Psyllid ID: psy7603


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MDSDEDTSYVDSGNESSSDDIGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
cccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccccHHHcccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHcccccEEEEcccccccccEEEccccccccccEEEEcc
mdsdedtsyvdsgnesssddIGYAMEVenqnpkdrqnDVEEFVFEVLSTEEIVQHMIDCIKEvnnvveipaTTTRILLNHFKWDKEKLMERyydgdqesstldysastssglvfsavdfgsggswfefkr
mdsdedtsyvdsgnesssddigYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
MDSDEDTSYVDSGNESSSDDIGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQEsstldysastssGLVFSAVDFGSGGSWFEFKR
***************************************EEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYD****************GLVFSAVDFGSGGSWF****
MDSDEDTS*********SDDIGYAM*****************VFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
*****************SDDIGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
***************************************EEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSDEDTSYVDSGNESSSDDIGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTSSGLVFSAVDFGSGGSWFEFKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q6NW85 533 E3 ubiquitin-protein liga yes N/A 0.730 0.178 0.438 2e-19
Q6PFJ9 527 E3 ubiquitin-protein liga no N/A 0.453 0.111 0.661 6e-19
Q94981 503 Protein ariadne-1 OS=Dros yes N/A 0.723 0.186 0.494 8e-19
Q32NS4 529 E3 ubiquitin-protein liga N/A N/A 0.453 0.111 0.644 1e-18
Q9Y4X5 557 E3 ubiquitin-protein liga yes N/A 0.453 0.105 0.644 1e-18
Q9Z1K5 555 E3 ubiquitin-protein liga yes N/A 0.453 0.106 0.644 1e-18
A2VEA3 555 E3 ubiquitin-protein liga yes N/A 0.453 0.106 0.644 1e-18
B1H1E4 529 E3 ubiquitin-protein liga yes N/A 0.446 0.109 0.637 2e-18
Q6T486 520 Probable E3 ubiquitin-pro yes N/A 0.676 0.169 0.378 1e-05
>sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 74/130 (56%), Gaps = 35/130 (26%)

Query: 1   MDSDEDTSY----------------VDSGNESSSDDIGYAMEVENQNPK----------- 33
           MDSDE  +Y                VDSG E + DD     EVE  +P            
Sbjct: 1   MDSDEGYNYEFDDEEEEEEEEEECSVDSGEEEAVDDSLELGEVELLDPAVAGGEPDDCAD 60

Query: 34  -------DRQNDVEEFVFEVLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKE 86
                    Q D E++ FEVL+TE+I+QHM++CI++VN V++ PAT TRILL+HF WDKE
Sbjct: 61  TGGGGPGPGQED-EDYRFEVLTTEQILQHMVECIRDVNEVIQNPATITRILLSHFNWDKE 119

Query: 87  KLMERYYDGD 96
           KLMERY+DG+
Sbjct: 120 KLMERYFDGN 129




E3 ubiquitin-protein ligase, which catalyzes polyubiquitination of target proteins together with ubiquitin-conjugating enzyme E2 ube2l3.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 Back     alignment and function description
>sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 Back     alignment and function description
>sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=2 SV=3 Back     alignment and function description
>sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 Back     alignment and function description
>sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 Back     alignment and function description
>sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
332029156 495 Protein ariadne-1-like protein [Acromyrm 0.753 0.197 0.77 2e-37
307181827 509 Protein ariadne-1 [Camponotus floridanus 0.753 0.192 0.77 3e-37
322797457 493 hypothetical protein SINV_05140 [Solenop 0.753 0.198 0.77 3e-37
345485088 510 PREDICTED: E3 ubiquitin-protein ligase a 0.753 0.192 0.75 1e-36
307214633 510 Protein ariadne-1 [Harpegnathos saltator 0.753 0.192 0.76 1e-36
242016336 506 protein ariadne-1, putative [Pediculus h 0.753 0.193 0.74 2e-35
48138658 509 PREDICTED: protein ariadne-1 homolog [Ap 0.753 0.192 0.757 2e-35
383849296 508 PREDICTED: E3 ubiquitin-protein ligase a 0.753 0.192 0.747 8e-35
350401290 509 PREDICTED: E3 ubiquitin-protein ligase a 0.753 0.192 0.747 3e-34
340720568 509 PREDICTED: e3 ubiquitin-protein ligase A 0.753 0.192 0.747 3e-34
>gi|332029156|gb|EGI69167.1| Protein ariadne-1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 2/100 (2%)

Query: 1   MDSDEDTSY--VDSGNESSSDDIGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQHMID 58
           MDS+E+T Y  VDSGNESS DD+ +AME+E+ NP++R  DV+E+ FEVLSTEEIVQHM+D
Sbjct: 1   MDSEEETLYDDVDSGNESSGDDVDFAMEIESGNPRERATDVDEYPFEVLSTEEIVQHMVD 60

Query: 59  CIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQE 98
            IKEVN VVEIPATTTRILLNHFKWDKEKLMER+YDGDQE
Sbjct: 61  SIKEVNTVVEIPATTTRILLNHFKWDKEKLMERFYDGDQE 100




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307181827|gb|EFN69270.1| Protein ariadne-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322797457|gb|EFZ19528.1| hypothetical protein SINV_05140 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345485088|ref|XP_001607592.2| PREDICTED: E3 ubiquitin-protein ligase arih1l-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307214633|gb|EFN89583.1| Protein ariadne-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242016336|ref|XP_002428785.1| protein ariadne-1, putative [Pediculus humanus corporis] gi|212513470|gb|EEB16047.1| protein ariadne-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|48138658|ref|XP_396912.1| PREDICTED: protein ariadne-1 homolog [Apis mellifera] gi|380027774|ref|XP_003697593.1| PREDICTED: E3 ubiquitin-protein ligase arih1l-like [Apis florea] Back     alignment and taxonomy information
>gi|383849296|ref|XP_003700281.1| PREDICTED: E3 ubiquitin-protein ligase arih1l-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350401290|ref|XP_003486110.1| PREDICTED: E3 ubiquitin-protein ligase arih1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720568|ref|XP_003398706.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 1 [Bombus terrestris] gi|340720570|ref|XP_003398707.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 2 [Bombus terrestris] gi|340720572|ref|XP_003398708.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0017418 503 ari-1 "ariadne" [Drosophila me 0.753 0.194 0.504 4.4e-22
RGD|1308131 381 Arih1 "ariadne homolog, ubiqui 0.453 0.154 0.644 1.5e-21
UNIPROTKB|A2VEA3 555 ARIH1 "E3 ubiquitin-protein li 0.453 0.106 0.644 2.9e-21
UNIPROTKB|Q9Y4X5 557 ARIH1 "E3 ubiquitin-protein li 0.453 0.105 0.644 2.9e-21
ZFIN|ZDB-GENE-030131-5213 527 arih1 "ariadne ubiquitin-conju 0.453 0.111 0.661 3.5e-21
ZFIN|ZDB-GENE-040426-2395 533 arih1l "ariadne homolog, ubiqu 0.492 0.120 0.630 3.6e-21
MGI|MGI:1344363 555 Arih1 "ariadne ubiquitin-conju 0.453 0.106 0.644 1.6e-20
UNIPROTKB|B1H1E4 529 arih1 "E3 ubiquitin-protein li 0.453 0.111 0.644 3.3e-20
UNIPROTKB|Q32NS4 529 arih1 "E3 ubiquitin-protein li 0.453 0.111 0.644 5.3e-20
UNIPROTKB|F1PG97 554 ARIH1 "Uncharacterized protein 0.446 0.104 0.644 5.8e-20
FB|FBgn0017418 ari-1 "ariadne" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 4.4e-22, P = 4.4e-22
 Identities = 52/103 (50%), Positives = 73/103 (70%)

Query:     1 MDSDEDTSY---VDSGNESSSDD--IGYAMEVENQNPKDRQNDVEEFVFEVLSTEEIVQH 55
             MDSD D  +   VDSGN SS DD    + MEV+  +  DRQ D +++ ++VL+T+EIVQH
Sbjct:     1 MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQH 60

Query:    56 MIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQE 98
               + I E N ++++P  TTRILLNHFKWDKEKL+E+Y+D + +
Sbjct:    61 QREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTD 103




GO:0005737 "cytoplasm" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0042787 "protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
RGD|1308131 Arih1 "ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A2VEA3 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4X5 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5213 arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2395 arih1l "ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1344363 Arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B1H1E4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q32NS4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1PG97 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4X5ARI1_HUMAN6, ., 3, ., 2, ., -0.64400.45380.1059yesN/A
Q9Z1K5ARI1_MOUSE6, ., 3, ., 2, ., -0.64400.45380.1063yesN/A
A2VEA3ARI1_BOVIN6, ., 3, ., 2, ., -0.64400.45380.1063yesN/A
B1H1E4ARI1_XENTR6, ., 3, ., 2, ., -0.63790.44610.1096yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG1815|consensus 444 98.95
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 98.04
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 92.73
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 92.56
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 92.08
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 91.55
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 89.43
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 86.63
smart0054643 CUE Domain that may be involved in binding ubiquit 81.04
>KOG1815|consensus Back     alignment and domain information
Probab=98.95  E-value=1.3e-09  Score=93.57  Aligned_cols=77  Identities=30%  Similarity=0.456  Sum_probs=71.2

Q ss_pred             EecHHHHHHHHHHHHHHHhhhhCCCHHHHHHHHHhCCCChHHHHHHHhcCChhhHHHHcCCCCC---CcceeeeeecccC
Q psy7603          46 VLSTEEIVQHMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQESSTLDYSASTS---SGLVFSAVDFGSG  122 (130)
Q Consensus        46 vLs~~eI~~~~~e~I~~V~~iL~vs~~~A~lLL~~fkWn~ekLlE~y~e~D~~kvl~~aGl~~~---~~~v~~~~~~~~~  122 (130)
                      +|+.++|...|.+.|..|+++|++++.+|++||.||+|++++|+++|++ +++.++...|+...   .+.+.+..|+++-
T Consensus         2 vl~~~~~~~~~~~~i~~~~~~ls~~~~~~~~ll~~~~W~~~kl~~~~~~-~~~~~~~~~g~~~~~~~~~~~~c~ic~~~~   80 (444)
T KOG1815|consen    2 VLTPDDIAALMREDIIEVSDILSLSHAVARILLAHFCWNVEKLLEEWVE-DEETGCFFVGLLLWPKKKGDVQCGICVESY   80 (444)
T ss_pred             CCchHhhhHHhHhhHHHHHHhhcCCHHHHHHHHHhcCcchHHHHHHHHh-cCcchhhhccccccCCCCccccCCcccCCC
Confidence            6889999999999999999999999999999999999999999999999 99999999997654   6778888888876


Q ss_pred             C
Q psy7603         123 G  123 (130)
Q Consensus       123 ~  123 (130)
                      .
T Consensus        81 ~   81 (444)
T KOG1815|consen   81 D   81 (444)
T ss_pred             c
Confidence            4



>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 97.66
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 97.43
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 96.96
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 96.91
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 96.3
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 95.67
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 95.49
2di0_A71 Activating signal cointegrator 1 complex subunit 2 94.91
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 94.42
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 93.87
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 93.12
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 93.09
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 93.04
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 92.74
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 92.07
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 90.95
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 90.12
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 89.92
1wji_A63 Tudor domain containing protein 3; UBA domain, str 88.99
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 88.42
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 88.37
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 87.49
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 87.41
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 86.14
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 85.43
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 85.17
4ddj_A83 Saposin-A, protein A; saposin fold, sphingolipid a 85.1
4gew_A 362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 84.93
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 84.76
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 84.62
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 83.46
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 81.63
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 81.2
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 80.95
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 80.84
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 80.12
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
Probab=97.66  E-value=8.7e-05  Score=43.75  Aligned_cols=41  Identities=22%  Similarity=0.457  Sum_probs=37.6

Q ss_pred             HHHHHHHHhhhhCCCHHHHHHHHHhCCCChHHHHHHHhcCCh
Q psy7603          56 MIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYDGDQ   97 (130)
Q Consensus        56 ~~e~I~~V~~iL~vs~~~A~lLL~~fkWn~ekLlE~y~e~D~   97 (130)
                      +.+.|.+-++|+++++..|+-+|..++||.+.-+..||+ +|
T Consensus         5 ~~~~i~~F~~iTg~~~~~A~~~L~~~~wdle~Ai~~ff~-~~   45 (46)
T 1v92_A            5 RQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYE-DG   45 (46)
T ss_dssp             HHHHHHHHHHHTCCCHHHHHHHHHHTTSCSHHHHHHHHH-TC
T ss_pred             HHHHHHHHHHHhCcCHHHHHHHHHHcCCCHHHHHHHHHc-CC
Confidence            456799999999999999999999999999999999998 54



>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 97.6
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 93.17
d2di0a163 Activating signal cointegrator 1 complex subunit 2 89.98
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 89.72
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 87.12
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 81.33
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: TAP-C domain-like
domain: NSFL1 (p97 ATPase) cofactor p47, UBA-like domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.60  E-value=5.5e-05  Score=44.12  Aligned_cols=40  Identities=20%  Similarity=0.441  Sum_probs=37.7

Q ss_pred             HHHHHHHHHhhhhCCCHHHHHHHHHhCCCChHHHHHHHhc
Q psy7603          55 HMIDCIKEVNNVVEIPATTTRILLNHFKWDKEKLMERYYD   94 (130)
Q Consensus        55 ~~~e~I~~V~~iL~vs~~~A~lLL~~fkWn~ekLlE~y~e   94 (130)
                      .+.+.|.+-++|+++++..|+-.|...+||.+.-+..||+
T Consensus         4 ~~~~lI~qF~~iTg~~~~~A~~~Le~~~w~Le~Ai~~yfe   43 (46)
T d1v92a_           4 ERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYE   43 (46)
T ss_dssp             HHHHHHHHHHHHTCCCHHHHHHHHHHTTSCSHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHCcCHHHHHHHHHHcCCcHHHHHHHHHh
Confidence            3567899999999999999999999999999999999998



>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure