Psyllid ID: psy8090
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 242 | ||||||
| 270010437 | 657 | hypothetical protein TcasGA2_TC009830 [T | 0.652 | 0.240 | 0.778 | 4e-70 | |
| 242007675 | 672 | LIM domain only protein, putative [Pedic | 0.615 | 0.221 | 0.805 | 9e-69 | |
| 195474329 | 1308 | GE19116 [Drosophila yakuba] gi|194175545 | 0.652 | 0.120 | 0.708 | 3e-66 | |
| 328927106 | 1346 | MIP30239p [Drosophila melanogaster] | 0.652 | 0.117 | 0.708 | 3e-66 | |
| 12655372 | 1299 | prickle sple isoform [Drosophila melanog | 0.652 | 0.121 | 0.708 | 4e-66 | |
| 194863868 | 1326 | GG23268 [Drosophila erecta] gi|190662521 | 0.652 | 0.119 | 0.708 | 4e-66 | |
| 24586188 | 1299 | prickle, isoform C [Drosophila melanogas | 0.652 | 0.121 | 0.708 | 4e-66 | |
| 195027702 | 1361 | GH21524 [Drosophila grimshawi] gi|193902 | 0.652 | 0.116 | 0.702 | 5e-66 | |
| 195402801 | 1421 | GJ15157 [Drosophila virilis] gi|19414085 | 0.652 | 0.111 | 0.702 | 6e-66 | |
| 24586174 | 963 | prickle, isoform A [Drosophila melanogas | 0.652 | 0.164 | 0.708 | 1e-65 |
| >gi|270010437|gb|EFA06885.1| hypothetical protein TcasGA2_TC009830 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 270 bits (689), Expect = 4e-70, Method: Compositional matrix adjust.
Identities = 123/158 (77%), Positives = 138/158 (87%)
Query: 2 LKPSKRCSMVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERK 61
+ P R VHLYFS+LPEDKVPYVNS GE+YR+RQLL QLPPHDNEVRYCHALS++ERK
Sbjct: 66 VPPGLRPDQVHLYFSALPEDKVPYVNSVGERYRVRQLLQQLPPHDNEVRYCHALSDEERK 125
Query: 62 ELRLFSAQRKREALGRGFVKQLVAPMFCENCEDELQTSDMSVFASRAGPNSCWHPGCFTC 121
ELRLFSAQRKREALGRG V+QL APM C+ CE+ L T D+ VFASRAGPN+CWHP CFTC
Sbjct: 126 ELRLFSAQRKREALGRGAVRQLPAPMQCDACEEMLATGDICVFASRAGPNTCWHPACFTC 185
Query: 122 SVCNELLVDLIYFYRGDKLYCGRHHAETLKPRCSACDE 159
+VC ELLVDLIYFY+ +LYCGRHHAET+KPRCSACDE
Sbjct: 186 TVCRELLVDLIYFYKEGRLYCGRHHAETIKPRCSACDE 223
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242007675|ref|XP_002424655.1| LIM domain only protein, putative [Pediculus humanus corporis] gi|212508129|gb|EEB11917.1| LIM domain only protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|195474329|ref|XP_002089444.1| GE19116 [Drosophila yakuba] gi|194175545|gb|EDW89156.1| GE19116 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|328927106|gb|AEB66928.1| MIP30239p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|12655372|emb|CAB57345.3| prickle sple isoform [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194863868|ref|XP_001970654.1| GG23268 [Drosophila erecta] gi|190662521|gb|EDV59713.1| GG23268 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|24586188|ref|NP_724538.1| prickle, isoform C [Drosophila melanogaster] gi|148887002|sp|A1Z6W3.1|PRIC1_DROME RecName: Full=Protein prickle; AltName: Full=Protein spiny legs gi|21627804|gb|AAF59281.2| prickle, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195027702|ref|XP_001986721.1| GH21524 [Drosophila grimshawi] gi|193902721|gb|EDW01588.1| GH21524 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195402801|ref|XP_002059993.1| GJ15157 [Drosophila virilis] gi|194140859|gb|EDW57330.1| GJ15157 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|24586174|ref|NP_724534.1| prickle, isoform A [Drosophila melanogaster] gi|21627798|gb|AAM68908.1| prickle, isoform A [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 242 | ||||||
| FB|FBgn0003090 | 1299 | pk "prickle" [Drosophila melan | 0.644 | 0.120 | 0.717 | 7.4e-63 | |
| UNIPROTKB|Q7QJT4 | 923 | pk "Protein prickle" [Anophele | 0.644 | 0.169 | 0.717 | 2.4e-62 | |
| UNIPROTKB|Q292U2 | 1353 | pk "Protein prickle" [Drosophi | 0.644 | 0.115 | 0.705 | 2.9e-62 | |
| UNIPROTKB|Q292U5 | 795 | esn "Protein espinas" [Drosoph | 0.644 | 0.196 | 0.711 | 3.7e-62 | |
| FB|FBgn0263934 | 785 | esn "espinas" [Drosophila mela | 0.644 | 0.198 | 0.711 | 4.8e-62 | |
| UNIPROTKB|Q174I2 | 916 | pk "Protein prickle" [Aedes ae | 0.644 | 0.170 | 0.711 | 1.1e-61 | |
| UNIPROTKB|F1N8U0 | 836 | PRICKLE2 "Uncharacterized prot | 0.644 | 0.186 | 0.666 | 1.2e-59 | |
| UNIPROTKB|Q90Z06 | 835 | prickle1-a "Prickle-like prote | 0.644 | 0.186 | 0.654 | 6.6e-58 | |
| UNIPROTKB|F1P3B6 | 832 | PRICKLE1 "Uncharacterized prot | 0.644 | 0.187 | 0.660 | 1.7e-57 | |
| MGI|MGI:1916034 | 832 | Prickle1 "prickle homolog 1 (D | 0.644 | 0.187 | 0.660 | 2.2e-57 |
| FB|FBgn0003090 pk "prickle" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 652 (234.6 bits), Expect = 7.4e-63, P = 7.4e-63
Identities = 112/156 (71%), Positives = 133/156 (85%)
Query: 4 PSKRCSMVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKEL 63
P R V LYFS +P+DKVPYVNSPGEQYR+RQLLHQLPPHDNEVRYCH+L+++ERKEL
Sbjct: 539 PGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
Query: 64 RLFSAQRKREALGRGFVKQLVAPMFCENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSV 123
RLFS QRKR+ALGRG V+QL++ C+ C+D + T D++VFA+R GPN+ WHP CF CSV
Sbjct: 599 RLFSTQRKRDALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSV 658
Query: 124 CNELLVDLIYFYRGDKLYCGRHHAETLKPRCSACDE 159
C ELLVDLIYF+R ++YCGRHHAETLKPRCSACDE
Sbjct: 659 CRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDE 694
|
|
| UNIPROTKB|Q7QJT4 pk "Protein prickle" [Anopheles gambiae (taxid:7165)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q292U2 pk "Protein prickle" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q292U5 esn "Protein espinas" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263934 esn "espinas" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q174I2 pk "Protein prickle" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N8U0 PRICKLE2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q90Z06 prickle1-a "Prickle-like protein 1-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3B6 PRICKLE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916034 Prickle1 "prickle homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 242 | |||
| cd09827 | 97 | cd09827, PET_Prickle, The PET domain of Prickle | 2e-45 | |
| pfam06297 | 106 | pfam06297, PET, PET Domain | 1e-40 | |
| cd09415 | 59 | cd09415, LIM1_Prickle, The first LIM domain of Pri | 6e-36 | |
| cd09027 | 82 | cd09027, PET, PET ((Prickle Espinas Testin) domain | 4e-33 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 1e-31 | |
| cd09841 | 59 | cd09841, LIM1_Prickle_3, The first LIM domain of P | 4e-28 | |
| cd09484 | 59 | cd09484, LIM1_Prickle_2, The first LIM domain of P | 3e-27 | |
| cd09483 | 59 | cd09483, LIM1_Prickle_1, The first LIM domain of P | 6e-27 | |
| cd09413 | 58 | cd09413, LIM1_Testin, The first LIM domain of Test | 3e-21 | |
| cd09829 | 88 | cd09829, PET_testin, The PET domain of Testin | 1e-19 | |
| cd09414 | 58 | cd09414, LIM1_LIMPETin, The first LIM domain of pr | 1e-17 | |
| cd09830 | 83 | cd09830, PET_LIMPETin_LIM-9, The PET domain of pro | 8e-16 | |
| cd09828 | 116 | cd09828, PET_OEBT, The PET domain of overexpressed | 9e-14 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 8e-10 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 2e-08 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 6e-08 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 2e-05 | |
| cd09459 | 55 | cd09459, LIM3_ENH, The third LIM domain of the Eni | 4e-05 | |
| cd09421 | 59 | cd09421, LIM3_LIMPETin, The third LIM domain of pr | 5e-05 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 9e-05 | |
| cd09332 | 52 | cd09332, LIM2_PINCH, The second LIM domain of prot | 1e-04 | |
| cd09363 | 54 | cd09363, LIM3_Enigma_like, The third LIM domain of | 2e-04 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 0.003 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 0.004 |
| >gnl|CDD|193602 cd09827, PET_Prickle, The PET domain of Prickle | Back alignment and domain information |
|---|
Score = 146 bits (371), Expect = 2e-45
Identities = 61/74 (82%), Positives = 69/74 (93%)
Query: 10 MVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQ 69
VH YFS LPEDKVPYVNSPGE+YRI+QLLHQLPPHDNEVRYC++LSE+E++ELRLFSAQ
Sbjct: 23 QVHAYFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDNEVRYCNSLSEEEKRELRLFSAQ 82
Query: 70 RKREALGRGFVKQL 83
RKREALGRG V+ L
Sbjct: 83 RKREALGRGIVRPL 96
|
The PET domain of Prickle: Prickle contains an N-terminal PET domain and three C-terminal LIM domains. Prickle has been implicated in regulation of cell movement in the planar cell polarity (PCP) pathway which requires the conserved Frizzled/Dishevelled (Dsh); Prickle interacts with Dishevelled, thereby modulating the activity of Frizzled/Dishevelled and the PCP signaling. Two forms of Prickle have been identified, namely Prickle 1 and Prickle 2. These are differentially expressed; Prickle 1 is found in fetal heart and hematological malignancies, while Prickle 2 is expressed in fetal brain, adult cartilage, pancreatic islet, and some types of timorous cells. The PET domain is a protein-protein interaction domain, usually found in conjunction with the LIM domain, which is also involved in protein-protein interactions. The PET containing proteins serve as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 97 |
| >gnl|CDD|191489 pfam06297, PET, PET Domain | Back alignment and domain information |
|---|
| >gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|193601 cd09027, PET, PET ((Prickle Espinas Testin) domain is involved in protein-protein interactions | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3 | Back alignment and domain information |
|---|
| >gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2 | Back alignment and domain information |
|---|
| >gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|193604 cd09829, PET_testin, The PET domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|193605 cd09830, PET_LIMPETin_LIM-9, The PET domain of protein LIMPETin and LIM-9 | Back alignment and domain information |
|---|
| >gnl|CDD|193603 cd09828, PET_OEBT, The PET domain of overexpressed breast tumor protein (OEBT) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| PF06297 | 106 | PET: PET Domain; InterPro: IPR010442 The PET domai | 100.0 | |
| KOG1701|consensus | 468 | 99.91 | ||
| KOG1701|consensus | 468 | 99.79 | ||
| KOG2272|consensus | 332 | 99.65 | ||
| KOG4577|consensus | 383 | 99.6 | ||
| KOG2272|consensus | 332 | 99.55 | ||
| KOG1703|consensus | 479 | 99.55 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.5 | |
| KOG1703|consensus | 479 | 99.49 | ||
| KOG1044|consensus | 670 | 99.28 | ||
| KOG1044|consensus | 670 | 99.11 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.55 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 98.48 | |
| KOG1700|consensus | 200 | 98.15 | ||
| KOG4577|consensus | 383 | 97.71 | ||
| KOG1700|consensus | 200 | 97.66 | ||
| KOG1702|consensus | 264 | 97.21 | ||
| KOG0490|consensus | 235 | 96.07 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 95.3 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 88.47 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 83.57 |
| >PF06297 PET: PET Domain; InterPro: IPR010442 The PET domain is a ~110 amino acid motif in the N-terminal part of LIM domain proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-33 Score=213.84 Aligned_cols=84 Identities=60% Similarity=0.924 Sum_probs=82.2
Q ss_pred CCCCCCChHHHHHHHhcCCCCCCCCcCChhHHHHHHHHhhhCCCCCCCchhcccCCHHHHHHHHHHHHHhhhhccCCCcc
Q psy8090 1 MLKPSKRCSMVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQRKREALGRGFV 80 (242)
Q Consensus 1 w~p~~~~~~~~~~y~~~lp~~~~p~~~s~g~~~r~~ql~~qlP~~d~~~~~c~~l~e~e~~~~~~f~~~~~~~~~g~g~v 80 (242)
||||||++++|++||++||++++|++||+||+||++||++|||+||.|++||++|+++|+++|++|+++|+++++|+|.|
T Consensus 23 WvPpgl~~~~v~~Ym~~LP~~~vP~~gS~Ge~~R~~QL~~QLP~hD~d~~~C~~Lse~E~k~l~~F~~~rk~~alG~G~V 102 (106)
T PF06297_consen 23 WVPPGLSPELVEQYMSCLPEEKVPVVGSPGEKYRRRQLLYQLPPHDLDPRYCHSLSEEEKKELEDFVKQRKEEALGVGTV 102 (106)
T ss_pred ecCCCCChHHHHHHHHhCCCcCCCCCCCHHHHHHHHHHHHcCCcccCCHHHHhhCCHHHHHHHHHHHHHHHHHcCCeeEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccc
Q psy8090 81 KQLV 84 (242)
Q Consensus 81 ~~~~ 84 (242)
+.+|
T Consensus 103 ~~~~ 106 (106)
T PF06297_consen 103 KELP 106 (106)
T ss_pred EeCC
Confidence 8754
|
The domain was described in Drosophila proteins involved in cell differentiation and is named after Prickle, Espinas and Testin. PET domain proteins contain about three zinc-binding LIM domains (see PDOC00382 from INTERPRO, IPR001781 from INTERPRO) and are found among metazoans. The PET domain has been suggested to play a role in protein-protein interactions with proteins involved in planar polarity signalling or organisation of the cytoskeleton []. Some proteins known to contain a PET domain: Mammalian testin protein (Q9UGI8 from SWISSPROT), which may function as a tumour suppressor. Mammalian LIM domain only protein 6 (LMO6/Prickle3, O43900 from SWISSPROT). Fruit fly prickle (A1Z6W3 from SWISSPROT) and espinas (Q9U1I1 from SWISSPROT) proteins encoded by the tissue polarity gene prickle (pk), involved in the control of orientation of bristles and hairs. Mammalian prickle-like proteins 1 (Q96MT3 from SWISSPROT) and 2 (Q7Z3G6 from SWISSPROT). ; GO: 0008270 zinc ion binding |
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 242 | |||
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 5e-17 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 6e-15 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 3e-13 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 3e-11 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 4e-10 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 4e-10 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 1e-09 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-10 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 6e-10 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 6e-10 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 7e-10 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 9e-10 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 1e-09 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-09 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 4e-09 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 2e-09 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-04 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-09 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 3e-09 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 1e-05 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 3e-09 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 4e-09 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 5e-06 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 9e-09 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 1e-08 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 1e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 2e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 1e-04 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 3e-08 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-07 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 4e-08 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 5e-08 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 9e-08 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-07 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 2e-07 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 3e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-07 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 2e-07 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 4e-07 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 5e-07 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 8e-07 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 2e-06 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 2e-06 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 1e-05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 9e-04 |
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
Score = 73.2 bits (180), Expect = 5e-17
Identities = 16/71 (22%), Positives = 26/71 (36%), Gaps = 4/71 (5%)
Query: 89 CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAE 148
C C + V N WH CF C+ C L + + + +K+ C +
Sbjct: 8 CVECRKPIGADSKEVHYK----NRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTR 63
Query: 149 TLKPRCSACDE 159
P+C C +
Sbjct: 64 EDSPKCKGCFK 74
|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.91 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.91 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.91 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.89 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.88 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.88 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.85 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.85 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.78 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.68 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.66 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.65 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.65 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.65 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.64 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.64 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.64 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.61 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.61 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.6 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.6 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.6 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.6 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.59 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.59 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.58 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.58 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.57 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.56 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.56 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.56 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.55 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.55 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.54 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.54 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.53 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.53 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.53 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.53 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.53 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.51 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.5 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.47 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.46 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.43 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.43 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.43 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.41 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.4 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.38 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.25 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.24 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.22 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.22 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.21 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.19 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.19 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.13 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.13 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.1 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.1 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.08 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.04 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.03 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.02 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.02 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.01 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.0 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 98.98 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 98.97 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 98.96 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 98.96 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 98.95 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 98.95 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 98.94 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 98.93 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 98.91 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 98.85 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 98.85 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 98.84 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 98.77 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 98.77 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 98.59 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 97.59 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 95.42 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
Probab=99.91 E-value=2.6e-25 Score=185.70 Aligned_cols=128 Identities=16% Similarity=0.245 Sum_probs=108.3
Q ss_pred ccccccCCCceecCccccccccCCCCCcccCCcccccccCCCCCCccceeeCCeeccHhhhhcccCCC------------
Q psy8090 86 PMFCENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKPR------------ 153 (242)
Q Consensus 86 ~~~C~~C~~~I~~~~~~v~~~r~~~~~~wH~~CF~C~~C~~~L~~~~~~~~dg~~yC~~~y~~~~~pr------------ 153 (242)
..+|.+|+++|..++.+. ++++.||++||+|..|+++|.+..|+.+||++||+.||.++|+|+
T Consensus 7 ~~~C~~C~~~I~~~~~v~-----a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~~ 81 (192)
T 1b8t_A 7 GKKCGVCQKAVYFAEEVQ-----CEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLS 81 (192)
T ss_dssp CEECTTTCCEECSSCCEE-----ETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCCCC
T ss_pred CCcCccCCCeecceeEEE-----eCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCccccccccccccEe
Confidence 347999999998776543 689999999999999999999989999999999999999999987
Q ss_pred ------------------------------------cccCCCcccCCCcceeeeeecCCCCCCCCCCCcccCCCcc--CC
Q psy8090 154 ------------------------------------CSACDEECQTSSQDILYYLTRDSERDLPDEYRTERLEHQR--DL 195 (242)
Q Consensus 154 ------------------------------------C~~C~~~I~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~f~--~~ 195 (242)
|++|+++|.++.. +.+.++.||.+||. .+
T Consensus 82 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~-------------v~a~~~~~H~~CF~C~~C 148 (192)
T 1b8t_A 82 TDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYAAEK-------------VIGAGKSWHKSCFRCAKC 148 (192)
T ss_dssp CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECTTTSCEECSSSC-------------EEETTEEECTTTCBCTTT
T ss_pred cCCCcccccccccccccCCCCcCccccccccCCCCcCCCCCCEecCcEE-------------EecCCCccchhcCCcccc
Confidence 5667777765431 23478999999993 24
Q ss_pred CCCCCCCCcccCCCCCCCHHHHhhhhcccccCCCCC
Q psy8090 196 PESYGTHRNSLNKEQNHSFDNLLKSNLKKLSLADSD 231 (242)
Q Consensus 196 ~~~~g~~~f~~~d~~~yC~~cy~~~~a~kc~~~~~~ 231 (242)
..++.+..|..+++++||..||.++|++||..++..
T Consensus 149 ~~~L~~~~~~~~~g~~yC~~cy~~~f~~kc~~C~~~ 184 (192)
T 1b8t_A 149 GKSLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQG 184 (192)
T ss_dssp CCBCCSSSEEEETTEEEEHHHHHHHTCCCCCCCCCC
T ss_pred CCCCCCCcccccCCEEeCHHHHHHhcCCcCCCCCCc
Confidence 567777789999999999999999999999988765
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.93 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.79 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.68 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.57 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.49 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.27 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.18 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.17 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.14 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.08 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.07 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.05 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.03 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 97.99 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.96 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.92 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.92 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.9 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.89 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.89 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.87 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 97.82 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.82 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.79 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.76 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.69 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.68 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.67 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.65 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.65 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.64 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.59 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.59 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.57 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.52 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.51 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.5 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.47 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.45 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.39 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.39 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.37 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.36 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.35 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.31 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.29 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.26 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.25 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.25 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.22 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.22 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.17 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.15 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.09 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.09 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.08 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.07 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.04 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.04 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.04 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.92 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.9 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.84 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 96.73 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 96.71 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.59 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 96.31 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.09 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.0 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 95.8 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.8 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.72 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.7 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.62 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.37 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.35 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.11 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 94.63 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 94.61 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 94.39 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 94.32 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 94.31 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 94.09 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 93.54 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 93.41 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 93.37 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 93.37 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 93.3 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 93.05 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 93.05 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 92.99 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 92.92 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 92.44 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 91.72 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 91.41 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 90.83 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 90.59 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 90.42 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 90.0 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 89.72 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 89.03 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 88.97 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 88.78 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 87.45 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 87.24 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 86.16 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 85.99 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 81.32 |
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Pinch (particularly interesting new Cys-His) protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.93 E-value=2e-10 Score=67.75 Aligned_cols=34 Identities=18% Similarity=0.561 Sum_probs=33.0
Q ss_pred ccccccCCCCCCccceeeCCeeccHhhhhcccCC
Q psy8090 119 FTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKP 152 (242)
Q Consensus 119 F~C~~C~~~L~~~~~~~~dg~~yC~~~y~~~~~p 152 (242)
|+|+.|+++|.+..||++||++||+.||.++|+|
T Consensus 1 F~C~~C~~~f~~~~F~e~~G~pYCe~~Y~~lFAP 34 (35)
T d1g47a2 1 FVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAP 34 (35)
T ss_dssp CCCTTTCCCCGGGCSEEETTEEECHHHHHHHCCC
T ss_pred CCCCCCcCCCCCCCeEEECCEecChHhHHhhcCC
Confidence 8999999999999999999999999999999987
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za1 g.39.1.3 (A:8-32) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cura2 g.39.1.3 (A:8-32) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|