Psyllid ID: psy7782


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGAGSNSDKKDDKDKKKKYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT
ccHHHHHHHHHHHHHcccccHHHHHHHccccccEEEEEcccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEcccccEEEEEEcccccccccccccEEEEcccccEEEEEcccccccccc
ccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHEEEEccHHHHHHHccccccccccccHHHHHHHHHHHcccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEcHHHHHccccEEEEccccccEEEEEEEEccHHHcccccEEEEEccccEEEEEcccccccccc
MSLDVQIQEIKesvelplthpeyyeemgikppkgvilygppgtgktlpfspalgyhyycrgagsnsdkkddkdkkkkyeppiptrvgkkkrkakgpdaaiklpqvtphtkcRLKLLKLERIKDYLLMEEEFIRNqerlkpqeekneeersrvddlrgtpmsvgtleeiiddnhaiVSTSVGSEHYVSILSfvdkdqlepgcsvllnHKVHAVVgvlsddtdpmvt
MSLDVQIQEikesvelplthpeyYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGagsnsdkkddkdkkkkyeppiptrvgkkkrkakgpdaaiklpqvtphtkcrlkllkLERIKDYLLMEEEFirnqerlkpqeekneeersrvddlrgtpMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHavvgvlsddtdpmvt
MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGAGSNSdkkddkdkkkkYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT
****************PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCR*******************************************QVTPHTKCRLKLLKLERIKDYLLMEEEFI******************************GTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVL*********
*S*DVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGY*************************************************VTPHTKCRLKLLKLERIKDYLLMEEEF**********************DLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDD*DP***
MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGAG*************KYEPPIPTR***********DAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLK***************LRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT
MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGAGSNSDKKDDKDKKKKYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSD*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFSPALGYHYYCRGAGSNSDKKDDKDKKKKYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
FB|FBgn0015282 439 Rpt2 "Regulatory particle trip 0.657 0.337 0.945 5.9e-73
UNIPROTKB|F1NSP7 439 PSMC1 "26S protease regulatory 0.657 0.337 0.898 6.3e-69
UNIPROTKB|F1NTZ4 438 PSMC1 "26S protease regulatory 0.657 0.337 0.898 6.3e-69
UNIPROTKB|A4FUZ3 440 PSMC1 "Proteasome (Prosome, ma 0.657 0.336 0.898 6.3e-69
UNIPROTKB|F1PQ40 440 PSMC1 "Uncharacterized protein 0.657 0.336 0.898 6.3e-69
UNIPROTKB|P62191 440 PSMC1 "26S protease regulatory 0.657 0.336 0.898 6.3e-69
UNIPROTKB|F2Z5J1 440 PSMC1 "Uncharacterized protein 0.657 0.336 0.898 6.3e-69
MGI|MGI:106054 440 Psmc1 "protease (prosome, macr 0.657 0.336 0.898 6.3e-69
RGD|621097 440 Psmc1 "proteasome (prosome, ma 0.657 0.336 0.898 6.3e-69
UNIPROTKB|Q90732 440 PSMC1 "26S protease regulatory 0.657 0.336 0.891 3.5e-68
FB|FBgn0015282 Rpt2 "Regulatory particle triple-A ATPase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 737 (264.5 bits), Expect = 5.9e-73, P = 5.9e-73
 Identities = 140/148 (94%), Positives = 147/148 (99%)

Query:    78 YEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQER 137
             YEPPIPTRVGKKKR+AKGPDAA+KLPQVTPHT+CRLKLLKLERIKDYL+ME+EFIRNQER
Sbjct:    24 YEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQER 83

Query:   138 LKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQL 197
             LKPQ+EKNEEERS+VDDLRGTPMSVG LEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQL
Sbjct:    84 LKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQL 143

Query:   198 EPGCSVLLNHKVHAVVGVLSDDTDPMVT 225
             EPGCSVLLNHKVHAVVGVLSDDTDPMVT
Sbjct:   144 EPGCSVLLNHKVHAVVGVLSDDTDPMVT 171


GO:0006508 "proteolysis" evidence=ISS;IDA;NAS
GO:0000502 "proteasome complex" evidence=NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=NAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=ISS
GO:0004175 "endopeptidase activity" evidence=IDA
GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0030163 "protein catabolic process" evidence=IEA
GO:0009987 "cellular process" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0006974 "response to DNA damage stimulus" evidence=IMP
UNIPROTKB|F1NSP7 PSMC1 "26S protease regulatory subunit 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTZ4 PSMC1 "26S protease regulatory subunit 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUZ3 PSMC1 "Proteasome (Prosome, macropain) 26S subunit, ATPase, 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ40 PSMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62191 PSMC1 "26S protease regulatory subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5J1 PSMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:106054 Psmc1 "protease (prosome, macropain) 26S subunit, ATPase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621097 Psmc1 "proteasome (prosome, macropain) 26S subunit, ATPase, 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q90732 PSMC1 "26S protease regulatory subunit 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 4e-86
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-32
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-24
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-23
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 8e-23
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-19
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 6e-19
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 8e-19
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 5e-17
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-14
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 1e-14
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-14
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-13
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-13
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 3e-11
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-09
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 5e-08
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-05
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.001
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 0.002
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 0.004
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
 Score =  261 bits (668), Expect = 4e-86
 Identities = 114/165 (69%), Positives = 139/165 (84%)

Query: 61  GAGSNSDKKDDKDKKKKYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLER 120
           G G+N   K+ K +KKK E P P    K+K+K KGPDAA KLP+VTP+TKCRL+LLKLER
Sbjct: 6   GQGNNQKDKNKKKEKKKKESPPPPHEIKRKKKRKGPDAASKLPKVTPNTKCRLRLLKLER 65

Query: 121 IKDYLLMEEEFIRNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSV 180
           IKDYLL+EEEFI NQE  KP +EKNE E  +VDDLRG+P+SVGTLEEIID+NHAIVS+SV
Sbjct: 66  IKDYLLLEEEFITNQEAQKPAQEKNEAELKKVDDLRGSPLSVGTLEEIIDENHAIVSSSV 125

Query: 181 GSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT 225
           G E+YV+ILSFVDK+QLEPGCSVLL++K H+VVG+L D+ DP+V+
Sbjct: 126 GPEYYVNILSFVDKEQLEPGCSVLLHNKTHSVVGILLDEVDPLVS 170


Length = 438

>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG0726|consensus 440 99.97
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.95
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.94
KOG0730|consensus693 99.91
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.9
KOG0733|consensus 802 99.89
KOG0731|consensus 774 99.89
KOG0736|consensus953 99.88
KOG0734|consensus 752 99.88
KOG0727|consensus408 99.87
KOG0726|consensus440 99.85
KOG0733|consensus 802 99.85
KOG0728|consensus404 99.84
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.84
KOG0652|consensus424 99.83
KOG0727|consensus 408 99.82
KOG0735|consensus 952 99.8
KOG0739|consensus439 99.79
KOG0738|consensus491 99.76
KOG0651|consensus388 99.74
KOG0729|consensus435 99.73
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.73
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.71
KOG0737|consensus386 99.67
KOG0728|consensus 404 99.65
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.65
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.65
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.62
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.6
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.57
PRK03992389 proteasome-activating nucleotidase; Provisional 99.56
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.56
KOG0732|consensus 1080 99.54
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.5
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.48
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.47
CHL00206 2281 ycf2 Ycf2; Provisional 99.46
KOG0741|consensus 744 99.45
CHL00195489 ycf46 Ycf46; Provisional 99.44
CHL00176 638 ftsH cell division protein; Validated 99.44
KOG0743|consensus457 99.41
KOG0652|consensus 424 99.4
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.39
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.38
KOG0740|consensus428 99.38
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.35
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.3
KOG0730|consensus 693 99.26
KOG0651|consensus 388 98.96
CHL00181287 cbbX CbbX; Provisional 98.85
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.76
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.75
PF00004132 AAA: ATPase family associated with various cellula 98.71
KOG0729|consensus 435 98.64
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 98.57
KOG0742|consensus630 98.57
KOG0744|consensus423 98.42
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.39
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.35
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.35
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.26
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.2
KOG2004|consensus 906 98.19
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.13
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.0
PRK04195 482 replication factor C large subunit; Provisional 97.99
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 97.97
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.96
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.9
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.86
KOG0989|consensus346 97.85
KOG2028|consensus 554 97.85
PRK13342 413 recombination factor protein RarA; Reviewed 97.84
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.83
CHL00095 821 clpC Clp protease ATP binding subunit 97.81
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.77
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.77
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.76
PLN03025319 replication factor C subunit; Provisional 97.71
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.71
COG0606490 Predicted ATPase with chaperone activity [Posttran 97.68
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.65
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 97.62
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.6
KOG0736|consensus 953 97.58
KOG0735|consensus 952 97.57
PRK12402 337 replication factor C small subunit 2; Reviewed 97.57
smart00382148 AAA ATPases associated with a variety of cellular 97.56
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.55
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 97.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.54
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.52
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.52
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.51
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.5
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.47
PHA02544316 44 clamp loader, small subunit; Provisional 97.47
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.46
PRK10865 857 protein disaggregation chaperone; Provisional 97.45
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.43
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.43
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.4
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.4
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.4
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.36
PRK15455 644 PrkA family serine protein kinase; Provisional 97.35
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.34
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.33
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.33
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.33
KOG0741|consensus744 97.32
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.28
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.27
PRK13341 725 recombination factor protein RarA/unknown domain f 97.27
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.27
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.26
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 97.25
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.24
PRK06620214 hypothetical protein; Validated 97.23
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.23
PRK00440319 rfc replication factor C small subunit; Reviewed 97.22
PRK00131175 aroK shikimate kinase; Reviewed 97.22
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.22
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 97.21
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.21
PRK06893229 DNA replication initiation factor; Validated 97.21
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.2
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.19
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.19
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.18
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.17
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.16
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.16
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.14
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.14
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.13
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.13
PRK06526254 transposase; Provisional 97.12
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.11
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.11
PRK12377248 putative replication protein; Provisional 97.1
PHA02244383 ATPase-like protein 97.09
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.09
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.09
PRK08939306 primosomal protein DnaI; Reviewed 97.08
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.08
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.07
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.07
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.05
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 97.05
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.04
PRK08084235 DNA replication initiation factor; Provisional 97.03
PRK08181269 transposase; Validated 97.02
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.02
PRK08118167 topology modulation protein; Reviewed 97.01
PRK06835329 DNA replication protein DnaC; Validated 96.99
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.96
PRK06921266 hypothetical protein; Provisional 96.95
PRK08116268 hypothetical protein; Validated 96.95
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.94
CHL00095821 clpC Clp protease ATP binding subunit 96.92
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 96.92
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.9
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.89
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.88
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.87
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.85
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.85
PRK00411 394 cdc6 cell division control protein 6; Reviewed 96.84
PRK13531 498 regulatory ATPase RavA; Provisional 96.84
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.83
PRK07952244 DNA replication protein DnaC; Validated 96.82
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 96.82
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.81
PRK07471 365 DNA polymerase III subunit delta'; Validated 96.8
PRK10865857 protein disaggregation chaperone; Provisional 96.78
KOG1803|consensus 649 96.77
PRK14532188 adenylate kinase; Provisional 96.76
PHA00729226 NTP-binding motif containing protein 96.75
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 96.75
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 96.75
PRK09183259 transposase/IS protein; Provisional 96.74
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.72
PF13479213 AAA_24: AAA domain 96.7
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.7
PRK03839180 putative kinase; Provisional 96.69
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.69
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.68
PRK13947171 shikimate kinase; Provisional 96.67
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.66
PRK05564313 DNA polymerase III subunit delta'; Validated 96.65
PRK14531183 adenylate kinase; Provisional 96.64
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.63
PRK09112 351 DNA polymerase III subunit delta'; Validated 96.63
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.63
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 96.58
PRK13949169 shikimate kinase; Provisional 96.58
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.57
PRK00149 450 dnaA chromosomal replication initiation protein; R 96.57
PRK05642234 DNA replication initiation factor; Validated 96.56
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.56
COG0714329 MoxR-like ATPases [General function prediction onl 96.54
KOG1969|consensus 877 96.54
KOG1942|consensus 456 96.53
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.53
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.52
PRK07261171 topology modulation protein; Provisional 96.51
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.51
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.5
PRK14088 440 dnaA chromosomal replication initiation protein; P 96.5
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.49
PF1324576 AAA_19: Part of AAA domain 96.47
PRK00625173 shikimate kinase; Provisional 96.46
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.46
PHA02624647 large T antigen; Provisional 96.45
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.44
PRK12422 445 chromosomal replication initiation protein; Provis 96.43
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.42
KOG3347|consensus176 96.4
PF07726131 AAA_3: ATPase family associated with various cellu 96.4
KOG0991|consensus333 96.4
PRK14527191 adenylate kinase; Provisional 96.39
PTZ00088229 adenylate kinase 1; Provisional 96.38
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.38
PRK06217183 hypothetical protein; Validated 96.37
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.35
PRK08727233 hypothetical protein; Validated 96.34
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.34
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.33
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.33
PRK07399314 DNA polymerase III subunit delta'; Validated 96.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.3
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.3
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.26
PRK14526211 adenylate kinase; Provisional 96.22
PLN02200234 adenylate kinase family protein 96.21
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.21
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 96.2
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.2
PRK04328249 hypothetical protein; Provisional 96.2
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.19
PRK14530215 adenylate kinase; Provisional 96.19
cd01394218 radB RadB. The archaeal protein radB shares simila 96.18
PRK01184184 hypothetical protein; Provisional 96.17
PRK14528186 adenylate kinase; Provisional 96.16
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.14
PRK13948182 shikimate kinase; Provisional 96.12
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.09
PRK02496184 adk adenylate kinase; Provisional 96.09
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.08
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 96.07
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.07
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.07
PRK05057172 aroK shikimate kinase I; Reviewed 96.06
PF05729166 NACHT: NACHT domain 96.05
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 96.04
PLN02674244 adenylate kinase 96.03
PRK00279215 adk adenylate kinase; Reviewed 96.03
PHA02774613 E1; Provisional 96.02
PRK13765 637 ATP-dependent protease Lon; Provisional 96.02
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.0
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.99
PRK06547172 hypothetical protein; Provisional 95.97
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 95.97
PRK08058 329 DNA polymerase III subunit delta'; Validated 95.92
PRK08356195 hypothetical protein; Provisional 95.91
PRK14738206 gmk guanylate kinase; Provisional 95.91
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.9
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.9
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.9
PRK09087226 hypothetical protein; Validated 95.86
PRK06067234 flagellar accessory protein FlaH; Validated 95.86
PRK04040188 adenylate kinase; Provisional 95.84
PRK13946184 shikimate kinase; Provisional 95.83
PRK05973237 replicative DNA helicase; Provisional 95.82
KOG1970|consensus 634 95.82
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.81
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.8
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 95.78
PRK06762166 hypothetical protein; Provisional 95.77
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.76
PRK03731171 aroL shikimate kinase II; Reviewed 95.75
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.74
PRK00771 437 signal recognition particle protein Srp54; Provisi 95.71
smart00350509 MCM minichromosome maintenance proteins. 95.71
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.69
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.68
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.67
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.66
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.66
PRK10416318 signal recognition particle-docking protein FtsY; 95.65
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 95.61
TIGR00064272 ftsY signal recognition particle-docking protein F 95.61
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.6
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 95.59
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.56
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.53
PRK00300205 gmk guanylate kinase; Provisional 95.53
PRK08233182 hypothetical protein; Provisional 95.52
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 95.51
PHA02530 300 pseT polynucleotide kinase; Provisional 95.49
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 95.48
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.48
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.44
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 95.44
KOG0990|consensus 360 95.41
PLN02459261 probable adenylate kinase 95.41
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.39
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.39
PRK09354349 recA recombinase A; Provisional 95.39
COG4525259 TauB ABC-type taurine transport system, ATPase com 95.37
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.34
PRK10536262 hypothetical protein; Provisional 95.32
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 95.31
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.31
COG1855 604 ATPase (PilT family) [General function prediction 95.31
PRK05541176 adenylylsulfate kinase; Provisional 95.3
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.26
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.25
COG4178604 ABC-type uncharacterized transport system, permeas 95.25
PRK13808 333 adenylate kinase; Provisional 95.24
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.23
PTZ00112 1164 origin recognition complex 1 protein; Provisional 95.22
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.21
TIGR00376 637 DNA helicase, putative. The gene product may repre 95.21
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.2
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.18
PRK11608326 pspF phage shock protein operon transcriptional ac 95.18
PF13173128 AAA_14: AAA domain 95.18
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.13
PRK14529223 adenylate kinase; Provisional 95.12
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 95.12
PRK09825176 idnK D-gluconate kinase; Provisional 95.12
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.12
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.11
PRK05707 328 DNA polymerase III subunit delta'; Validated 95.08
COG4619223 ABC-type uncharacterized transport system, ATPase 95.08
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.06
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.06
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 95.06
PRK08699 325 DNA polymerase III subunit delta'; Validated 95.03
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.03
PRK14086 617 dnaA chromosomal replication initiation protein; P 94.98
PRK13764 602 ATPase; Provisional 94.97
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 94.96
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.95
PRK15429686 formate hydrogenlyase transcriptional activator Fh 94.94
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 94.94
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 94.94
PRK04182180 cytidylate kinase; Provisional 94.93
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.92
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 94.92
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 94.9
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.9
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.89
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 94.86
PRK05480209 uridine/cytidine kinase; Provisional 94.85
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.79
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.76
PRK05022509 anaerobic nitric oxide reductase transcription reg 94.76
PRK10867 433 signal recognition particle protein; Provisional 94.75
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.75
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.75
PRK15424538 propionate catabolism operon regulatory protein Pr 94.7
PRK06696223 uridine kinase; Validated 94.7
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 94.69
cd03115173 SRP The signal recognition particle (SRP) mediates 94.67
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 94.65
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 94.63
PF1355562 AAA_29: P-loop containing region of AAA domain 94.62
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.61
cd01128249 rho_factor Transcription termination factor rho is 94.6
COG1221 403 PspF Transcriptional regulators containing an AAA- 94.59
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.58
PRK00889175 adenylylsulfate kinase; Provisional 94.58
PRK11823 446 DNA repair protein RadA; Provisional 94.58
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.57
KOG0060|consensus659 94.52
KOG2680|consensus 454 94.51
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 94.5
PRK09302 509 circadian clock protein KaiC; Reviewed 94.5
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.5
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.5
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.49
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.48
cd01878204 HflX HflX subfamily. A distinct conserved domain w 94.47
PRK14737186 gmk guanylate kinase; Provisional 94.47
PRK06851 367 hypothetical protein; Provisional 94.45
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.45
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 94.45
PTZ00035337 Rad51 protein; Provisional 94.44
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.44
TIGR02329526 propionate_PrpR propionate catabolism operon regul 94.39
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 94.39
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 94.39
PRK14974336 cell division protein FtsY; Provisional 94.38
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.38
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.37
PRK12339197 2-phosphoglycerate kinase; Provisional 94.37
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.37
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.35
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.34
KOG1533|consensus290 94.34
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.34
KOG1802|consensus 935 94.34
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.32
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.32
PRK13833323 conjugal transfer protein TrbB; Provisional 94.27
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.26
KOG0745|consensus 564 94.23
cd00876160 Ras Ras family. The Ras family of the Ras superfam 94.22
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 94.22
KOG2383|consensus 467 94.22
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.2
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.2
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.18
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.17
PRK04296190 thymidine kinase; Provisional 94.14
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 94.12
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.12
PRK06964 342 DNA polymerase III subunit delta'; Validated 94.11
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.07
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.05
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.05
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 94.05
PLN03186342 DNA repair protein RAD51 homolog; Provisional 94.05
PRK13851344 type IV secretion system protein VirB11; Provision 94.04
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.04
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.04
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.04
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 94.03
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.03
PRK12338 319 hypothetical protein; Provisional 94.01
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 93.99
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 93.99
TIGR02688449 conserved hypothetical protein TIGR02688. Members 93.99
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 93.98
PRK14730195 coaE dephospho-CoA kinase; Provisional 93.98
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 93.96
PF01057271 Parvo_NS1: Parvovirus non-structural protein NS1; 93.93
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 93.93
PRK08769319 DNA polymerase III subunit delta'; Validated 93.91
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 93.91
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 93.91
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 93.91
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 93.91
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.9
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.9
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.89
PLN02199303 shikimate kinase 93.89
TIGR00959 428 ffh signal recognition particle protein. This mode 93.89
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 93.89
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 93.88
PRK09376416 rho transcription termination factor Rho; Provisio 93.87
PF04851184 ResIII: Type III restriction enzyme, res subunit; 93.86
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 93.86
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 93.85
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 93.84
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.81
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 93.81
KOG0064|consensus728 93.8
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 93.8
cd03234226 ABCG_White The White subfamily represents ABC tran 93.78
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.77
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 93.76
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.76
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 93.75
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 93.75
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 93.74
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 93.73
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.72
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.71
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.71
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.7
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 93.68
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 93.67
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.67
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 93.65
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 93.65
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.65
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 93.64
PRK04220301 2-phosphoglycerate kinase; Provisional 93.62
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 93.62
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 93.61
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 93.61
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.61
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.59
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.59
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 93.59
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 93.57
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 93.57
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 93.57
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 93.57
PRK09862 506 putative ATP-dependent protease; Provisional 93.56
PRK00081194 coaE dephospho-CoA kinase; Reviewed 93.56
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.55
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 93.55
>KOG0726|consensus Back     alignment and domain information
Probab=99.97  E-value=1.4e-31  Score=226.95  Aligned_cols=157  Identities=90%  Similarity=1.324  Sum_probs=148.3

Q ss_pred             cchhhhhhcCCCCCCccccccccccCCCCccccCCccCCchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhchhhhhHHHH
Q psy7782          69 KDDKDKKKKYEPPIPTRVGKKKRKAKGPDAAIKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEE  148 (225)
Q Consensus        69 ~~~f~~a~~~~p~iid~igk~r~~~~g~~~~~~l~~v~p~~~c~lr~~~le~~~~~l~~~~~~~~~~~~~~~~~~~~~~l  148 (225)
                      +.--+...+++|.|...+|+++++.+|+++++++|++.|.+.|.+++.+++|++++|++|++|++++++++..+...++.
T Consensus        16 ~~dk~eK~~~~~~v~~r~gr~k~~~kGpdAa~klP~V~p~~~C~lrlLk~~RIkDyLLMEEEFI~NQe~~k~~e~~~ee~   95 (440)
T KOG0726|consen   16 KDDKKEKKKYEPPVPTRVGRKKKKGKGPDAASKLPTVTPHTQCKLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKQEEE   95 (440)
T ss_pred             ccccccccccCCCCcchhhhhhhcccCcchhhcCCccccchhHHHHHHHHHHHHHHHHHHHHHHhhccccCCchhhhHHH
Confidence            44445566788889999999988888999999999999999999999999999999999999999999999998888888


Q ss_pred             HHHHhhhcCCCceeeEEEEEecCCeEEEEccCCCeEEEeecCCCCcCCCCCCCeEEecCCcceeeeccCCCCCCCCC
Q psy7782         149 RSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVT  225 (225)
Q Consensus       149 ~~ev~~l~~~p~~vg~v~e~~d~~~~iV~~~~g~~~~v~v~~~vd~~~L~pG~~V~ln~~~~~Iv~vLp~~~D~~v~  225 (225)
                      +..++.|++.|+.||+++|++||+++||.++.|++|||++.++||++.|+||+.|+||...++||++|.+++||+|+
T Consensus        96 r~~vd~lRGtPmsvg~leEiidd~haivst~~g~e~Yv~IlSfVdKdlLepgcsvll~~k~~avvGvL~d~~dpmv~  172 (440)
T KOG0726|consen   96 RSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEYYVSILSFVDKDLLEPGCSVLLNHKVHAVVGVLQDDTDPMVS  172 (440)
T ss_pred             HhHHHhhcCCccccccHHHHhcCCceEEecccCchheeeeeeeccHhhcCCCCeeeeccccceEEEEeccCCCccce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999985



>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>KOG2383|consensus Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3h43_A85 Proteasome-activating nucleotidase; regulatory par 8e-28
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-26
2wg5_A109 General control protein GCN4, proteasome-activatin 7e-25
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-19
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-19
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-18
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-17
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-16
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-04
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 5e-16
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 2e-13
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 5e-13
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 9e-13
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-12
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-12
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 6e-11
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-10
2r62_A268 Cell division protease FTSH homolog; ATPase domain 4e-10
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 5e-10
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 6e-10
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 7e-10
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-09
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-09
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-09
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-09
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-09
2wfw_A153 ARC; ATP-binding protein, proteasomal atpases, PAN 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 5e-04
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Length = 85 Back     alignment and structure
 Score =  100 bits (250), Expect = 8e-28
 Identities = 26/82 (31%), Positives = 42/82 (51%)

Query: 143 EKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCS 202
           ++NE  R  +D +R  P+ VGT+ + + +   +V +S G    V++  FV+ D L PG  
Sbjct: 2   KENEILRRELDRMRVPPLIVGTVVDKVGERKVVVKSSTGPSFLVNVSHFVNPDDLAPGKR 61

Query: 203 VLLNHKVHAVVGVLSDDTDPMV 224
           V LN +   VV VL +      
Sbjct: 62  VCLNQQTLTVVDVLPELEHHHH 83


>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Length = 109 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Length = 251 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2wfw_A ARC; ATP-binding protein, proteasomal atpases, PAN, AAA, ATP-binding, nucleotide-binding; 1.60A {Rhodococcus erythropolis} PDB: 3fp9_A Length = 153 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
2wg5_A109 General control protein GCN4, proteasome-activatin 99.95
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.95
3h43_A85 Proteasome-activating nucleotidase; regulatory par 99.92
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.89
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.88
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.87
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.86
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.86
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.85
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 99.84
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.77
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.75
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.75
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.74
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.65
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.57
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.48
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.45
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.45
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.45
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.37
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.36
2wfw_A153 ARC; ATP-binding protein, proteasomal atpases, PAN 99.34
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.34
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.3
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.3
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.3
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.29
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.28
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.27
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.22
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.21
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.15
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.15
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.12
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.04
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.02
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.01
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.92
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.9
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.6
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.55
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 98.5
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.44
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.41
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.33
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.29
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.22
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.21
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.16
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.15
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.13
3pvs_A 447 Replication-associated recombination protein A; ma 98.11
3co5_A143 Putative two-component system transcriptional RES 98.1
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.07
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.07
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.04
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.91
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.88
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.86
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.84
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.8
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.79
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.75
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.74
1tue_A212 Replication protein E1; helicase, replication, E1E 97.71
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.71
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.67
3bos_A242 Putative DNA replication factor; P-loop containing 97.64
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.62
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.61
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.61
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.61
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.6
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.58
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.58
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.57
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.56
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.53
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.52
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.52
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.52
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.47
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.45
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.43
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.4
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.39
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.38
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 97.32
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.3
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.29
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.28
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.26
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.25
2qgz_A308 Helicase loader, putative primosome component; str 97.24
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.16
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.99
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.99
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.96
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.95
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.81
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.77
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.75
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.74
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.7
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.68
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.65
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.64
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.64
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.58
2wfw_A153 ARC; ATP-binding protein, proteasomal atpases, PAN 96.48
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.47
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.41
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.37
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.34
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.32
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.28
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 96.28
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.25
1via_A175 Shikimate kinase; structural genomics, transferase 96.25
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.24
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.17
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.16
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.15
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.14
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.11
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.11
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.1
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.08
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.08
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.06
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.03
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.01
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.99
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 95.99
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.96
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.95
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.89
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.88
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 95.88
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.87
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.84
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.8
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.8
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.79
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.79
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.78
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.78
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.77
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.76
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.75
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.74
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.74
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.73
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.72
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.69
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.69
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.63
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.61
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.58
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.58
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.56
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.54
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.53
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.51
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.49
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.49
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.42
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.42
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.35
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.34
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.31
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.28
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.23
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.23
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.22
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.21
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.2
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.2
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.17
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.14
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.14
2fna_A 357 Conserved hypothetical protein; structural genomic 95.08
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.07
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.07
2z43_A324 DNA repair and recombination protein RADA; archaea 95.06
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.04
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.04
2og2_A359 Putative signal recognition particle receptor; nuc 95.03
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.03
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.02
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.01
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.98
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.97
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.94
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.92
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.89
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.89
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.85
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.84
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.82
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.81
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.81
3io5_A 333 Recombination and repair protein; storage dimer, i 94.8
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.79
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.77
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 94.75
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 94.74
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.73
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.72
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.71
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.71
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.69
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.64
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.61
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 94.6
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.58
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.52
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.52
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.49
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.49
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.46
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.38
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.33
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.31
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.29
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 94.28
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 94.21
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.2
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 94.15
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.11
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 94.11
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.07
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.05
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.05
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.02
2ged_A193 SR-beta, signal recognition particle receptor beta 93.99
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.95
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.94
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.92
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.88
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.83
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.81
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.81
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.76
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.68
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.63
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 93.61
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.6
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.58
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.53
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 93.52
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.52
2ghi_A260 Transport protein; multidrug resistance protein, M 93.47
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.47
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.46
1g6h_A257 High-affinity branched-chain amino acid transport 93.46
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 93.4
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.38
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 93.36
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 93.36
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 93.35
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.34
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.33
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 93.33
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 93.32
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 93.31
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.3
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.28
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 93.27
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 93.27
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 93.23
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.22
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 93.19
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.19
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.19
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.18
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.17
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 93.13
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 93.13
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.11
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.1
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.09
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 93.07
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 93.06
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.04
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.03
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 93.03
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.03
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.02
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.93
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.92
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.87
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 92.87
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.85
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.81
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.76
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.75
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.75
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.73
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 92.72
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.68
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.68
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 92.66
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.65
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 92.6
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 92.6
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.59
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 92.56
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.53
1p9r_A418 General secretion pathway protein E; bacterial typ 92.52
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.51
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.5
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.5
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 92.48
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 92.47
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.47
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.46
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.46
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 92.46
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 92.46
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 92.42
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 92.37
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.37
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.34
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 92.3
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 92.26
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.24
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.22
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.19
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 92.17
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.17
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.17
3kta_A182 Chromosome segregation protein SMC; structural mai 92.16
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 92.15
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.15
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.14
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 92.09
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.09
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.09
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 92.05
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 92.03
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 91.93
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 91.92
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.86
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.83
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 91.82
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 91.7
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 91.7
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 91.68
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 91.67
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 91.65
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 91.65
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 91.64
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.62
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 91.6
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 91.57
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 91.56
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 91.55
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.55
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.52
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 91.52
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.51
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.51
3lxx_A239 GTPase IMAP family member 4; structural genomics c 91.48
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 91.48
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.42
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.4
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 91.4
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 91.38
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 91.36
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 91.34
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 91.33
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.29
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 91.23
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 91.18
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.17
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.15
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 91.11
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 91.08
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 91.08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 91.07
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 91.06
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 90.99
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 90.98
3ice_A422 Transcription termination factor RHO; transcriptio 90.95
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.94
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 90.94
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 90.92
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 90.91
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.89
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 90.88
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.87
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 90.86
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.86
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.85
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 90.8
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 90.8
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 90.8
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.79
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 90.75
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 90.74
3iby_A256 Ferrous iron transport protein B; G protein, G dom 90.74
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 90.65
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 90.6
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 90.57
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.54
1ah9_A71 IF1, initiation factor 1; ribosome binding, protei 90.52
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 90.49
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 90.43
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.43
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 90.38
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 90.37
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.35
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.32
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 90.28
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 90.21
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 90.17
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.17
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 90.16
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 90.15
1j3b_A 529 ATP-dependent phosphoenolpyruvate carboxykinase; a 90.11
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 90.11
2oqk_A117 Putative translation initiation factor EIF-1A; mal 90.08
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 89.57
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 90.06
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 90.05
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 90.04
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 90.02
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 90.01
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 89.99
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 89.97
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 89.96
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 89.92
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 89.87
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 89.86
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.85
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 89.83
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.81
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 89.81
2olr_A 540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 89.79
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.75
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.72
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.71
3lxw_A247 GTPase IMAP family member 1; immunity, structural 89.65
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 89.65
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 89.62
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 89.6
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 89.56
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 89.55
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.43
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.41
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.4
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 89.31
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 89.23
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 89.22
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.21
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 89.05
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 89.05
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 89.04
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 89.02
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.0
1ytm_A 532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 88.96
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 88.94
1ii2_A 524 Phosphoenolpyruvate carboxykinase; phosphate bindi 88.93
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 88.92
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 88.9
3t1o_A198 Gliding protein MGLA; G domain containing protein, 88.86
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 88.79
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 88.73
3f8t_A506 Predicted ATPase involved in replication control, 88.65
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 88.6
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 88.59
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 88.58
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 88.51
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.5
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 88.5
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 88.42
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 88.41
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 88.37
2xxa_A 433 Signal recognition particle protein; protein trans 88.35
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 88.32
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 88.29
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 88.28
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 88.16
3i4o_A79 Translation initiation factor IF-1; cytoplasm, pro 88.15
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 88.14
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 88.08
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 88.07
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 87.96
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 87.92
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 87.84
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 87.8
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.79
2dgy_A111 MGC11102 protein; EIF-1A, structural genomics, NPP 87.74
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 87.66
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 87.62
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Back     alignment and structure
Probab=99.95  E-value=2.2e-28  Score=181.62  Aligned_cols=93  Identities=30%  Similarity=0.571  Sum_probs=80.6

Q ss_pred             HHHhhhchhhhhHHHHHHHHhhhcCCCceeeEEEEEecCCeEEEEccCCCeEEEeecCCCCcCCCCCCCeEEecCCccee
Q psy7782         133 RNQERLKPQEEKNEEERSRVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAV  212 (225)
Q Consensus       133 ~~~~~~~~~~~~~~~l~~ev~~l~~~p~~vg~v~e~~d~~~~iV~~~~g~~~~v~v~~~vd~~~L~pG~~V~ln~~~~~I  212 (225)
                      +++.+++.++++++.+++|+++|++||+.||+|+|++|++++||++++|++|||+++++||+++|+||+||+||+++|+|
T Consensus        11 ~l~~~~~~l~~~i~~lkeel~~L~~~P~~Vg~v~e~~d~~~~iVk~s~g~~~~V~v~~~Vd~~~LkpG~rVaLn~~s~~I   90 (109)
T 2wg5_A           11 QLEDKVEELLSKNYHLENEVARLRSPPLLVGVVSDILEDGRVVVKSSTGPKFVVNTSQYINEEELKPGARVALNQQTLAI   90 (109)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHSCCEEEEEEEEECTTSCEEEEETTSCEEEECBCTTSCTTTCCTTCEEEEETTTCCE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhCCCceEEEEEEEecCCEEEEEeCCCCEEEEEcccccCHHHCCCCCEEEECCcceEe
Confidence            34456677888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccCCCCCCCCC
Q psy7782         213 VGVLSDDTDPMVT  225 (225)
Q Consensus       213 v~vLp~~~D~~v~  225 (225)
                      |++||+++||+|+
T Consensus        91 v~iLp~e~Dp~V~  103 (109)
T 2wg5_A           91 VNVLPTSKDPMVY  103 (109)
T ss_dssp             EEEEC--------
T ss_pred             EEeCCCCcCccch
Confidence            9999999999985



>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2wfw_A ARC; ATP-binding protein, proteasomal atpases, PAN, AAA, ATP-binding, nucleotide-binding; 1.60A {Rhodococcus erythropolis} PDB: 3fp9_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2wfw_A ARC; ATP-binding protein, proteasomal atpases, PAN, AAA, ATP-binding, nucleotide-binding; 1.60A {Rhodococcus erythropolis} PDB: 3fp9_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1ah9_A IF1, initiation factor 1; ribosome binding, protein-RNA interaction, OB fold; NMR {Escherichia coli} SCOP: b.40.4.5 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oqk_A Putative translation initiation factor EIF-1A; malaria, eukaryotic initiation facto SGC, structural genomics; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} SCOP: b.40.4.5 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2dgy_A MGC11102 protein; EIF-1A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-17
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-13
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-12
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-11
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-06
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-05
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-04
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 4e-04
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 0.001
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.001
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 0.002
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 0.003
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 0.003
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.004
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 76.2 bits (186), Expect = 3e-17
 Identities = 27/46 (58%), Positives = 36/46 (78%)

Query: 3  LDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLP 48
             Q+ +IKE VELPL HP  ++ +G+KPP+G++LYGPPGTGKTL 
Sbjct: 9  CRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLI 54


>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.76
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.75
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.73
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.66
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.3
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.28
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.16
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.01
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.65
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.61
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.44
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.26
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.19
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.08
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.04
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.95
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.86
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.84
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.84
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.73
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.64
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.59
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 97.57
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.43
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.4
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.37
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.34
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.3
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.27
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.25
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.23
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.21
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.21
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.06
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.02
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.02
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.95
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.86
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.83
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.82
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.79
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.77
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.75
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.74
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.69
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.68
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.68
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.65
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.54
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.51
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.5
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.5
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.48
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.46
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.43
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.37
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.27
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.18
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.18
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.15
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.12
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.96
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.95
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.66
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.52
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.5
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.49
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.47
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.27
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.26
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.06
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.94
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.89
d1okkd2207 GTPase domain of the signal recognition particle r 94.81
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.8
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.8
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.77
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.71
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.67
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.62
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.55
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.54
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.51
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.47
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.43
d1vmaa2213 GTPase domain of the signal recognition particle r 94.36
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.36
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.2
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.18
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.15
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.04
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.02
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.96
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.93
d2qy9a2211 GTPase domain of the signal recognition particle r 93.9
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.8
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.56
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.56
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.52
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.48
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.45
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.43
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.43
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.43
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.22
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.21
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.2
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.17
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.1
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.01
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.91
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.88
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.79
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.74
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.73
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 92.72
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.68
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.64
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.61
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.59
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.58
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.5
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.38
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.33
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.32
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.32
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.31
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.27
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.22
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.18
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.12
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.07
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.05
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.05
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 92.04
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.98
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.96
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.88
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.87
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.79
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.77
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.76
d1ah9a_71 Translational initiation factor 1, IF1 {Escherichi 91.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.72
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.56
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.55
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.49
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.38
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.28
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.2
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.2
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.12
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.1
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.08
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.07
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.01
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.01
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.84
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.68
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.62
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.59
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.53
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.48
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.42
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.23
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.2
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.15
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.05
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 90.02
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.01
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.89
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.82
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 89.77
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.61
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 89.43
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.36
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.34
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.19
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.01
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 88.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 88.78
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.38
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 88.15
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.12
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.12
d1u0la166 Probable GTPase EngC (YjeQ), N-terminal domain {Th 87.69
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.49
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.46
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.28
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.06
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.05
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.63
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.6
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.25
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.25
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.8
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.71
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.64
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 85.34
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.28
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 85.22
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.12
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.05
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 84.82
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.06
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 83.65
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.48
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.41
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.01
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.53
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 82.33
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 82.19
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 81.87
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 81.84
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.29
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 80.49
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.18
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=99.76  E-value=1.5e-19  Score=151.12  Aligned_cols=90  Identities=33%  Similarity=0.522  Sum_probs=72.6

Q ss_pred             CChHHHHHHHHHHHHcccCChHHHHHcCCCCCceeEEEcCCCCCCCcccc---cccCCceeeccCCC--------C-CCc
Q psy7782           1 MSLDVQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLPFS---PALGYHYYCRGAGS--------N-SDK   68 (225)
Q Consensus         1 iGl~~~k~~l~~~v~~~l~~~~~~~~~g~~~~~giLl~GppGtGKT~la~---~~~~~~~~~~~~~~--------~-~~~   68 (225)
                      +|+++++++|.+.+.+ +.+++.|+++|..+++|+|||||||||||++|+   .+++.+++.++.++        + ..+
T Consensus        15 ~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~~~~g~~~~~l   93 (256)
T d1lv7a_          15 AGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRV   93 (256)
T ss_dssp             CSCHHHHHHTHHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTTSCCCCCHHHH
T ss_pred             hchHHHHHHHHHHHHH-HHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhhcchhHHHHHH
Confidence            5999999999998876 899999999999999999999999999999997   55678888887665        2 335


Q ss_pred             cchhhhhhcCCCCCC-----cccccccc
Q psy7782          69 KDDKDKKKKYEPPIP-----TRVGKKKR   91 (225)
Q Consensus        69 ~~~f~~a~~~~p~ii-----d~igk~r~   91 (225)
                      +.+|+.|++++|||+     |.++..|.
T Consensus        94 ~~~f~~A~~~~P~il~iDeiD~l~~~r~  121 (256)
T d1lv7a_          94 RDMFEQAKKAAPCIIFIDEIDAVGRQRG  121 (256)
T ss_dssp             HHHHHHHHTTCSEEEEETTHHHHTCCCS
T ss_pred             HHHHHHHHHcCCEEEEEEChhhhCccCC
Confidence            799999999999997     66665553



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ah9a_ b.40.4.5 (A:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure