Family of putative transmembrane GTPase. The fzo protein is a mediator of mitochondrial fusion. This conserved region is also found in the human mitofusin protein. Length = 171
DUF3450: Protein of unknown function (DUF3450); In
80.33
>PF04799 Fzo_mitofusin: fzo-like conserved region; InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases
Probab=100.00 E-value=3e-36 Score=216.89 Aligned_cols=82 Identities=54% Similarity=0.874 Sum_probs=58.9
Q ss_pred CchhhhhhchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhhhhHHHHHHHHHHHHHHhcc
Q psy7799 1 MIVDLTSSNCSHQVEQELSSTFARLCQLVDRATDDMHEDIKQLDSHLKQVEEASNNAKVLRNKAHYLIKELDMFQEAYLV 80 (83)
Q Consensus 1 ~iV~~tssncshQVqqEL~~tf~rL~~~Vd~~~~eL~~ei~~L~~~i~~le~i~~~~K~lrnKa~~L~~eL~~F~~~yL~ 80 (83)
+||++||+||||||||||++||+|||++||++++||++||++|+++|++||++++++|+|||||+||++|||+|.++||+
T Consensus 90 ~iv~~tsancs~QVqqeL~~tf~rL~~~Vd~~~~eL~~eI~~L~~~i~~le~~~~~~k~LrnKa~~L~~eL~~F~~~yL~ 169 (171)
T PF04799_consen 90 LIVSFTSANCSHQVQQELSSTFARLCQQVDQTKNELEDEIKQLEKEIQRLEEIQSKSKTLRNKANWLESELERFQEQYLQ 169 (171)
T ss_dssp --------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-
T ss_pred HHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred cC
Q psy7799 81 NM 82 (83)
Q Consensus 81 ~~ 82 (83)
+.
T Consensus 170 ~~ 171 (171)
T PF04799_consen 170 KS 171 (171)
T ss_dssp --
T ss_pred CC
Confidence 63
Fzo is a mediator of mitochondrial fusion during spermatogenesis []. This conserved region is also found in the human mitofusin protein []. This domain forms a dimeric antiparallel coiled coil structure, which has been proposed to act as a mitochodrial tether before vesicle fusion [].; GO: 0003924 GTPase activity, 0006184 GTP catabolic process, 0008053 mitochondrial fusion, 0005741 mitochondrial outer membrane, 0016021 integral to membrane; PDB: 1T3J_A.
Probab=99.82 E-value=4.4e-20 Score=154.30 Aligned_cols=82 Identities=37% Similarity=0.561 Sum_probs=79.6
Q ss_pred CchhhhhhchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhhhhHHHHHHHHHHHHHHhcc
Q psy7799 1 MIVDLTSSNCSHQVEQELSSTFARLCQLVDRATDDMHEDIKQLDSHLKQVEEASNNAKVLRNKAHYLIKELDMFQEAYLV 80 (83)
Q Consensus 1 ~iV~~tssncshQVqqEL~~tf~rL~~~Vd~~~~eL~~ei~~L~~~i~~le~i~~~~K~lrnKa~~L~~eL~~F~~~yL~ 80 (83)
++++.|++||||||+|||++||++||++|+.+..+|+++++.+.++|+.+|.+|+++|.+||||.+++.||++|..+||.
T Consensus 668 ~~~~~h~a~cs~qi~~El~~vfa~l~r~v~~~~~~~~d~~~~~~~~le~lds~q~~~K~~~~ka~~l~~el~mf~~~~L~ 747 (749)
T KOG0448|consen 668 EFDDSHTANCSHQIRQELRTVFAILCRTVDRVEEQMRDDLLATKKQLESLDSIQSRLKFFRSKALKLEYELIMFERQYLS 747 (749)
T ss_pred HHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence 36899999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred cC
Q psy7799 81 NM 82 (83)
Q Consensus 81 ~~ 82 (83)
+.
T Consensus 748 ~~ 749 (749)
T KOG0448|consen 748 ID 749 (749)
T ss_pred CC
Confidence 73
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis
Vesicle function is mediated by proteins in their membranes, although the precise nature of the protein-protein interactions underlying this are still uncertain []. Synaptobrevin may play a role in the molecular events underlying neurotransmitter release and vesicle recycling and may be involved in the regulation of membrane flow in the nerve terminal, a process mediated by interaction with low molecular weight GTP-binding proteins []. Synaptic vesicle-associated membrane proteins (VAMPs) from Torpedo californica (Pacific electric ray) and SNC1 from yeast are related to synaptobrevin.; GO: 0016192 vesicle-mediated transport, 0016021 integral to membrane; PDB: 3EGX_C 2NUP_C 3EGD_C 2NUT_C 1IOU_A 1H8M_A 3B5N_A 3ZYM_A 2NPS_A 1SFC_E ....
>cd07646 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Insulin Receptor tyrosine kinase Substrate p53
The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. IRSp53 (Insulin Receptor tyrosine kinase Substrate p53) is also known as BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2). It is a scaffolding protein that takes part in many signaling pathways including Cdc42-induced filopodia formation, Rac-mediated lamellipodia extension, and spine morphogenesis. IRSp53 exists as multiple splicing variants that differ mainly at the C-termini. One variant (T-form) is expressed exclusively in human breast cancer cells. The gene encoding IRSp53 is a putative susceptibility gene for Gilles de la Tourette syndrome. IRSp53 contains an N-terminal IMD, a CRIB (Cdc42 and Rac interactive binding motif), an SH3 domain, and a WASP
>PF10157 DUF2365: Uncharacterized conserved protein (DUF2365); InterPro: IPR019314 This entry is found in a highly conserved family of proteins which have no known function
Chaperonins are cytosolic, ATP-dependent molecular chaperones, with a conserved toroidal architecture, that assist in the folding of nascent and/or denatured polypeptide chains. The group I chaperonin system consists of GroEL and GroES, and is found (usually) in bacteria and organelles of bacterial origin. The group II chaperonin system, called the thermosome in Archaea and TRiC or CCT in the Eukaryota, is structurally similar but only distantly related. Prefoldin, also called GimC, is a complex in Archaea and Eukaryota, that works with group II chaperonins. Members of this protein family are the archaeal clade of the beta class of prefoldin subunit. Closely related, but outside the scope of this family are the eukaryotic beta-class prefoldin subunits, Gim-1,3,4 and 6. The alpha class prefoldin subunits are more distantly related.
This model describes the common type II DNA topoisomerase (DNA gyrase). Two apparently independently arising families, one in the Proteobacteria and one in Gram-positive lineages, are both designated toposisomerase IV.
>PF02646 RmuC: RmuC family; InterPro: IPR003798 This protein contains several bacterial RmuC DNA recombination proteins
The function of the RMUC protein is unknown but it is suspected that it is either a structural protein that protects DNA against nuclease action, or is itself involved in DNA cleavage at the regions of DNA secondary structures []. Proteins in this family are predicted to contain a central endonuclease-like fold domain, surrounded by coiled coils, consistent with a direct role in DNA cleavage [, ].
>TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit, Gram-positive
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason.
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
>PF08514 STAG: STAG domain ; InterPro: IPR013721 STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes
The STAG domain is present in Schizosaccharomyces pombe (Fission yeast) mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version [].
>PF06825 HSBP1: Heat shock factor binding protein 1; InterPro: IPR009643 Heat shock factor binding protein 1 (HSBP1) appears to be a negative regulator of the heat shock response []
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function
However, they are found in an operon along with components of a TonB transport system (typified by Vibrio cholerae TonB2 [], and are predicted to be localized to the periplasmic space. Caution: the low-complexity nature of these sequences produces spurious BLAST hits to chromosome segregation ATPases (which are much longer in length and contain canonical Walker motifs). Accordingly, some members are misidentified as such.
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Methicillin resistance protein FemA probable tRNA-binding arm
domain: Methicillin resistance protein FemA probable tRNA-binding arm
species: Staphylococcus aureus [TaxId: 1280]
