Psyllid ID: psy7854


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MANNANANMLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPILKI
ccccccccccccccEEEccccccccccccccccEEccccccccccccEEEcccccEEcccccccccccccccccEEEccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccEEEEccccEEEEccccccEEEc
ccccHHHHHHHHccccEEEEEccccccHHHHHcccccccccccccEEEcccccccccccccccccccccccccccccEcccccccccccEEEcccccEEEEcccccEEcccccEEEEcHHHccccccccccEEEcccccEEEEccccccEccc
MANNANANMLTEGRLRIKGVSKHSRLAVALRRSIsideftvhSSTLIALSQESQDLERlkfglepptsrsevhganhhttenpgictngacenlmgtyrcicnpgyegdptgklcsdqneCLMDVMicsggtckntpgsfqsnfqdsspilki
mannananmltegrlrikgvskHSRLAVALRRsisideftvhSSTLIALSQESQDLERLKFGLEPPTSRSEVHganhhttenpgiCTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCkntpgsfqsnfqdsspilki
MANNANANMLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPILKI
****************IKGVSKHSRLAVALRRSISIDEFTVHSSTLIAL*********************************PGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTC********************
*****NANMLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPILKI
********MLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPILKI
**N**N*NMLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPIL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNANANMLTEGRLRIKGVSKHSRLAVALRRSISIDEFTVHSSTLIALSQESQDLERLKFGLEPPTSRSEVHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPILKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
P35555 2871 Fibrillin-1 OS=Homo sapie yes N/A 0.379 0.020 0.627 2e-15
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa yes N/A 0.372 0.019 0.627 2e-15
P98133 2871 Fibrillin-1 OS=Bos taurus yes N/A 0.379 0.020 0.627 2e-15
Q61554 2871 Fibrillin-1 OS=Mus muscul yes N/A 0.267 0.014 0.627 3e-15
Q61555 2907 Fibrillin-2 OS=Mus muscul no N/A 0.372 0.019 0.559 4e-13
P35556 2912 Fibrillin-2 OS=Homo sapie no N/A 0.372 0.019 0.559 4e-13
Q75N90 2809 Fibrillin-3 OS=Homo sapie no N/A 0.379 0.020 0.508 5e-13
Q8CG19 1712 Latent-transforming growt no N/A 0.398 0.035 0.435 2e-09
Q00918 1712 Latent-transforming growt no N/A 0.398 0.035 0.435 3e-09
O08999 1813 Latent-transforming growt no N/A 0.372 0.031 0.517 2e-08
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function desciption
 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 45/59 (76%)

Query: 82  NPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSF 140
           +P IC NG CENL GTY+CICN GYE D TGK C D NEC+++ ++C  G C+NTPGSF
Sbjct: 730 DPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPGSF 788




Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-1-containing microfibrils provide long-term force bearing structural support. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Homo sapiens (taxid: 9606)
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|Q8CG19|LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus GN=Ltbp1 PE=2 SV=2 Back     alignment and function description
>sp|Q00918|LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus GN=Ltbp1 PE=1 SV=1 Back     alignment and function description
>sp|O08999|LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus GN=Ltbp2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.555 0.030 0.521 3e-19
189234367 2933 PREDICTED: similar to fibrillin 2 [Tribo 0.418 0.021 0.661 1e-18
270001930 2865 hypothetical protein TcasGA2_TC000836 [T 0.418 0.022 0.661 1e-18
322786654158 hypothetical protein SINV_00502 [Solenop 0.424 0.411 0.661 6e-18
328715164 3100 PREDICTED: fibrillin-2-like [Acyrthosiph 0.758 0.037 0.466 1e-17
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.405 0.021 0.661 1e-17
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.418 0.022 0.661 1e-17
307196014 2862 Fibrillin-2 [Harpegnathos saltator] 0.385 0.020 0.693 2e-17
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.385 0.021 0.693 2e-17
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.405 0.021 0.661 4e-17
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (69%), Gaps = 7/92 (7%)

Query: 52  ESQDLERLKFGLEPPTSRSEVHGAN--HHTTENPGICTNGACENLMGTYRCICNPGYEGD 109
           +S++ E+L      P    + H  +  +   +NP ICTNGACENL+GTYRCICNPGY+ D
Sbjct: 597 DSEEFEQLC-----PFGSGKTHSGDDINECAQNPNICTNGACENLLGTYRCICNPGYQVD 651

Query: 110 PTGKLCSDQNECLMDVMICSGGTCKNTPGSFQ 141
            +GK C+D NEC +D ++C GG C+NTPGSFQ
Sbjct: 652 SSGKTCTDINECAVDNLLCDGGQCRNTPGSFQ 683




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234367|ref|XP_974344.2| PREDICTED: similar to fibrillin 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001930|gb|EEZ98377.1| hypothetical protein TcasGA2_TC000836 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322786654|gb|EFZ13038.1| hypothetical protein SINV_00502 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328715164|ref|XP_001945971.2| PREDICTED: fibrillin-2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
UNIPROTKB|F1PIA3 2871 FBN1 "Uncharacterized protein" 0.385 0.020 0.627 1.5e-17
UNIPROTKB|F1NII7 2822 FBN1 "Uncharacterized protein" 0.385 0.020 0.610 2.4e-17
UNIPROTKB|F1NJQ9 2838 FBN1 "Uncharacterized protein" 0.385 0.020 0.610 2.4e-17
UNIPROTKB|E1C5P6 2869 FBN3 "Uncharacterized protein" 0.385 0.020 0.627 2.4e-17
UNIPROTKB|F1SN67 2336 FBN1 "Fibrillin-1" [Sus scrofa 0.385 0.025 0.627 3.1e-17
UNIPROTKB|P98133 2871 FBN1 "Fibrillin-1" [Bos taurus 0.385 0.020 0.627 3.9e-17
UNIPROTKB|F1N4K8 2871 FBN1 "Fibrillin-1" [Bos taurus 0.385 0.020 0.627 3.9e-17
UNIPROTKB|P35555 2871 FBN1 "Fibrillin-1" [Homo sapie 0.385 0.020 0.627 3.9e-17
UNIPROTKB|Q9TV36 2871 FBN1 "Fibrillin-1" [Sus scrofa 0.385 0.020 0.627 3.9e-17
MGI|MGI:95489 2871 Fbn1 "fibrillin 1" [Mus muscul 0.385 0.020 0.627 6.4e-17
UNIPROTKB|F1PIA3 FBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 37/59 (62%), Positives = 46/59 (77%)

Query:    82 NPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSF 140
             +P IC NG CENL GTY+CICN GYE DP+GK C D NEC+++ ++C  G C+NTPGSF
Sbjct:   730 DPDICPNGICENLRGTYKCICNSGYEVDPSGKNCVDINECVLNSLLCDNGQCRNTPGSF 788


GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005201 "extracellular matrix structural constituent" evidence=IEA
UNIPROTKB|F1NII7 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJQ9 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5P6 FBN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN67 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P98133 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K8 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P35555 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TV36 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95489 Fbn1 "fibrillin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
smart0018135 smart00181, EGF, Epidermal growth factor-like doma 7e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 5e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-05
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 2e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 2e-04
pfam1294736 pfam12947, EGF_3, EGF domain 8e-04
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.003
>gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain Back     alignment and domain information
 Score = 40.6 bits (95), Expect = 7e-06
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 81  ENPGICTNGACENLMGTYRCICNPGYEGDPT 111
            + G C+NG C N  G+Y C C PGY GD  
Sbjct: 3   ASGGPCSNGTCINTPGSYTCSCPPGYTGDKR 33


Length = 35

>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG1214|consensus 1289 99.3
KOG1219|consensus 4289 99.16
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.84
KOG1214|consensus 1289 98.78
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.75
KOG4289|consensus 2531 98.71
KOG1219|consensus 4289 98.59
PF1266224 cEGF: Complement Clr-like EGF-like 98.52
KOG4260|consensus350 98.37
KOG4289|consensus 2531 98.09
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.04
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.95
KOG4260|consensus350 97.94
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.82
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.81
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.66
KOG1217|consensus 487 97.61
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.56
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.52
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.45
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 97.34
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 97.28
KOG1217|consensus487 97.08
smart0018135 EGF Epidermal growth factor-like domain. 97.03
cd0005336 EGF Epidermal growth factor domain, found in epide 96.97
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.89
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.82
smart0018135 EGF Epidermal growth factor-like domain. 96.41
cd0005336 EGF Epidermal growth factor domain, found in epide 96.01
PF06247 197 Plasmod_Pvs28: Plasmodium ookinete surface protein 95.12
KOG1225|consensus 525 92.55
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 92.26
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 90.87
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 88.46
PHA03099139 epidermal growth factor-like protein (EGF-like pro 86.66
PHA03099139 epidermal growth factor-like protein (EGF-like pro 84.58
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 83.11
KOG1225|consensus 525 82.29
PHA02887126 EGF-like protein; Provisional 80.81
PHA02887126 EGF-like protein; Provisional 80.28
>KOG1214|consensus Back     alignment and domain information
Probab=99.30  E-value=5.1e-12  Score=102.59  Aligned_cols=122  Identities=25%  Similarity=0.363  Sum_probs=89.1

Q ss_pred             eecccCCCCcccCcCCCCCCCeeeCCCcee----cccCCCCccCCCCCCCCcCCc------ccCCCCCCCCCC-CC--ce
Q psy7854          25 RLAVALRRSISIDEFTVHSSTLIALSQESQ----DLERLKFGLEPPTSRSEVHGA------NHHTTENPGICT-NG--AC   91 (153)
Q Consensus        25 ~~~~~~~~c~~i~~c~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~C~~------~~~C~~~~~~C~-~~--~C   91 (153)
                      .+..+.+.|.|++||+.-...|..+..|.+    +.|.|..+|..... +.+|+.      ++.|..+.+.|. ++  .|
T Consensus       723 g~~gdgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd-~~tCV~i~~pap~n~Ce~g~h~C~i~g~a~c  801 (1289)
T KOG1214|consen  723 GYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADD-RHTCVLITPPAPANPCEDGSHTCAIAGQARC  801 (1289)
T ss_pred             ccCCCCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccC-CcceEEecCCCCCCccccCccccCcCCceEE
Confidence            344578999999999887766666666643    33444445543332 345643      455666556673 33  66


Q ss_pred             eecC-CCceeeCCCCcccCCCCCCCccCccccCCCCCCCC-CeeeecCCCcEEecCCCCCcc
Q psy7854          92 ENLM-GTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSG-GTCKNTPGSFQSNFQDSSPIL  151 (153)
Q Consensus        92 ~~~~-g~~~C~C~~g~~~~~~g~~C~~i~~C~~~~~~C~~-~~C~~~~g~~~C~C~~g~~~~  151 (153)
                      .... ++|.|.|.+||.+  +|..|.++|||  .++.|+. ++|.|++|+|.|.|.+||-++
T Consensus       802 ~~hGgs~y~C~CLPGfsG--DG~~c~dvDeC--~psrChp~A~CyntpgsfsC~C~pGy~GD  859 (1289)
T KOG1214|consen  802 VHHGGSTYSCACLPGFSG--DGHQCTDVDEC--SPSRCHPAATCYNTPGSFSCRCQPGYYGD  859 (1289)
T ss_pred             EecCCceEEEeecCCccC--Ccccccccccc--CccccCCCceEecCCCcceeecccCccCC
Confidence            6554 5799999999988  89999999999  6999985 999999999999999999754



>KOG1219|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 1e-06
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 82 NPGICTNGACENLMGTYRCICNPGYE-GDPTGKLCSDQNECLMDVMICSGGTCKNTPGSF 140 +P +C G C N G + C C+ GYE G K C D +EC D ++C GG C NT GS+ Sbjct: 9 SPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSY 68 Query: 141 Q 141 + Sbjct: 69 R 69

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-19
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-08
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-18
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-16
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-15
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-13
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-08
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-13
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-11
2bou_A143 EGF-like module containing mucin-like hormone rece 7e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 6e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 7e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 5e-09
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 5e-09
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-05
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-08
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 8e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-07
2vh0_B134 Activated factor XA light chain; serine protease, 1e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 8e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 5e-06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 7e-06
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-05
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 2e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 5e-04
1szb_A170 Mannose binding lectin-associated serine protease- 6e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 6e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 8e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 8e-04
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
 Score = 76.9 bits (190), Expect = 1e-19
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 80  TENPGICTNGACENLMGTYRCICNPGYEGDPT-GKLCSDQNECLMDVMICSGGTCKNTPG 138
             +P +C  G C N  G + C C+ GYE      K C D +EC  D ++C GG C NT G
Sbjct: 7   RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEG 66

Query: 139 SFQ 141
           S++
Sbjct: 67  SYR 69


>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.72
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.71
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.67
2bou_A143 EGF-like module containing mucin-like hormone rece 99.6
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.6
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.57
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.52
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.51
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.51
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.48
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.47
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.43
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.42
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.41
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.32
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.3
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.29
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.28
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.26
2vh0_B134 Activated factor XA light chain; serine protease, 99.26
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.21
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.19
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.18
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.17
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.17
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.16
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.09
2bou_A143 EGF-like module containing mucin-like hormone rece 99.08
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.96
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.96
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.87
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.86
2vh0_B134 Activated factor XA light chain; serine protease, 98.85
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.84
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.83
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.8
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.78
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.76
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.62
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.54
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.53
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.49
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.47
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.45
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.44
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.44
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.34
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.34
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.28
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.26
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.26
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.22
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 98.16
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.12
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.09
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.07
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 98.06
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 98.06
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.04
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.97
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.9
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.89
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.87
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.87
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.84
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 97.8
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.79
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.77
1ob1_C99 Major merozoite surface protein; immune system, im 97.64
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.64
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.63
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 97.59
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.57
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.56
1szb_A170 Mannose binding lectin-associated serine protease- 97.54
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.53
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.5
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.43
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 97.38
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.37
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.34
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.28
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 97.26
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.26
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.21
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.13
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 96.86
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.81
1nzi_A159 Complement C1S component; calcium, innate immunity 96.79
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.76
2wph_E59 Coagulation factor IXA light chain; serine proteas 96.75
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.67
1szb_A170 Mannose binding lectin-associated serine protease- 96.61
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 96.38
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 96.27
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.06
1nzi_A159 Complement C1S component; calcium, innate immunity 95.73
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.29
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 95.23
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.22
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.18
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.15
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.09
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.9
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 94.78
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.56
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 94.05
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.95
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.76
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 93.75
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.73
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 93.66
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 93.64
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.39
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.27
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.11
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.11
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 92.72
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.67
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 92.26
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 91.8
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 90.66
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 90.2
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 90.07
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.77
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 89.51
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 88.76
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 88.16
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 87.89
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 87.48
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 87.22
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 86.68
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 86.48
1ob1_C99 Major merozoite surface protein; immune system, im 85.93
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 85.09
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 81.84
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 81.55
2i9a_A145 Urokinase-type plasminogen activator; growth facto 80.31
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
Probab=99.72  E-value=1.1e-17  Score=101.61  Aligned_cols=76  Identities=34%  Similarity=0.678  Sum_probs=67.4

Q ss_pred             cCCcccCCCCCCCCCCCCceeecCCCceeeCCCCcccCCCCCCCccCccccCCCCCCCCCeeeecCCCcEEecCCCCCcc
Q psy7854          72 VHGANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLCSDQNECLMDVMICSGGTCKNTPGSFQSNFQDSSPIL  151 (153)
Q Consensus        72 ~C~~~~~C~~~~~~C~~~~C~~~~g~~~C~C~~g~~~~~~g~~C~~i~~C~~~~~~C~~~~C~~~~g~~~C~C~~g~~~~  151 (153)
                      +|+++|+|.. +.+|.++.|++..++|.|.|++||.+  .+..|++++||.. .++|.+++|+++.|+|+|.|++||.+.
T Consensus         1 sC~dideC~~-~~~C~~g~C~n~~g~y~C~C~~Gy~~--~g~~C~dideC~~-~~~C~~~~C~n~~g~y~C~C~~G~~g~   76 (82)
T 1emn_A            1 SAVDMDECKE-PDVCKHGQCINTDGSYRCECPFGYIL--AGNECVDTDECSV-GNPCGNGTCKNVIGGFECTCEEGFEPG   76 (82)
T ss_dssp             CCCCCCSSSS-TTSCSSSEECCCSSCCCEECCTTEEE--ETTEEEECCGGGT-CCTTSSSCEEECSSSEEECCSSSSCCC
T ss_pred             CCCccccCCC-CCCcCCCEEEecCCCEEEECCCCeEC--CCCccCCcccccC-CCCCCCCEeECCCCCEEeECCCCeEeC
Confidence            4788999986 57898789999999999999999976  5789999999963 678977899999999999999999764



>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 8e-09
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 8e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-09
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 6e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 0.001
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-07
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 4e-06
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-05
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 2e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 5e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-04
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 3e-04
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 7e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 8e-04
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.001
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.001
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 0.001
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.001
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.001
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 0.002
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.002
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.002
d1emoa239 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sa 0.004
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.7 bits (111), Expect = 8e-09
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 80  TENPGICTNGACENLMGTYRCICNPGYEGD-PTGKLC 115
             +P +C  G C N  G + C C+ GYE      K C
Sbjct: 7   RISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNC 43


>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.97
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.91
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.81
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.79
d1szba245 Mannose-binding protein associated serine protease 98.77
d1nt0a345 Mannose-binding protein associated serine protease 98.74
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.74
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.62
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.62
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.6
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.56
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.54
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.51
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.51
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.49
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.47
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.46
d1nt0a345 Mannose-binding protein associated serine protease 98.44
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.44
d1szba245 Mannose-binding protein associated serine protease 98.43
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.41
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.34
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.29
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.25
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.19
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.19
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.17
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.1
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.08
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.06
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.04
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.02
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.02
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.98
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.9
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.86
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.73
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.66
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.66
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.57
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.56
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.5
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.49
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.48
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.33
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.32
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.18
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.15
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.01
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.93
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.91
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.83
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.76
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.47
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.18
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.71
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.55
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.51
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 95.51
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.26
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.16
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 91.82
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 91.72
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 90.76
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 90.46
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.01
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.05  E-value=2.3e-11  Score=62.59  Aligned_cols=41  Identities=34%  Similarity=0.816  Sum_probs=35.9

Q ss_pred             cccCCCCCCCCCCCCceeecCCCceeeCCCCcccCCCCCCC
Q psy7854          75 ANHHTTENPGICTNGACENLMGTYRCICNPGYEGDPTGKLC  115 (153)
Q Consensus        75 ~~~~C~~~~~~C~~~~C~~~~g~~~C~C~~g~~~~~~g~~C  115 (153)
                      |||||...+..|.++.|+|++|+|+|.|++||.+.++++.|
T Consensus         1 DidEC~~~~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~C   41 (42)
T d1lmja2           1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC   41 (42)
T ss_dssp             ECCHHHHCSSTTTTSEEEEETTEEEEESCTTSCCCSSSCCC
T ss_pred             CccccCCCCCCCCCCEeECCCCCeEEeCCCCCeECcCCCcc
Confidence            68999887788887799999999999999999887777665



>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure