGGHPNTYTFTKALAERLVLKERG-NLPLVIVRPSIVGATLKEPFPGWIDNF 237

Query: 301 NGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTA 360
           NGP GL +  GKGI+RTM  D +  AD +PVDV+ N +L +           + V +  +
Sbjct: 238 NGPDGLFLAYGKGILRTMNADPNAVADIIPVDVVANALLAAAAYSGVRKPRELEVYHCGS 297

Query: 361 NKDFQITWYDIIENGKDIARNK 382
           +     TW +  E      +  
Sbjct: 298 SDVNPFTWGEAEELINQYLKKN 319


SDRs are Rossmann-fold NAD(P)H-binding proteins, many of which may function as fatty acyl CoA reductases (FAR), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. This N-terminal domain shares the catalytic triad (but not the upstream Asn) and characteristic NADP-binding motif of the extended SDR family. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 320

>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|176924 cd09071, FAR_C, C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|132790 cd06880, PX_SNX22, The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 Back     alignment and domain information
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|132790 cd06880, PX_SNX22, The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|132795 cd06885, PX_SNX17_31, The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 Back     alignment and domain information
>gnl|CDD|132768 cd06093, PX_domain, The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 762
KOG1221|consensus467 100.0
PLN02503605 fatty acyl-CoA reductase 2 100.0
PLN02996491 fatty acyl-CoA reductase 100.0
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
COG3320382 Putative dehydrogenase domain of multifunctional n 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.98
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.97
PLN02427386 UDP-apiose/xylose synthase 99.97
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.97
PLN02260668 probable rhamnose biosynthetic enzyme 99.97
PLN02166436 dTDP-glucose 4,6-dehydratase 99.97
PLN02572442 UDP-sulfoquinovose synthase 99.97
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.97
PLN02206442 UDP-glucuronate decarboxylase 99.97
PRK07201657 short chain dehydrogenase; Provisional 99.97
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.97
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN00198338 anthocyanidin reductase; Provisional 99.97
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.97
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.97
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.97
KOG1502|consensus327 99.96
PLN02240352 UDP-glucose 4-epimerase 99.96
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.96
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.96
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.96
PLN02214342 cinnamoyl-CoA reductase 99.96
KOG0747|consensus331 99.96
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.96
PLN02650351 dihydroflavonol-4-reductase 99.96
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.96
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.96
PLN02653340 GDP-mannose 4,6-dehydratase 99.96
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.95
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.95
KOG1429|consensus350 99.95
PLN02896353 cinnamyl-alcohol dehydrogenase 99.95
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.95
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.95
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.94
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.94
KOG1430|consensus361 99.94
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.94
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.94
PLN02686367 cinnamoyl-CoA reductase 99.94
KOG1371|consensus343 99.94
CHL00194317 ycf39 Ycf39; Provisional 99.93
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.93
PLN02583297 cinnamoyl-CoA reductase 99.93
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.93
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.91
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.91
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.91
PLN00016378 RNA-binding protein; Provisional 99.91
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.9
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.9
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.89
PLN02778298 3,5-epimerase/4-reductase 99.89
PRK05865 854 hypothetical protein; Provisional 99.88
PRK12320 699 hypothetical protein; Provisional 99.83
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.8
PLN02260668 probable rhamnose biosynthetic enzyme 99.79
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.79
PRK06482276 short chain dehydrogenase; Provisional 99.79
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.79
cd06880110 PX_SNX22 The phosphoinositide binding Phox Homolog 99.78
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.78
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.77
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.75
PRK09135249 pteridine reductase; Provisional 99.75
KOG1431|consensus315 99.74
KOG2865|consensus391 99.74
PRK08263275 short chain dehydrogenase; Provisional 99.73
PLN03209576 translocon at the inner envelope of chloroplast su 99.73
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.72
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
PRK06914280 short chain dehydrogenase; Provisional 99.72
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.72
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.72
PRK05875276 short chain dehydrogenase; Provisional 99.7
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.7
PRK07806248 short chain dehydrogenase; Provisional 99.7
PRK07067257 sorbitol dehydrogenase; Provisional 99.69
PRK12746254 short chain dehydrogenase; Provisional 99.69
PRK07774250 short chain dehydrogenase; Provisional 99.68
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.68
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
PRK05876275 short chain dehydrogenase; Provisional 99.68
PRK06180277 short chain dehydrogenase; Provisional 99.67
PRK06128300 oxidoreductase; Provisional 99.67
PRK07775274 short chain dehydrogenase; Provisional 99.67
PRK07074257 short chain dehydrogenase; Provisional 99.67
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.66
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK12829264 short chain dehydrogenase; Provisional 99.66
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.66
PRK06138252 short chain dehydrogenase; Provisional 99.66
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.65
PF0301594 Sterile: Male sterility protein; InterPro: IPR0042 99.65
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.65
PRK06194287 hypothetical protein; Provisional 99.65
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.65
PRK12827249 short chain dehydrogenase; Provisional 99.64
PRK12828239 short chain dehydrogenase; Provisional 99.64
PRK08628258 short chain dehydrogenase; Provisional 99.63
PRK09186256 flagellin modification protein A; Provisional 99.63
PRK06182273 short chain dehydrogenase; Validated 99.63
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
cd06875116 PX_IRAS The phosphoinositide binding Phox Homology 99.63
PRK07060245 short chain dehydrogenase; Provisional 99.62
PRK07890258 short chain dehydrogenase; Provisional 99.62
PRK06179270 short chain dehydrogenase; Provisional 99.62
cd06870109 PX_CISK The phosphoinositide binding Phox Homology 99.62
cd07276110 PX_SNX16 The phosphoinositide binding Phox Homolog 99.61
PLN02253280 xanthoxin dehydrogenase 99.61
PRK06181263 short chain dehydrogenase; Provisional 99.61
PRK08219227 short chain dehydrogenase; Provisional 99.61
PRK05717255 oxidoreductase; Validated 99.61
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.61
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
KOG1372|consensus376 99.61
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.61
PRK12939250 short chain dehydrogenase; Provisional 99.61
PRK09134258 short chain dehydrogenase; Provisional 99.6
PRK06701290 short chain dehydrogenase; Provisional 99.6
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.59
PRK06123248 short chain dehydrogenase; Provisional 99.59
cd06877119 PX_SNX14 The phosphoinositide binding Phox Homolog 99.59
PRK07985294 oxidoreductase; Provisional 99.59
PRK08264238 short chain dehydrogenase; Validated 99.59
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.58
PRK07326237 short chain dehydrogenase; Provisional 99.58
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.58
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.58
cd06872107 PX_SNX19_like_plant The phosphoinositide binding P 99.58
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.58
PRK12937245 short chain dehydrogenase; Provisional 99.57
PRK06841255 short chain dehydrogenase; Provisional 99.57
PRK06500249 short chain dehydrogenase; Provisional 99.57
PRK07814263 short chain dehydrogenase; Provisional 99.57
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.57
PRK06196315 oxidoreductase; Provisional 99.56
PRK07024257 short chain dehydrogenase; Provisional 99.56
cd06897108 PX_SNARE The phosphoinositide binding Phox Homolog 99.56
PRK10538248 malonic semialdehyde reductase; Provisional 99.56
PRK09291257 short chain dehydrogenase; Provisional 99.56
PRK08324681 short chain dehydrogenase; Validated 99.56
PRK06101240 short chain dehydrogenase; Provisional 99.56
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.55
PRK06197306 short chain dehydrogenase; Provisional 99.55
PRK07454241 short chain dehydrogenase; Provisional 99.55
PRK07825273 short chain dehydrogenase; Provisional 99.55
PRK06523260 short chain dehydrogenase; Provisional 99.55
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.55
PRK07577234 short chain dehydrogenase; Provisional 99.55
PRK12744257 short chain dehydrogenase; Provisional 99.55
PRK07856252 short chain dehydrogenase; Provisional 99.55
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.55
PRK08017256 oxidoreductase; Provisional 99.55
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.55
cd0907192 FAR_C C-terminal domain of fatty acyl CoA reductas 99.54
PRK06398258 aldose dehydrogenase; Validated 99.54
PRK12747252 short chain dehydrogenase; Provisional 99.54
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.54
PRK05993277 short chain dehydrogenase; Provisional 99.54
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.54
PRK05650270 short chain dehydrogenase; Provisional 99.54
cd06886106 PX_SNX27 The phosphoinositide binding Phox Homolog 99.53
cd06878127 PX_SNX25 The phosphoinositide binding Phox Homolog 99.53
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.53
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.53
PRK08226263 short chain dehydrogenase; Provisional 99.53
PRK06114254 short chain dehydrogenase; Provisional 99.53
cd07277118 PX_RUN The phosphoinositide binding Phox Homology 99.53
PRK07035252 short chain dehydrogenase; Provisional 99.52
PRK08643256 acetoin reductase; Validated 99.52
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.52
PRK07102243 short chain dehydrogenase; Provisional 99.52
PRK07041230 short chain dehydrogenase; Provisional 99.52
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.52
PRK07063260 short chain dehydrogenase; Provisional 99.52
cd06885104 PX_SNX17_31 The phosphoinositide binding Phox Homo 99.52
PRK05867253 short chain dehydrogenase; Provisional 99.51
PRK05866293 short chain dehydrogenase; Provisional 99.51
PRK12743256 oxidoreductase; Provisional 99.51
PRK08277278 D-mannonate oxidoreductase; Provisional 99.51
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.51
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.51
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.51
PRK06198260 short chain dehydrogenase; Provisional 99.51
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.5
PRK08589272 short chain dehydrogenase; Validated 99.5
PRK08251248 short chain dehydrogenase; Provisional 99.5
PRK09242257 tropinone reductase; Provisional 99.5
PRK07478254 short chain dehydrogenase; Provisional 99.5
cd06868120 PX_HS1BP3 The phosphoinositide binding Phox Homolo 99.5
PRK07904253 short chain dehydrogenase; Provisional 99.49
PRK08265261 short chain dehydrogenase; Provisional 99.49
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.49
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.49
cd07301112 PX_SNX21 The phosphoinositide binding Phox Homolog 99.49
PRK09072263 short chain dehydrogenase; Provisional 99.48
PRK08267260 short chain dehydrogenase; Provisional 99.48
PRK06949258 short chain dehydrogenase; Provisional 99.48
PRK06172253 short chain dehydrogenase; Provisional 99.48
PRK07109334 short chain dehydrogenase; Provisional 99.48
cd07280120 PX_YPT35 The phosphoinositide binding Phox Homolog 99.47
cd07300114 PX_SNX20 The phosphoinositide binding Phox Homolog 99.47
PRK08278273 short chain dehydrogenase; Provisional 99.47
PRK06057255 short chain dehydrogenase; Provisional 99.47
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.47
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.46
PRK07677252 short chain dehydrogenase; Provisional 99.46
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK07576264 short chain dehydrogenase; Provisional 99.46
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.46
PRK07069251 short chain dehydrogenase; Validated 99.46
PRK05872296 short chain dehydrogenase; Provisional 99.46
cd06883109 PX_PI3K_C2 The phosphoinositide binding Phox Homol 99.46
cd06873120 PX_SNX13 The phosphoinositide binding Phox Homolog 99.46
PRK05693274 short chain dehydrogenase; Provisional 99.46
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.45
PRK08703239 short chain dehydrogenase; Provisional 99.45
PRK05854313 short chain dehydrogenase; Provisional 99.45
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.45
cd06882123 PX_p40phox The phosphoinositide binding Phox Homol 99.45
PRK12742237 oxidoreductase; Provisional 99.44
PRK06139330 short chain dehydrogenase; Provisional 99.44
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.44
PRK06947248 glucose-1-dehydrogenase; Provisional 99.43
PRK09009235 C factor cell-cell signaling protein; Provisional 99.43
cd06881117 PX_SNX15_like The phosphoinositide binding Phox Ho 99.43
PRK08936261 glucose-1-dehydrogenase; Provisional 99.43
cd06874127 PX_KIF16B_SNX23 The phosphoinositide binding Phox 99.43
PRK06484520 short chain dehydrogenase; Validated 99.42
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.42
cd06876133 PX_MDM1p The phosphoinositide binding Phox Homolog 99.42
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.41
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.41
PRK07201657 short chain dehydrogenase; Provisional 99.41
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.41
PRK07023243 short chain dehydrogenase; Provisional 99.41
cd06864129 PX_SNX4 The phosphoinositide binding Phox Homology 99.41
cd07287118 PX_RPK118_like The phosphoinositide binding Phox H 99.4
PRK07578199 short chain dehydrogenase; Provisional 99.4
cd07279112 PX_SNX20_21_like The phosphoinositide binding Phox 99.4
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.39
cd06887118 PX_p47phox The phosphoinositide binding Phox Homol 99.39
PRK06483236 dihydromonapterin reductase; Provisional 99.39
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.39
PRK07832272 short chain dehydrogenase; Provisional 99.39
COG0300265 DltE Short-chain dehydrogenases of various substra 99.38
cd06898113 PX_SNX10 The phosphoinositide binding Phox Homolog 99.38
PRK08177225 short chain dehydrogenase; Provisional 99.38
PRK06953222 short chain dehydrogenase; Provisional 99.38
cd06867112 PX_SNX41_42 The phosphoinositide binding Phox Homo 99.38
PRK07831262 short chain dehydrogenase; Provisional 99.38
PRK05855582 short chain dehydrogenase; Validated 99.38
cd07281124 PX_SNX1 The phosphoinositide binding Phox Homology 99.37
PRK08339263 short chain dehydrogenase; Provisional 99.37
cd06895140 PX_PLD The phosphoinositide binding Phox Homology 99.37
cd06884111 PX_PI3K_C2_68D The phosphoinositide binding Phox H 99.37
cd06879138 PX_UP1_plant The phosphoinositide binding Phox Hom 99.37
cd06893132 PX_SNX19 The phosphoinositide binding Phox Homolog 99.37
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.36
cd06871120 PX_MONaKA The phosphoinositide binding Phox Homolo 99.36
cd06865120 PX_SNX_like The phosphoinositide binding Phox Homo 99.36
PRK07062265 short chain dehydrogenase; Provisional 99.35
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.35
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.34
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.34
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.34
PRK07791286 short chain dehydrogenase; Provisional 99.34
PRK06125259 short chain dehydrogenase; Provisional 99.34
cd06861112 PX_Vps5p The phosphoinositide binding Phox Homolog 99.33
cd07282124 PX_SNX2 The phosphoinositide binding Phox Homology 99.33
KOG1259|consensus 490 99.32
PLN02780320 ketoreductase/ oxidoreductase 99.32
KOG1205|consensus282 99.32
PRK06924251 short chain dehydrogenase; Provisional 99.32
cd06862125 PX_SNX9_18_like The phosphoinositide binding Phox 99.31
cd06894123 PX_SNX3_like The phosphoinositide binding Phox Hom 99.31
cd07295116 PX_Grd19 The phosphoinositide binding Phox Homolog 99.3
KOG2774|consensus366 99.3
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.3
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.3
PRK12367245 short chain dehydrogenase; Provisional 99.3
cd06863118 PX_Atg24p The phosphoinositide binding Phox Homolo 99.3
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.3
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.29
cd06866105 PX_SNX8_Mvp1p_like The phosphoinositide binding Ph 99.29
cd07293123 PX_SNX3 The phosphoinositide binding Phox Homology 99.28
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.28
cd07289109 PX_PI3K_C2_alpha The phosphoinositide binding Phox 99.27
PRK06940275 short chain dehydrogenase; Provisional 99.27
cd07288118 PX_SNX15 The phosphoinositide binding Phox Homolog 99.27
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.27
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.26
cd06859114 PX_SNX1_2_like The phosphoinositide binding Phox H 99.25
cd06869119 PX_UP2_fungi The phosphoinositide binding Phox Hom 99.24
PRK05884223 short chain dehydrogenase; Provisional 99.24
cd06860116 PX_SNX7_30_like The phosphoinositide binding Phox 99.24
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.24
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.22
cd07290109 PX_PI3K_C2_beta The phosphoinositide binding Phox 99.22
cd07294132 PX_SNX12 The phosphoinositide binding Phox Homolog 99.22
PRK08340259 glucose-1-dehydrogenase; Provisional 99.21
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.21
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.21
smart00312105 PX PhoX homologous domain, present in p47phox and 99.21
KOG4039|consensus238 99.2
cd06093106 PX_domain The Phox Homology domain, a phosphoinosi 99.2
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PRK06484520 short chain dehydrogenase; Validated 99.19
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.18
PRK08303305 short chain dehydrogenase; Provisional 99.16
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.15
KOG1201|consensus300 99.11
PRK05599246 hypothetical protein; Provisional 99.11
PF00787113 PX: PX domain; InterPro: IPR001683 The PX (phox) d 99.1
PRK08862227 short chain dehydrogenase; Provisional 99.1
cd06890112 PX_Bem1p The phosphoinositide binding Phox Homolog 99.09
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.09
cd07296135 PX_PLD1 The phosphoinositide binding Phox Homology 99.08
cd06888119 PX_FISH The phosphoinositide binding Phox Homology 99.08
cd07283116 PX_SNX30 The phosphoinositide binding Phox Homolog 99.07
KOG4288|consensus283 99.03
cd07286127 PX_SNX18 The phosphoinositide binding Phox Homolog 99.03
KOG1203|consensus411 99.03
PLN00015308 protochlorophyllide reductase 99.0
cd07284116 PX_SNX7 The phosphoinositide binding Phox Homology 98.99
KOG1208|consensus314 98.97
cd07285126 PX_SNX9 The phosphoinositide binding Phox Homology 98.93
KOG1200|consensus256 98.9
KOG0725|consensus270 98.87
KOG4169|consensus261 98.85
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.84
KOG1611|consensus249 98.82
COG1028251 FabG Dehydrogenases with different specificities ( 98.81
PLN02730303 enoyl-[acyl-carrier-protein] reductase 98.77
KOG1610|consensus322 98.75
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.73
COG2910211 Putative NADH-flavin reductase [General function p 98.73
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.67
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.64
KOG2527|consensus144 98.62
KOG1207|consensus245 98.6
KOG3019|consensus315 98.52
KOG1210|consensus331 98.48
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 98.48
PLN00106323 malate dehydrogenase 98.46
PTZ00325321 malate dehydrogenase; Provisional 98.41
cd06891140 PX_Vps17p The phosphoinositide binding Phox Homolo 98.38
KOG3784|consensus 407 98.38
KOG1209|consensus289 98.36
cd06889121 PX_NoxO1 The phosphoinositide binding Phox Homolog 98.25
KOG1014|consensus312 98.24
PRK06720169 hypothetical protein; Provisional 98.14
cd07297130 PX_PLD2 The phosphoinositide binding Phox Homology 98.12
PRK08309177 short chain dehydrogenase; Provisional 98.07
PRK09620229 hypothetical protein; Provisional 98.05
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.04
KOG1204|consensus253 98.03
cd06896101 PX_PI3K_C2_gamma The phosphoinositide binding Phox 97.95
KOG1199|consensus260 97.85
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.78
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 97.69
PRK14982340 acyl-ACP reductase; Provisional 97.61
cd06892141 PX_SNX5_like The phosphoinositide binding Phox Hom 97.53
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.48
KOG1478|consensus341 97.42
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.31
PRK05086312 malate dehydrogenase; Provisional 97.29
cd07291141 PX_SNX5 The phosphoinositide binding Phox Homology 97.29
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.26
KOG2101|consensus362 97.24
KOG2273|consensus 503 97.21
cd07292141 PX_SNX6 The phosphoinositide binding Phox Homology 97.19
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.19
KOG2733|consensus423 97.13
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.07
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.05
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.01
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.78
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.75
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.64
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.53
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.52
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.51
COG0623259 FabI Enoyl-[acyl-carrier-protein] 96.51
KOG1202|consensus2376 96.49
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.23
COG5391 524 Phox homology (PX) domain protein [Intracellular t 96.07
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 95.91
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.9
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.89
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 95.88
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 95.87
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.65
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.51
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 95.42
PRK00048257 dihydrodipicolinate reductase; Provisional 95.42
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.41
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 95.39
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.33
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.32
PRK08223287 hypothetical protein; Validated 95.29
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 95.26
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.21
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.19
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.0
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 94.99
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.8
PRK05442326 malate dehydrogenase; Provisional 94.65
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 94.59
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.52
cd07298115 PX_RICS The phosphoinositide binding Phox Homology 94.46
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.42
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 94.19
PRK08328231 hypothetical protein; Provisional 94.12
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.07
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.06
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 93.99
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.95
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 93.51
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.26
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 93.26
PRK07877722 hypothetical protein; Provisional 93.24
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.22
COG3268382 Uncharacterized conserved protein [Function unknow 93.21
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.19
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 93.18
PLN00112444 malate dehydrogenase (NADP); Provisional 93.06
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.01
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 92.97
COG4982866 3-oxoacyl-[acyl-carrier protein] 92.94
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 92.87
PTZ00117319 malate dehydrogenase; Provisional 92.65
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 92.52
PRK05600370 thiamine biosynthesis protein ThiF; Validated 92.52
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.48
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.45
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.44
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.42
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 92.34
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 92.3
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 92.21
PLN02383344 aspartate semialdehyde dehydrogenase 92.15
KOG0905|consensus1639 92.13
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 91.91
cd07278114 PX_RICS_like The phosphoinositide binding Phox Hom 91.85
PRK07411390 hypothetical protein; Validated 91.78
PRK09496453 trkA potassium transporter peripheral membrane com 91.7
PLN02602350 lactate dehydrogenase 91.4
cd07299113 PX_TCGAP The phosphoinositide binding Phox Homolog 91.23
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.22
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.94
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 90.93
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 90.62
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 90.5
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 90.36
PRK14851679 hypothetical protein; Provisional 90.32
KOG4022|consensus236 89.89
PTZ00082321 L-lactate dehydrogenase; Provisional 89.6
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.48
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.39
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 89.34
PRK04148134 hypothetical protein; Provisional 89.23
PRK06223307 malate dehydrogenase; Reviewed 88.98
PRK06153393 hypothetical protein; Provisional 88.88
KOG1494|consensus345 88.74
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 88.69
PRK14852989 hypothetical protein; Provisional 88.44
PRK13940414 glutamyl-tRNA reductase; Provisional 87.68
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 87.68
KOG2528|consensus 490 87.65
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 87.28
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 87.13
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 86.85
TIGR00036266 dapB dihydrodipicolinate reductase. 86.8
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 86.8
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 86.79
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 86.77
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 86.76
KOG1178|consensus1032 86.37
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 86.25
KOG1496|consensus332 86.17
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 86.15
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 86.13
PRK09496453 trkA potassium transporter peripheral membrane com 85.54
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 85.52
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 85.48
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 85.41
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 85.26
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 85.14
PRK08040336 putative semialdehyde dehydrogenase; Provisional 85.07
>KOG1221|consensus Back     alignment and domain information
Probab=100.00  E-value=1.7e-85  Score=724.84  Aligned_cols=434  Identities=41%  Similarity=0.752  Sum_probs=418.6

Q ss_pred             hhhhhccCCCEEEEECCCChhHHHHHHHHHHcCCCc-EEEEEeCCCCCcchHHHHHHHhcChhHHHHHhhhhcccccCCe
Q psy7542          53 DRISATLEHKNIFITGASGFVGKVLLEKILRTCENV-KIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKV  131 (762)
Q Consensus        53 ~~i~~~~~gk~VLVTGATGFLG~~LvekLL~~gp~v-~V~~LvR~~~~~~~~eRl~~ll~~~~f~~l~~~~~~~~~~~kV  131 (762)
                      +++++||+||+|||||||||+|+.|+|+||+.+|++ +||+|+|+++++++++|+++++.+++|+.+++.+  ++..+|+
T Consensus         4 ~~i~~f~~~k~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~--p~~l~Kv   81 (467)
T KOG1221|consen    4 SDIVQFYKNKTIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKK--PEALEKV   81 (467)
T ss_pred             ccHHHHhCCCeEEEEcccchhHHHHHHHHHhcCcCcceEEEEEecCCCCCHHHHHHHHHhhhHHHHHHhhC--ccceecc
Confidence            348899999999999999999999999999999999 9999999999999999999999999999999999  8899999


Q ss_pred             EEEEeecCCCCCCCCHHHHHhhcCCccEEEEcccccCccccHHHHHHHhHHHHHHHHHHHHHcCCccEEEEEeCCcccCC
Q psy7542         132 IPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPK  211 (762)
Q Consensus       132 ~~V~GDl~~~~LGLs~~~l~~l~~~vDiViH~AA~v~f~~~l~~~~~~NV~GT~~LLelA~~~~~lk~fV~vSSay~~~~  211 (762)
                      .+|.||+++++||++++|++.+.++||+|||+||+++|+++++.++.+|+.||++++++|+++++++.|+||||+|++|.
T Consensus        82 ~pi~GDi~~~~LGis~~D~~~l~~eV~ivih~AAtvrFde~l~~al~iNt~Gt~~~l~lak~~~~l~~~vhVSTAy~n~~  161 (467)
T KOG1221|consen   82 VPIAGDISEPDLGISESDLRTLADEVNIVIHSAATVRFDEPLDVALGINTRGTRNVLQLAKEMVKLKALVHVSTAYSNCN  161 (467)
T ss_pred             eeccccccCcccCCChHHHHHHHhcCCEEEEeeeeeccchhhhhhhhhhhHhHHHHHHHHHHhhhhheEEEeehhheecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccccCCCCC--ChhhHHHHHHhhhHHHHHHHHHhhhcCCCchhHhhhHHHHHHHHHHHHcCCCEEEEeeeeeccCC
Q psy7542         212 EKVLEEKTYPPPV--SPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEAGMPCMILRPSIIIPIW  289 (762)
Q Consensus       212 ~~~i~E~~~~~p~--~p~~~~~~~e~l~~e~l~~~tp~l~~~~pn~Y~~SK~~aE~lv~~~~~~glpv~IvRPs~V~G~~  289 (762)
                      ...++|+.|+.+.  ++++++++.++++++.++.+++++.++|||+|++||++||+++.++++ ++|++|+||++|+++.
T Consensus       162 ~~~i~E~~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~~-~lPivIiRPsiI~st~  240 (467)
T KOG1221|consen  162 VGHIEEKPYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEAE-NLPLVIIRPSIITSTY  240 (467)
T ss_pred             cccccccccCccccCCHHHHHhhhccchHHHHHHhhHHhcCCCCCceeehHhhHHHHHHhhcc-CCCeEEEcCCceeccc
Confidence            9999999999988  899999999999999999999999999999999999999999999988 9999999999999999


Q ss_pred             CCCCCCCCCCCCCchHHHHHHhcCCeEEEeeCCCcccccccHHHHHHHHHHHhhcccCCCC-CCceEEEecCCCCCcccH
Q psy7542         290 KDPLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPG-NTMRVINLTANKDFQITW  368 (762)
Q Consensus       290 ~eP~pGWidn~~gp~~li~~~~~G~l~~i~gd~~~~~d~VpVDdvA~aii~a~~~~~~~~~-~~~~iyNi~s~~~~piT~  368 (762)
                      ++|+|||+||.+||.+++.++++|.++.+.+|++...|+||||+|||++++++|......+ ++..|||++++..||++|
T Consensus       241 ~EP~pGWidn~~gp~g~i~g~gkGvlr~~~~d~~~~adiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~t~  320 (467)
T KOG1221|consen  241 KEPFPGWIDNLNGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPVTW  320 (467)
T ss_pred             cCCCCCccccCCCCceEEEEeccceEEEEEEccccccceeeHHHHHHHHHHHHHHHhccCCCCCCcEEEecccccCcccH
Confidence            9999999999999999999999999999999999999999999999999999987654322 246799999999999999


Q ss_pred             HHHHHHHHHhhccCCCCccccccCCccccc--------------------------cCCCchhhHHHHHHhhhhhhhccc
Q psy7542         369 YDIIENGKDIARNKVPLNNVLWYPGGAMTN--------------------------RGYEPVLKRVHNRIKKGFDIFEYY  422 (762)
Q Consensus       369 ~el~~~i~~~~G~~~P~~~~~w~p~~~~~~--------------------------lG~kP~l~~l~~ki~~~~~~l~~f  422 (762)
                      +++.+...++. .+.|+...+|+|...+.+                          .|++|.+.++++++.+..+.+++|
T Consensus       321 ~~~~e~~~~~~-~~~Pl~~~iw~P~~~~~sn~~~f~~~~~~~h~lPa~~~d~~~~i~g~k~~~~k~~~ki~~~~~~l~~f  399 (467)
T KOG1221|consen  321 GDFIELALRYF-EKIPLEKMIWYPFGTLTSNPWLFNLAAFLYHTLPAYILDLLLRLLGKKPRLVKLYRKIHKLVKLLEPF  399 (467)
T ss_pred             HHHHHHHHHhc-ccCCcccceeccCceeeecHhHHHHHHHHHHHhhHHHHHHHHHHhCCChhhhHHHHHHHHHHHhhhhh
Confidence            99999999999 899999999999998775                          699999999999999999999999


Q ss_pred             ccCceeeecHHHHHHHhhcchhhhhcccccccCCCchHHHHHHHHHHHHhhcccCCCCCCcHHHHHHHHH
Q psy7542         423 TKNSWSFKNENLHALRNMMNEKEAIRYEIAMFRDLDEAKAYFEMCIHGARQYLLGEPPETLPGAKRHVRI  492 (762)
Q Consensus       423 ~~~~w~Fd~~n~~~L~~~ls~~Dr~~F~fD~~~~id~W~~Y~~~~~~Girkyllke~~~~l~~ar~~~~~  492 (762)
                      +.++|.||++|+.+|+..|+++|++.|+||+ +++| |++|+.+|+.|+|+|++||+++++|+||++++|
T Consensus       400 ~~~~w~Fd~~n~~~L~~~~~~~d~~~f~fd~-~~ld-W~ey~~~~i~G~r~~llKe~~e~l~~~r~~~kr  467 (467)
T KOG1221|consen  400 SLFKWIFDNKNTEKLREKMSEEDKRLFNFDM-KQLD-WEEYFNRHLLGLRKYLLKESPESLPQARKRLKR  467 (467)
T ss_pred             eeceEEecCccHHHHHHhCCHHHHhhcCCCc-ccCC-HHHHHHHHHHHHHHHHhcCChhhhHHHHHhhcC
Confidence            9999999999999999999999999999999 9999 999999999999999999999999999999875



>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>cd06880 PX_SNX22 The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd06875 PX_IRAS The phosphoinositide binding Phox Homology domain of the Imidazoline Receptor Antisera-Selected Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06870 PX_CISK The phosphoinositide binding Phox Homology Domain of Cytokine-Independent Survival Kinase Back     alignment and domain information
>cd07276 PX_SNX16 The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06877 PX_SNX14 The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06886 PX_SNX27 The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 Back     alignment and domain information
>cd06878 PX_SNX25 The phosphoinositide binding Phox Homology domain of Sorting Nexin 25 Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd07277 PX_RUN The phosphoinositide binding Phox Homology domain of uncharacterized proteins containing PX and RUN domains Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06868 PX_HS1BP3 The phosphoinositide binding Phox Homology domain of HS1BP3 Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>cd07301 PX_SNX21 The phosphoinositide binding Phox Homology domain of Sorting Nexin 21 Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd07280 PX_YPT35 The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 Back     alignment and domain information
>cd07300 PX_SNX20 The phosphoinositide binding Phox Homology domain of Sorting Nexin 20 Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06883 PX_PI3K_C2 The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd06873 PX_SNX13 The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>cd06882 PX_p40phox The phosphoinositide binding Phox Homology domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>cd06881 PX_SNX15_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 15-like proteins Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd06874 PX_KIF16B_SNX23 The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd06876 PX_MDM1p The phosphoinositide binding Phox Homology domain of yeast MDM1p Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 Back     alignment and domain information
>cd07287 PX_RPK118_like The phosphoinositide binding Phox Homology domain of RPK118-like proteins Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>cd06887 PX_p47phox The phosphoinositide binding Phox Homology domain of the p47phox subunit of NADPH oxidase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06867 PX_SNX41_42 The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06895 PX_PLD The phosphoinositide binding Phox Homology domain of Phospholipase D Back     alignment and domain information
>cd06884 PX_PI3K_C2_68D The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases similar to the Drosophila PI3K_68D protein Back     alignment and domain information
>cd06879 PX_UP1_plant The phosphoinositide binding Phox Homology domain of uncharacterized plant proteins Back     alignment and domain information
>cd06893 PX_SNX19 The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>cd06871 PX_MONaKA The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase Back     alignment and domain information
>cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06861 PX_Vps5p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p Back     alignment and domain information
>cd07282 PX_SNX2 The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06862 PX_SNX9_18_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 Back     alignment and domain information
>cd06894 PX_SNX3_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins Back     alignment and domain information
>cd07295 PX_Grd19 The phosphoinositide binding Phox Homology domain of fungal Grd19 Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06863 PX_Atg24p The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd06866 PX_SNX8_Mvp1p_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p Back     alignment and domain information
>cd07293 PX_SNX3 The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd07289 PX_PI3K_C2_alpha The phosphoinositide binding Phox Homology Domain of the Alpha Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd07288 PX_SNX15 The phosphoinositide binding Phox Homology domain of Sorting Nexin 15 Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd06869 PX_UP2_fungi The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd07290 PX_PI3K_C2_beta The phosphoinositide binding Phox Homology Domain of the Beta Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd07294 PX_SNX12 The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>smart00312 PX PhoX homologous domain, present in p47phox and p40phox Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>cd06093 PX_domain The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PF00787 PX: PX domain; InterPro: IPR001683 The PX (phox) domain [] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [, , ] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd06890 PX_Bem1p The phosphoinositide binding Phox Homology domain of Bem1p Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>cd07296 PX_PLD1 The phosphoinositide binding Phox Homology domain of Phospholipase D1 Back     alignment and domain information
>cd06888 PX_FISH The phosphoinositide binding Phox Homology domain of Five SH protein Back     alignment and domain information
>cd07283 PX_SNX30 The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>cd07286 PX_SNX18 The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG2527|consensus Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>KOG3019|consensus Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd06891 PX_Vps17p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps17p Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>cd06889 PX_NoxO1 The phosphoinositide binding Phox Homology domain of Nox Organizing protein 1 Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>cd07297 PX_PLD2 The phosphoinositide binding Phox Homology domain of Phospholipase D2 Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>cd06896 PX_PI3K_C2_gamma The phosphoinositide binding Phox Homology Domain of the Gamma Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd06892 PX_SNX5_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd07291 PX_SNX5 The phosphoinositide binding Phox Homology domain of Sorting Nexin 5 Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG2101|consensus Back     alignment and domain information
>KOG2273|consensus Back     alignment and domain information
>cd07292 PX_SNX6 The phosphoinositide binding Phox Homology domain of Sorting Nexin 6 Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG5391 Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd07298 PX_RICS The phosphoinositide binding Phox Homology domain of PX-RICS Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>cd07278 PX_RICS_like The phosphoinositide binding Phox Homology domain of PX-RICS-like proteins Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd07299 PX_TCGAP The phosphoinositide binding Phox Homology domain of Tc10/Cdc42 GTPase-activating protein Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG1494|consensus Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>KOG1496|consensus Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
4dqv_A478 Crystal Structure Of Reductase (R) Domain Of Non-Ri 1e-11
>pdb|4DQV|A Chain A, Crystal Structure Of Reductase (R) Domain Of Non-Ribosomal Peptide Synthetase From Mycobacterium Tuberculosis Length = 478 Back     alignment and structure

Iteration: 1

Score = 68.6 bits (166), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 44/148 (29%), Positives = 86/148 (58%), Gaps = 5/148 (3%) Query: 60 EHKNIFITGASGFVGKVLLEKILRTCE-NVKIYILLRPKKNKNSRERLEEIFQSPLYEAL 118 E + + +TGA+GF+G+ L+ ++LR + + ++ L+R + ++++R RLE+ F S E L Sbjct: 72 ELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELL 131 Query: 119 KKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVF 178 + + +A +++ + GD + PDLG+ + L+ET+ ++ AA V Y + + Sbjct: 132 RHFKELAA--DRLEVVAGDKSEPDLGLDQPXWRRLAETVDLIVDSAAXVNAFPYHELF-G 188 Query: 179 LNTRGTRDMLNLSKQMIHLQLFVYVSTA 206 N GT +++ ++ L+ F YVSTA Sbjct: 189 PNVAGTAELIRIA-LTTKLKPFTYVSTA 215

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 2e-61
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-22
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-17
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 1e-09
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 1e-04
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 6e-09
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 8e-08
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 3e-07
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 4e-07
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 2e-06
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 8e-06
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 1e-05
3p0c_A130 Nischarin; structural genomics, structural genomic 1e-05
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 1e-05
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 4e-05
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 5e-05
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 5e-05
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 1e-04
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 9e-05
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 1e-04
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 1e-04
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 2e-04
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 3e-04
3slg_A372 PBGP3 protein; structural genomics, seattle struct 4e-04
1xq6_A253 Unknown protein; structural genomics, protein stru 8e-04
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 8e-04
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score =  213 bits (544), Expect = 2e-61
 Identities = 68/364 (18%), Positives = 143/364 (39%), Gaps = 38/364 (10%)

Query: 39  FIVKAIPKKFKHLPDRISATLEHKNIFITGASGFVGKVLLEKILRTCE-NVKIYILLRPK 97
           FI         +LP       E + + +TGA+GF+G+ L+ ++LR  + + ++  L+R +
Sbjct: 54  FIDADTLATAVNLPGPSP---ELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAE 110

Query: 98  KNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETI 157
            ++++R RLE+ F S   E L+  +  +A  +++  + GD + PDLG+     + L+ET+
Sbjct: 111 SDEDARRRLEKTFDSGDPELLRHFKELAA--DRLEVVAGDKSEPDLGLDQPMWRRLAETV 168

Query: 158 HIVYHIAATVRFDDYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEE 217
            ++   AA V    Y + +   N  GT +++ ++     L+ F YVSTA           
Sbjct: 169 DLIVDSAAMVNAFPYHELFG-PNVAGTAELIRIALTT-KLKPFTYVSTADVG-------- 218

Query: 218 KTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYME-AGMP 276
                 + P    E A++   +    +          GY  +K   E ++ E  +   +P
Sbjct: 219 ----AAIEPSAFTEDADIRVISPTRTVDGGW----AGGYGTSKWAGEVLLREANDLCALP 270

Query: 277 CMILRPSIIIPIWKDPLPGWTDNINGPTGLLIGA--------GKGIIRTMYCDYSTCADF 328
             + R  +I  +      G  +  +  T +++                +         D 
Sbjct: 271 VAVFRCGMI--LADTSYAGQLNMSDWVTRMVLSLMATGIAPRSFYEPDSEGNRQRAHFDG 328

Query: 329 LPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYDIIENGKDIARNKVPLNNV 388
           LPV  +   + +       +        ++    D  I   + ++    +     P+  +
Sbjct: 329 LPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEYVD---WLIEAGYPIRRI 385

Query: 389 LWYP 392
             + 
Sbjct: 386 DDFA 389


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Length = 143 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Length = 130 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Length = 140 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Length = 115 Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Length = 154 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.98
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.98
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.98
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.98
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.98
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.98
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.98
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.98
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.97
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.97
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.97
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.97
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.97
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.97
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.97
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.97
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.97
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.97
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.97
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.97
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.97
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.97
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.97
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.97
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.97
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.97
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.97
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.96
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.96
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.96
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 99.96
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.96
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.96
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.96
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.96
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.96
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.96
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.96
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.96
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.96
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.96
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.96
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.96
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.95
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.95
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.95
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.95
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.95
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.95
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.95
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.94
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.94
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.94
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.94
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.94
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.94
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.93
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.93
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.93
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.93
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.92
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.92
1xq6_A253 Unknown protein; structural genomics, protein stru 99.91
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.91
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.91
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.9
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.89
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.89
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.89
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.89
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.88
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.88
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.87
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.87
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.87
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.86
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.84
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.83
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.82
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.82
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.81
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.8
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.8
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.8
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.79
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.79
1spx_A278 Short-chain reductase family member (5L265); paral 99.79
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.78
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.78
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.78
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.78
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.78
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.78
4az9_A129 Sorting nexin-24; protein transport; 1.75A {Homo s 99.78
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.77
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.77
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.77
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.77
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.77
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.77
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.77
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.77
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.76
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.76
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.76
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.76
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.76
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.75
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.75
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.75
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.75
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.75
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.75
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.75
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.75
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.75
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.75
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.75
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.75
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.75
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.75
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.75
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.75
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.75
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.75
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.74
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.74
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.74
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.74
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.74
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.74
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.74
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.73
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.73
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.73
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.73
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.73
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 99.73
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.73
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.73
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.73
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.73
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.73
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.73
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.73
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.73
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.73
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.72
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.72
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.72
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.72
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.72
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.72
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.72
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.72
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.72
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.72
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.72
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.72
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.72
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.72
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.72
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.72
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.71
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.71
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.71
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.71
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.71
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.71
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.71
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.71
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.71
3rih_A293 Short chain dehydrogenase or reductase; structural 99.71
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.71
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.71
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.71
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.71
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.71
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.71
3cxt_A291 Dehydrogenase with different specificities; rossma 99.71
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.7
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.7
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.7
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.7
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.7
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.7
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.7
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.7
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.7
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.7
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.7
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.7
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.7
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.7
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.7
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.7
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.7
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.7
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.7
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.7
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.69
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.69
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.69
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.69
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.69
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.69
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.69
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.69
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.69
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.69
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.69
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.69
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.69
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.68
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.68
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.68
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.68
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.68
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.68
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.68
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.68
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.68
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.68
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.68
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.68
1xkq_A280 Short-chain reductase family member (5D234); parra 99.68
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.68
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.68
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.68
4e4y_A244 Short chain dehydrogenase family protein; structur 99.68
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.67
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.67
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.67
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.67
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.67
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.67
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.67
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.67
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.66
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.66
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.66
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.65
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.65
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.65
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.65
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.65
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.65
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.64
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.64
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.64
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.64
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.63
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.63
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.63
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.63
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.63
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.63
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.62
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.62
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.62
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.62
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.62
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.6
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.6
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.59
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.58
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.58
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.56
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.55
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.55
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.55
1kmd_A117 VAM7P, vacuolar morphogenesis protein VAM7; PX dom 99.55
3p0c_A130 Nischarin; structural genomics, structural genomic 99.54
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.53
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.53
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.53
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 99.52
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.52
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 99.51
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.51
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.51
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.5
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.5
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 99.5
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.49
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.47
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 99.47
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.46
3iq2_A138 Sorting nexin-7; SNX7, PHOX, protein signalling, S 99.46
2csk_A146 Sorting nexin 12; SNX12, PX domain, structural gen 99.46
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.46
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.46
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.46
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.46
2ar5_A121 Phosphoinositide 3-kinase; PX domain, transferase; 99.43
1ocs_A162 Sorting nexin GRD19; sorting protein, PX-domain, y 99.4
1kq6_A141 NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha 99.4
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 99.38
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.37
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.35
2i4k_A128 Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al 99.35
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 99.34
2l73_A149 NADPH oxidase organizer 1; cell membrane, PX domai 99.29
2v6v_A156 BUD emergence protein 1; homotypic fusion, regulat 99.27
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.17
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.16
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.15
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.14
2wwe_A127 Phosphoinositide-3-kinase, class 2, gamma polypept 99.12
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.05
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.03
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.03
3dyt_A 366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 99.0
4akv_A 386 Sorting nexin-33; transport protein, organelle bio 98.99
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.92
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.91
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.91
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.86
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 98.83
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.8
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 98.77
3hpc_X161 SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph 98.63
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 98.51
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.45
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.44
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.39
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.32
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 98.3
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.03
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 97.98
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.68
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 97.66
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.56
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.55
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.51
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 97.42
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.31
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.26
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.23
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.18
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.0
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.92
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.78
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.78
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 96.75
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.11
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.56
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 95.53
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 95.45
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.45
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.43
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.37
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.23
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.22
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 95.14
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.1
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 94.96
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.91
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.9
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.8
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.78
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 94.76
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 94.76
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.55
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.48
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 94.39
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.34
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 94.26
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.21
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 94.21
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 94.19
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.13
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 93.98
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 93.79
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 93.73
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 93.51
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.46
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 93.45
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 93.41
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.38
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 93.33
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.25
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.25
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.21
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 93.16
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.15
3gms_A340 Putative NADPH:quinone reductase; structural genom 93.15
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 93.1
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 93.08
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 93.06
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.94
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.88
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.79
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 92.79
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 92.77
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.53
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.45
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 92.13
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.11
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.11
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 92.09
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 92.01
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 91.98
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 91.98
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 91.9
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 91.5
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 91.49
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 91.41
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.4
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.21
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 91.18
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 91.13
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 91.13
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 91.04
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 90.95
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 90.95
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 90.78
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 90.62
3p2o_A285 Bifunctional protein fold; structural genomics, ce 90.53
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.44
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 90.28
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 90.19
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 90.09
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.04
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 90.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 89.91
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 89.87
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 89.78
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 89.69
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 89.68
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 89.66
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 89.53
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 89.32
3l07_A285 Bifunctional protein fold; structural genomics, ID 88.93
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 88.88
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 88.65
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 88.53
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 88.11
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 88.11
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 88.04
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 87.85
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 87.83
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 87.74
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 87.69
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 87.66
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 87.45
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 87.32
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 86.81
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.53
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 86.47
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 86.32
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 86.16
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 86.06
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 85.91
1lnq_A336 MTHK channels, potassium channel related protein; 85.78
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.67
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 85.51
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 85.33
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 85.32
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 84.98
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 84.87
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 84.84
4g65_A461 TRK system potassium uptake protein TRKA; structur 84.57
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 83.78
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 83.74
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 83.58
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 83.41
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 83.34
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 83.27
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 83.21
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 83.2
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 83.14
3krt_A456 Crotonyl COA reductase; structural genomics, prote 82.98
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 82.97
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 82.76
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 82.55
2rir_A300 Dipicolinate synthase, A chain; structural genomic 82.1
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 81.78
2d59_A144 Hypothetical protein PH1109; COA binding, structur 81.75
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 81.58
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 81.51
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 81.32
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 81.29
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 81.22
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-33  Score=306.81  Aligned_cols=302  Identities=20%  Similarity=0.194  Sum_probs=225.5

Q ss_pred             ccCCCEEEEECCCChhHHHHHHHHHHcCCCcEEEEEeCCCCCcchHHHHHHHhcChhHHHHHhhhhcccccCCeEEEEee
Q psy7542          58 TLEHKNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGD  137 (762)
Q Consensus        58 ~~~gk~VLVTGATGFLG~~LvekLL~~gp~v~V~~LvR~~~~~~~~eRl~~ll~~~~f~~l~~~~~~~~~~~kV~~V~GD  137 (762)
                      .+++|+|||||||||||++|+++|++.  +.+|++++|......  +.+..+....        .  +....+++++.+|
T Consensus        22 ~~~~~~vlVtGatG~iG~~l~~~L~~~--g~~V~~~~r~~~~~~--~~~~~~~~~~--------~--~~~~~~~~~~~~D   87 (351)
T 3ruf_A           22 IFSPKTWLITGVAGFIGSNLLEKLLKL--NQVVIGLDNFSTGHQ--YNLDEVKTLV--------S--TEQWSRFCFIEGD   87 (351)
T ss_dssp             HHSCCEEEEETTTSHHHHHHHHHHHHT--TCEEEEEECCSSCCH--HHHHHHHHTS--------C--HHHHTTEEEEECC
T ss_pred             CCCCCeEEEECCCcHHHHHHHHHHHHC--CCEEEEEeCCCCCch--hhhhhhhhcc--------c--cccCCceEEEEcc
Confidence            357899999999999999999999998  678999999765432  2222221100        0  0112689999999


Q ss_pred             cCCCCCCCCHHHHHhhcCCccEEEEcccccCcc---ccHHHHHHHhHHHHHHHHHHHHHcCCccEEEEEeCCcccCC--C
Q psy7542         138 VAVPDLGISAEDRQMLSETIHIVYHIAATVRFD---DYMQTYVFLNTRGTRDMLNLSKQMIHLQLFVYVSTAYCHPK--E  212 (762)
Q Consensus       138 l~~~~LGLs~~~l~~l~~~vDiViH~AA~v~f~---~~l~~~~~~NV~GT~~LLelA~~~~~lk~fV~vSSay~~~~--~  212 (762)
                      +++++      ++..+++++|+|||+||.....   ......+++|+.||.+++++|++. ++++|||+||+.+++.  .
T Consensus        88 l~d~~------~~~~~~~~~d~Vih~A~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~-~~~~~v~~SS~~vyg~~~~  160 (351)
T 3ruf_A           88 IRDLT------TCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNA-QVQSFTYAASSSTYGDHPA  160 (351)
T ss_dssp             TTCHH------HHHHHTTTCSEEEECCCCCCHHHHHHCHHHHHHHHTHHHHHHHHHHHHT-TCSEEEEEEEGGGGTTCCC
T ss_pred             CCCHH------HHHHHhcCCCEEEECCccCCcchhhhCHHHHHHHHHHHHHHHHHHHHHc-CCCEEEEEecHHhcCCCCC
Confidence            99865      7899999999999999976543   345568899999999999999997 7899999999866543  3


Q ss_pred             cccccccCCCCCChhhHHHHHHhhhHHHHHHHHHhhhcCCCchhHhhhHHHHHHHHHHHHc-CCCEEEEeeeeeccCCCC
Q psy7542         213 KVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEA-GMPCMILRPSIIIPIWKD  291 (762)
Q Consensus       213 ~~i~E~~~~~p~~p~~~~~~~e~l~~e~l~~~tp~l~~~~pn~Y~~SK~~aE~lv~~~~~~-glpv~IvRPs~V~G~~~e  291 (762)
                      .+++|+....|.                             +.|+.||+.+|+++..+++. |++++|+||+.|||+...
T Consensus       161 ~~~~E~~~~~p~-----------------------------~~Y~~sK~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~  211 (351)
T 3ruf_A          161 LPKVEENIGNPL-----------------------------SPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQD  211 (351)
T ss_dssp             SSBCTTCCCCCC-----------------------------SHHHHHHHHHHHHHHHHHHHHCCCCEEEEECSEESTTCC
T ss_pred             CCCccCCCCCCC-----------------------------ChhHHHHHHHHHHHHHHHHHhCCCEEEEeeCceeCcCCC
Confidence            467776554443                             78999999999999998776 999999999999999765


Q ss_pred             CCCCCCCCCCCchHHHHHHhcCCeEEEeeCCCcccccccHHHHHHHHHHHhhcc-cCCCCCCceEEEecCCCCCcccHHH
Q psy7542         292 PLPGWTDNINGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNF-LSNPGNTMRVINLTANKDFQITWYD  370 (762)
Q Consensus       292 P~pGWidn~~gp~~li~~~~~G~l~~i~gd~~~~~d~VpVDdvA~aii~a~~~~-~~~~~~~~~iyNi~s~~~~piT~~e  370 (762)
                      +...|.   .....++..+..|....++++++..+++|+|||+|++++.++... ..    .+++||++++  .++|+.|
T Consensus       212 ~~~~~~---~~~~~~~~~~~~~~~~~~~g~g~~~~~~i~v~Dva~a~~~~~~~~~~~----~~~~~ni~~~--~~~s~~e  282 (351)
T 3ruf_A          212 PNGAYA---AVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSA----KDNIYNVAVG--DRTTLNE  282 (351)
T ss_dssp             CCSTTC---CHHHHHHHHHHHTCCCEEESSSCCEECCEEHHHHHHHHHHHHTCCGGG----CSEEEEESCS--CCEEHHH
T ss_pred             CCcchh---hHHHHHHHHHHcCCCcEEeCCCCeEEeeEEHHHHHHHHHHHHhhcccc----CCCEEEeCCC--CcccHHH
Confidence            432110   112345666778887788899999999999999999999998872 32    4789999999  8999999


Q ss_pred             HHHHHHHhhccCC-----CCccccccCCc----cc-----cc-cCCCchhhHHHHHHhhhhhhh
Q psy7542         371 IIENGKDIARNKV-----PLNNVLWYPGG----AM-----TN-RGYEPVLKRVHNRIKKGFDIF  419 (762)
Q Consensus       371 l~~~i~~~~G~~~-----P~~~~~w~p~~----~~-----~~-lG~kP~l~~l~~ki~~~~~~l  419 (762)
                      +++.+.+.+|...     +.....+.+..    ..     .. +||+|+. .+.+.+.+..+++
T Consensus       283 ~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~~lG~~p~~-~~~~~l~~~~~~~  345 (351)
T 3ruf_A          283 LSGYIYDELNLIHHIDKLSIKYREFRSGDVRHSQADVTKAIDLLKYRPNI-KIREGLRLSMPWY  345 (351)
T ss_dssp             HHHHHHHHHHTTCCC-----EEECCCTTCCSBCCBCCHHHHHHHCCCCCC-CHHHHHHHHHHHH
T ss_pred             HHHHHHHHhCcccccccccccccCCCCCccceeeeCHHHHHHHhCCCCCC-CHHHHHHHHHHHH
Confidence            9999999997621     11111111110    01     11 7888887 6777776655443



>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4az9_A Sorting nexin-24; protein transport; 1.75A {Homo sapiens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Back     alignment and structure
>2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Back     alignment and structure
>1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Back     alignment and structure
>1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Back     alignment and structure
>2v6v_A BUD emergence protein 1; homotypic fusion, regulator, PI3P, 3-kinase, PX domain, SH3 domain, cytoskeleton, cell polarity; 1.5A {Saccharomyces cerevisiae} PDB: 2czo_A Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 762
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-12
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 5e-12
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-10
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 2e-10
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-09
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 2e-09
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 2e-07
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 2e-07
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 3e-07
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 5e-07
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 6e-05
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-04
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-04
d1xtea_116 d.189.1.1 (A:) Serine/threonine-protein kinase Sgk 2e-04
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 3e-04
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 4e-04
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 6e-04
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 6e-04
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 7e-04
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.001
d1h6ha_143 d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo 0.002
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 0.003
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 0.003
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 0.004
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptococcus suis, serotype 2 [TaxId: 1307]
 Score = 67.7 bits (164), Expect = 1e-12
 Identities = 59/392 (15%), Positives = 116/392 (29%), Gaps = 53/392 (13%)

Query: 62  KNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKE 121
           KNI +TG +GF+G   +  +     +V + +L                    L  A  K 
Sbjct: 3   KNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVL------------------DKLTYAGNKA 44

Query: 122 QSESAIFEKVIPINGDVAVPDLGISAEDRQMLSETIHIVYHIAATVRFDDYMQTYVFLNT 181
             E+ + ++V  + GD+A  +L      +           H   ++   +    ++  N 
Sbjct: 45  NLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSL---NDPSPFIHTNF 101

Query: 182 RGTRDMLNLSKQMIHLQLFVYVSTAYCHPKEKVLEEKTYPPPVSPHNVIEKAELLSKNEL 241
            GT  +L  +++       V     Y                     + E      +   
Sbjct: 102 IGTYTLLEAARKYDIRFHHVSTDEVYG-----------------DLPLREDLPGHGEGPG 144

Query: 242 ELLKQELLQDFPNGYAYTKCLCEGVVTEYMEA-GMPCMILRPSIIIPIWKDPLPGWTDNI 300
           E    E   +  + Y+ TK   + +V  ++ + G+   I   S     ++         I
Sbjct: 145 EKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQI 204

Query: 301 NGPTGLLIGAGKGIIRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTA 360
                       GI   +Y +     D++  +    GV              +       
Sbjct: 205 T-------NILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKN 257

Query: 361 NKDFQITWYDIIENGKD-IARNKVPLNNVLWYPGG---AMTNRGYEPVLKRVHNRIKKGF 416
           NK+      + +   KD          + L Y           G+ P        +++  
Sbjct: 258 NKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEE-- 315

Query: 417 DIFEYYTKNSWSFKNENLHALRNMMNEKEAIR 448
              ++YT N   +K E      N    +E I+
Sbjct: 316 -TIQWYTDNQDWWKAEKEAVEANYAKTQEVIK 346


>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.98
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.98
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.98
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.97
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.97
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.97
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.97
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.97
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.97
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.97
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.96
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.96
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.96
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.95
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.95
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.95
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.92
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.91
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.9
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.87
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.87
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.87
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.86
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.86
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.85
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.74
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.6
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.58
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.57
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.57
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.55
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.54
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.54
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.54
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.54
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.54
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.53
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.53
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.53
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.53
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.53
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.53
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.52
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.51
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.51
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.51
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.51
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.5
d1xtea_116 Serine/threonine-protein kinase Sgk3, Cisk {Mouse 99.5
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.49
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.48
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.48
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.47
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.46
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.46
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.45
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.45
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.45
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.44
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.44
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.43
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.43
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.42
d1h6ha_143 p40phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.42
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.42
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.41
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.4
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.39
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.39
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.38
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.37
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.36
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.36
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.34
d1kmda_117 Vam7p {Baker's yeast (Saccharomyces cerevisiae) [T 99.34
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.34
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.32
d1kq6a_140 p47phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.31
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.31
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.3
d1ocsa_132 Sorting nexin grd19 {Baker's yeast (Saccharomyces 99.28
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.28
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.27
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.27
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.25
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.24
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.22
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.18
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.18
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.13
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.05
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 98.96
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.91
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.85
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.82
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.76
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.54
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.06
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.94
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.76
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.74
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.7
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.63
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.24
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.24
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.24
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.13
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.08
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.97
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 95.88
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.85
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.85
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.78
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.77
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.72
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.68
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.33
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.28
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 94.94
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.93
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.86
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.7
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.69
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.57
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.51
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 93.78
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.67
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.38
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.29
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.92
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.79
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.76
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.72
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.59
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 92.47
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.11
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 91.77
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.15
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 91.14
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 90.49
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.66
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 89.51
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 89.39
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 89.1
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 88.46
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 88.39
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.09
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 88.04
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 87.86
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 87.51
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.17
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 87.17
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.57
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.28
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 86.09
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 86.06
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.02
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 85.78
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 85.76
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 85.75
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 85.54
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.37
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 84.95
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.9
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 83.79
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 83.34
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 83.18
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 82.96
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 81.92
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.69
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 81.47
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 80.34
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=6.5e-33  Score=300.95  Aligned_cols=263  Identities=17%  Similarity=0.113  Sum_probs=194.2

Q ss_pred             CEEEEECCCChhHHHHHHHHHHcCCCcEEEEEeCCCCCcchHHHHHHHhcChhHHHHHhhhhcccccCCeEEEEeecCCC
Q psy7542          62 KNIFITGASGFVGKVLLEKILRTCENVKIYILLRPKKNKNSRERLEEIFQSPLYEALKKEQSESAIFEKVIPINGDVAVP  141 (762)
Q Consensus        62 k~VLVTGATGFLG~~LvekLL~~gp~v~V~~LvR~~~~~~~~eRl~~ll~~~~f~~l~~~~~~~~~~~kV~~V~GDl~~~  141 (762)
                      |.|||||||||||++|+++|++.  +.+|++++|..... ..+|++.+....           .....+++++.||+++.
T Consensus         2 K~vLITGatGfiGs~lv~~Ll~~--g~~V~~~~r~~~~~-~~~~~~~~~~~~-----------~~~~~~~~~~~~Dl~d~   67 (357)
T d1db3a_           2 KVALITGVTGQDGSYLAEFLLEK--GYEVHGIKRRASSF-NTERVDHIYQDP-----------HTCNPKFHLHYGDLSDT   67 (357)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHT--TCEEEEECC---------------------------------CCEEECCCCSSCH
T ss_pred             CEEEEeCCCcHHHHHHHHHHHHC--cCEEEEEECCCccc-chhhHHHHHhhh-----------hhcCCCeEEEEeecCCH
Confidence            78999999999999999999999  67889999965432 123443332211           22346899999999986


Q ss_pred             CCCCCHHHHHhhcCCc--cEEEEcccccCcc---ccHHHHHHHhHHHHHHHHHHHHHc--CCccEEEEEeCCcccC--CC
Q psy7542         142 DLGISAEDRQMLSETI--HIVYHIAATVRFD---DYMQTYVFLNTRGTRDMLNLSKQM--IHLQLFVYVSTAYCHP--KE  212 (762)
Q Consensus       142 ~LGLs~~~l~~l~~~v--DiViH~AA~v~f~---~~l~~~~~~NV~GT~~LLelA~~~--~~lk~fV~vSSay~~~--~~  212 (762)
                      .      +++++++++  |+|||+||.....   ++....+++|+.||.+||++|++.  ++.++|||+||+.+++  ..
T Consensus        68 ~------~~~~~~~~~~~d~v~h~aa~~~~~~~~~~~~~~~~~Nv~gt~nllea~~~~~~~~~~r~i~~SS~~vYG~~~~  141 (357)
T d1db3a_          68 S------NLTRILREVQPDEVYNLGAMSHVAVSFESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELYGLVQE  141 (357)
T ss_dssp             H------HHHHHHHHHCCSEEEECCCCCTTTTTTSCHHHHHHHHTHHHHHHHHHHHHTTCTTTCEEEEEEEGGGGTTCCS
T ss_pred             H------HHHHHHhccCCCEEEEeecccccchhhhCHHHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEEEchhhhCCCCC
Confidence            6      788888754  9999999986543   445668899999999999999986  2445899999985543  44


Q ss_pred             cccccccCCCCCChhhHHHHHHhhhHHHHHHHHHhhhcCCCchhHhhhHHHHHHHHHHHHc-CCCEEEEeeeeeccCCCC
Q psy7542         213 KVLEEKTYPPPVSPHNVIEKAELLSKNELELLKQELLQDFPNGYAYTKCLCEGVVTEYMEA-GMPCMILRPSIIIPIWKD  291 (762)
Q Consensus       213 ~~i~E~~~~~p~~p~~~~~~~e~l~~e~l~~~tp~l~~~~pn~Y~~SK~~aE~lv~~~~~~-glpv~IvRPs~V~G~~~e  291 (762)
                      .+++|+....|.                             +.|+.||+++|.++..+++. +++++++||++|||+...
T Consensus       142 ~~~~E~~~~~P~-----------------------------~~Y~~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~  192 (357)
T d1db3a_         142 IPQKETTPFYPR-----------------------------SPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRRG  192 (357)
T ss_dssp             SSBCTTSCCCCC-----------------------------SHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCEECTTSC
T ss_pred             CCcCCCCCCCCC-----------------------------ChHHHHHHHHHHHHHHHHHHhCCCEEEEEeccccCCCCC
Confidence            578887655554                             78999999999999999887 999999999999998643


Q ss_pred             CCCCCCCCCCCchHHHHHHhcCC-eEEEeeCCCcccccccHHHHHHHHHHHhhcccCCCCCCceEEEecCCCCCcccHHH
Q psy7542         292 PLPGWTDNINGPTGLLIGAGKGI-IRTMYCDYSTCADFLPVDVLVNGVLLSTWNFLSNPGNTMRVINLTANKDFQITWYD  370 (762)
Q Consensus       292 P~pGWidn~~gp~~li~~~~~G~-l~~i~gd~~~~~d~VpVDdvA~aii~a~~~~~~~~~~~~~iyNi~s~~~~piT~~e  370 (762)
                      +..    ........+.....|. .....|++++.+|+++|+|+|++++.++....      +++||++++  +++|+.|
T Consensus       193 ~~~----~~~~i~~~~~~~~~~~~~~~~~g~~~~~r~~~~v~D~~~a~~~~~~~~~------~~~yni~sg--~~~s~~~  260 (357)
T d1db3a_         193 ETF----VTRKITRAIANIAQGLESCLYLGNMDSLRDWGHAKDYVKMQWMMLQQEQ------PEDFVIATG--VQYSVRQ  260 (357)
T ss_dssp             TTS----HHHHHHHHHHHHHTTSCCCEEESCTTCEECCEEHHHHHHHHHHTTSSSS------CCCEEECCC--CCEEHHH
T ss_pred             cCC----CchHHHHHHHHHHhCCCceEEECCCCeeecceeechHHHHHHHHHhCCC------CCeEEECCC--CceehHH
Confidence            210    0001122333444444 34567899999999999999999999886542      479999999  8999999


Q ss_pred             HHHHHHHhhccCCCC
Q psy7542         371 IIENGKDIARNKVPL  385 (762)
Q Consensus       371 l~~~i~~~~G~~~P~  385 (762)
                      +++.+.+..|...++
T Consensus       261 ~~~~~~~~~g~~~~~  275 (357)
T d1db3a_         261 FVEMAAAQLGIKLRF  275 (357)
T ss_dssp             HHHHHHHTTTEEEEE
T ss_pred             HHHHHHHHhCCcccc
Confidence            999999999755443



>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure