Psyllid ID: psy8109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010-
MDPRPGCVDVMLPVIKIDPERYIQVLLEIKKEINRKSDNLSKLLTKFSSLKRGEYPYGLKKIKRGPRLHKEIDSAVERMVKEKLGEMDSNEENEEEEEEERGGKRSKKRKRKAQETLDLDDLGDIVAGRKGNWSITKTPAEKNSQAKTNGVPTKKPKVTQDQWNIVTVSDKKETSKNPQSSDSNSDKALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNSLKNKNKAKYR
ccccccccccHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHcHHHHHHHccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccEEEHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHccccccccccccHHHHHHHHHccccccccccccEEEEccccccccccHHHHHccc
cccccccccccccEEEcccccEEEHHHHcccccccccccHHHHHHHHHHHHHccccHHHcccccccccccccHHHHHHHHHHHHHHcccccccHcccccccccccHHHHHHHHcccccccccHHHHHHHccccEEEEEEccccccccccccccHHHHHHccccHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccEcccccEHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHcccHHEEEEEEHHHHHHHHHcccccccccccccccc
mdprpgcvdvmlpvikidPERYIQVLLEIKKEINRKSDNLSKLLTKfsslkrgeypyglkkikrgprlhKEIDSAVERMVKEKlgemdsneeneeeeeeerggkrskkRKRKAqetldlddlgdivagrkgnwsitktpaeknsqaktngvptkkpkvtqdqwNIVTVsdkketsknpqssdsnsdKALEEELTNIFKKfdllehpeylshsqGYKALCWALQEKKTDIAKLLVdkgvplnlvdkgvplnysrriietdtplhsaiLNSDIELVKLLLEkganplaieKSRNRTALHVAAIVESVDIVKLLFDYgaeksvnvqnvagltplhIACRRKCLEIVKILLdkgadinsgnddgctpLFCAIAQNCLEVFNYLVNhgcdlsvpegERTALHMASQFGNLEMVNYLLKHINinhqdkdgwtpltcsikgqASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIdinsendlgktpiyFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGvnlqdnkgctplhcaiVGNQLEVFNHLINsnaditmykndsplhlacatGNMDMITYAMKYFDVniendigetplhvaVSHGCLEAVKFLLNtknidvnhktkdgstaLFFACYDKRLDLVEILLEAnadvnlgdgtytpLYTALMKDPSLDIIKMLVKYgadvnltneacyymtplhyasyrgdcNDIARFLVEECNAditlrnfnnrtALNFAAFGNNLDLLKFLLKagadpdildlkdtspllssCRQGLYEIVDTLLEynadtnlrtikhgstalhTAAFHNQLDIIKLLLKYNAdinaedkygkiAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALlkcekpgdqekvsFYDILskhpaqvefyaknpqisncvkwkdlnlqfpiygdvICCKFTKVLNSLKnknkakyr
mdprpgcvdvmlpvikidperYIQVLLEIKKeinrksdnlsklltkfsslkrgeypyglkkikrgprlhkeidsAVERMVKEklgemdsneeneeeeeeerggkrskkrkrkaqetldlddlgdivagrkgnwsitktpaeknsqaktngvptkkpkvtqdqwnivtvsdkketsknpqssdsnsdkALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLlvdkgvplnlvdkgvplnysRRIIetdtplhsaILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNidvnhktkdgstALFFACYDKRLDLVEILLEanadvnlgdGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRaaniyvdkniMVQFLTTQVNDFYEECLREVALlkcekpgdQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLnslknknkakyr
MDPRPGCVDVMLPVIKIDPERYIQVLLEIKKEINRKSDNlsklltkfsslkRGEYPYGLKKIKRGPRLHKEIDSAVERMVKEKLGEMDsneeneeeeeeerggkrskkrkrkAQETLDLDDLGDIVAGRKGNWSITKTPAEKNSQAKTNGVPTKKPKVTQDQWNIVTVSDKKETSKNPQSSDSNSDKALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNSLKNKNKAKYR
******CVDVMLPVIKIDPERYIQVLLEIKKEINRK**NLSKLLTKFSSLKRGEYPYGLK***************************************************************DIVA*****************************************************************LTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNS**********
****PGCVDVMLPVIKIDPERYIQVLLEIKKEINRKSDNLSKLLTKFSSLKRGEYPYGLKKIKRGPRLHKEIDSAVERMVKEKLGEMDSNEENEEEEEEERGGKRSKKRKRKAQETLDLDDLGDIVAGRKGNWSITKTPAEKNSQAKTNGVPTKKPKVTQDQWNIVTVSDKKETSKNPQSSDSNSDKALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVL************
MDPRPGCVDVMLPVIKIDPERYIQVLLEIKKEINRKSDNLSKLLTKFSSLKRGEYPYGLKKIKRGPRLHKEIDSAVERMVKEKLG******************************TLDLDDLGDIVAGRKGNWSITKT*******************VTQDQWNIVTVS*******************LEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNSLKNKNKAKYR
****PGCVDVMLPVIKIDPERYIQVLLEIKKEIN*KSDNLSKLLTKFSSLKRGEYPYGLKKIKRGPRLHKEIDSAVERMVKEKLGEMD****************RSKKRKRKAQETLDLDDLGDIVAGRKGNWSITKTPAEKNSQAKTNGVPTKKPKVTQDQWNIVTVSDKKETSKNPQSSDSNSDKALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNS**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPRPGCVDVMLPVIKIDPERYIQVxxxxxxxxxxxxxxxxxxxxxFSSLKRGEYPYGLKKIKRGPRLHKEIDSAVERMxxxxxxxxxxxxxxxxxxxxxRGGKRSKKRKRKAQETLDLDDLGDIVAGRKGNWSITKTPAEKNSQAKTNGVPTKKPKVTQDQWNIVTVSDKKETSKNPQSSDSNSDKALEEELTNIFKKFDLLEHPEYLSHSQGYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYVDKNIMVQFLTTQVNDFYEECLREVALLKCEKPGDQEKVSFYDILSKHPAQVEFYAKNPQISNCVKWKDLNLQFPIYGDVICCKFTKVLNSLKNKNKAKYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1011 2.2.26 [Sep-21-2011]
Q12955 4377 Ankyrin-3 OS=Homo sapiens yes N/A 0.609 0.140 0.294 6e-64
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.606 0.325 0.293 2e-63
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes N/A 0.609 0.314 0.291 1e-62
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.604 0.328 0.293 6e-60
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.531 0.455 0.311 6e-57
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.629 0.160 0.301 1e-56
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.629 0.163 0.298 4e-55
Q5F478 990 Serine/threonine-protein no N/A 0.610 0.623 0.274 1e-49
Q8NB461076 Serine/threonine-protein no N/A 0.638 0.600 0.276 4e-49
Q8BTI71076 Serine/threonine-protein no N/A 0.638 0.600 0.275 4e-49
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function desciption
 Score =  246 bits (629), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 197/668 (29%), Positives = 321/668 (48%), Gaps = 52/668 (7%)

Query: 262 LHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVN 321
           LH A     +E+V  LL++ AN  A  K  N TALH+A++    ++VK+L   GA  +VN
Sbjct: 78  LHLASKEGHVEVVSELLQREANVDAATKKGN-TALHIASLAGQAEVVKVLVTNGA--NVN 134

Query: 322 VQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLV- 380
            Q+  G TPL++A +   LE+VK LLD GA  +   +DG TPL  A+ Q   +V + L+ 
Sbjct: 135 AQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE 194

Query: 381 ------------------------------NHGCDLSVPEGERTALHMASQFGNLEMVNY 410
                                         ++  D+    G  T LH+A+ +GN+ +   
Sbjct: 195 NDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSG-FTPLHIAAHYGNINVATL 253

Query: 411 LL-KHININHQDKDGWTPL-TCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYF 468
           LL +   ++   ++  TPL   S +G A++     +++ GA I AK  DG T LH     
Sbjct: 254 LLNRAAAVDFTARNDITPLHVASKRGNANMVKL--LLDRGAKIDAKTRDGLTPLHCGARS 311

Query: 469 GNLAMVNYLV-KHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCL 527
           G+  +V  L+ +   I S+   G +P++ A + +HL    LLL+    V        T L
Sbjct: 312 GHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTAL 371

Query: 528 HVACEFASIEMVSFLL-SHIGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKN 586
           HVA      ++   LL      N +   G TPLH A   N+++V   L+   A I     
Sbjct: 372 HVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTE 431

Query: 587 D--SPLHLACATGNMDMITYAMKY-FDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNI 643
              +P+H+A   G++++++  M +    N  N  GET LH+A   G  E V++L+     
Sbjct: 432 SGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGA 490

Query: 644 DVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGT-YTPLYTALMKDPSLDIIK 702
            V  K KD  T L  +    + D+V+ LL+  A  N    + YTPL+ +  ++   D+  
Sbjct: 491 QVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLS-AREGHEDVAA 549

Query: 703 MLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFA 762
            L+ +GA +++T +  +  TPLH A+  G   ++A  L+++ +A       +  T L+ A
Sbjct: 550 FLLDHGASLSITTKKGF--TPLHVAAKYGKL-EVANLLLQK-SASPDAAGKSGLTPLHVA 605

Query: 763 AFGNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHG 822
           A  +N  +   LL  GA P        +PL  + ++   +I  TLLEY AD N  T + G
Sbjct: 606 AHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVT-RQG 664

Query: 823 STALHTAAFHNQLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIE 882
             ++H AA    +D++ LLL  NA++N  +K G    H A Q    ++   L++ G++++
Sbjct: 665 IASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVD 724

Query: 883 KATKYRMT 890
             TK   T
Sbjct: 725 AQTKMGYT 732




Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments.
Homo sapiens (taxid: 9606)
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 Back     alignment and function description
>sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1011
189502738 1585 hypothetical protein Aasi_1435 [Candidat 0.648 0.413 0.351 2e-89
390357740 3120 PREDICTED: uncharacterized protein LOC75 0.652 0.211 0.321 5e-82
157106769789 ankyrin 2,3/unc44 [Aedes aegypti] gi|108 0.604 0.774 0.325 9e-79
390357742770 PREDICTED: serine/threonine-protein phos 0.644 0.846 0.307 1e-78
353328673946 ankyrin repeat domain protein [Wolbachia 0.747 0.799 0.299 4e-78
390367550 2382 PREDICTED: uncharacterized protein LOC75 0.650 0.276 0.316 2e-77
390342455 1487 PREDICTED: ankyrin-1-like [Strongylocent 0.655 0.445 0.298 5e-77
390349089 2331 PREDICTED: uncharacterized protein LOC58 0.666 0.289 0.318 6e-77
390368544 2160 PREDICTED: uncharacterized protein LOC10 0.626 0.293 0.319 1e-76
390343598 1639 PREDICTED: serine/threonine-protein phos 0.636 0.392 0.329 1e-76
>gi|189502738|ref|YP_001958455.1| hypothetical protein Aasi_1435 [Candidatus Amoebophilus asiaticus 5a2] gi|189498179|gb|ACE06726.1| hypothetical protein Aasi_1435 [Candidatus Amoebophilus asiaticus 5a2] Back     alignment and taxonomy information
 Score =  337 bits (864), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 252/717 (35%), Positives = 393/717 (54%), Gaps = 61/717 (8%)

Query: 214  GYKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIEL 273
            G  +L +A +E   ++ K LV+KG  +N  D+           + +T LH A    ++E+
Sbjct: 801  GVTSLHYACREGNLEVVKYLVEKGADINATDE-----------DGETLLHYACNKGNLEV 849

Query: 274  VKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHI 333
            VKLL++KGA+ + I+ +   TALH A   + ++IVK L D GA+  +  +N    T L  
Sbjct: 850  VKLLVDKGAD-INIKSNDQCTALHFATRYDHLEIVKYLLDKGAD--IQAKNKEVETLLIY 906

Query: 334  ACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGER 393
            AC++  LE+VK L+DKG+DIN  N +  T L  A     LE+  YL++ G D++V   ++
Sbjct: 907  ACKKGDLEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQ 966

Query: 394  -TALHMASQFGNLEMVNYLL-KHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADI 451
             TALH A+++ +LE+V YLL K  +IN ++ D WT L  + +    LE+   ++E GADI
Sbjct: 967  WTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATR-YNHLEIVKLLLEKGADI 1025

Query: 452  KAKLMDGTTALHLACYFGNLAMVNYLV-KHIDINSENDLGKTPIYFAIKNNHLEIFNLLL 510
             AK   G T LH AC  G+L +V YL+ K  DIN +N+   T ++FA + NHL+I  LLL
Sbjct: 1026 NAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLL 1085

Query: 511  KLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSH-IGVNLQDNKGCTPLHCAIVGNQLE 569
              GAD+  K K   T LH ACE   +E+V  LL     +N+++N   T LH A   N LE
Sbjct: 1086 DKGADINAKNKEGNTTLHKACENDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLE 1145

Query: 570  VFNHLINSNADITMYKND--SPLHLACATGNMDMITYAM-KYFDVNIENDIGETPLHVAV 626
            +  +L++  ADI +  ND  + LH A    ++ ++ Y + K  D+N++++   T LH A 
Sbjct: 1146 IVKYLLDKGADINVKNNDQWTALHFATRYDHLKIVKYLLDKGADINVKDNDQWTALHFAT 1205

Query: 627  SHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNL-GDGTY 685
             +  L+ VK LL  K  D++ K K+  T L +AC    L+LV+ LL+  AD+N+  +  +
Sbjct: 1206 RYDHLKIVKLLL-EKGADIHAKNKESETLLIYACKKGDLELVKYLLDKGADINVKNNDQW 1264

Query: 686  TPLY-----------------------------TALMK---DPSLDIIKMLVKYGADVNL 713
            T L+                             T L K   +  L+I+K+L+  GAD+N+
Sbjct: 1265 TALHFVTRYNHLEIVKYLLDKGADINAKNKYGNTTLHKACENDHLEIVKLLLDKGADINV 1324

Query: 714  TNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKF 773
             N   +  T LH+A+ R +  +I ++L+++  ADI ++N +   AL+FA   N+L+++K+
Sbjct: 1325 KNNDQW--TALHFAT-RYNHLEIVKYLLDK-GADINVKNNDQWIALHFATRYNHLEIVKY 1380

Query: 774  LLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHN 833
            LL  GAD ++ +      L  + R    +IV  LL+  AD N++      TALH A  ++
Sbjct: 1381 LLDKGADINVKNNDQWIALHFATRYNHLKIVKLLLDKGADINVKN-NDQWTALHFATRYD 1439

Query: 834  QLDIIKLLLKYNADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMT 890
             L+I+K LL   ADIN ++K    A H A +  +  IV  LLD G++I    KY  T
Sbjct: 1440 HLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNT 1496




Source: Candidatus Amoebophilus asiaticus 5a2

Species: Candidatus Amoebophilus asiaticus

Genus: Candidatus Amoebophilus

Family:

Order:

Class:

Phylum: Bacteroidetes

Superkingdom: Bacteria

>gi|390357740|ref|XP_001188247.2| PREDICTED: uncharacterized protein LOC755074 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|157106769|ref|XP_001649474.1| ankyrin 2,3/unc44 [Aedes aegypti] gi|108868779|gb|EAT33004.1| AAEL014742-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|390357742|ref|XP_003729086.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like, partial [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|353328673|ref|ZP_08971000.1| ankyrin repeat domain protein [Wolbachia endosymbiont wVitB of Nasonia vitripennis] gi|321272303|gb|ADW80188.1| ankyrin repeat protein [Wolbachia endosymbiont wVitA of Nasonia vitripennis phage WOVitA1] gi|321272355|gb|ADW80236.1| ankyrin repeat protein [Wolbachia endosymbiont wVitB of Nasonia vitripennis phage WOVitB] Back     alignment and taxonomy information
>gi|390367550|ref|XP_001190300.2| PREDICTED: uncharacterized protein LOC755521 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390342455|ref|XP_001200090.2| PREDICTED: ankyrin-1-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390349089|ref|XP_792227.3| PREDICTED: uncharacterized protein LOC587405 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390368544|ref|XP_003731471.1| PREDICTED: uncharacterized protein LOC100890587 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390343598|ref|XP_001184209.2| PREDICTED: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1011
UNIPROTKB|P16157 1881 ANK1 "Ankyrin-1" [Homo sapiens 0.611 0.328 0.299 2.8e-59
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.657 0.345 0.295 3.8e-59
RGD|1309620 1864 Ank1 "ankyrin 1, erythrocytic" 0.659 0.357 0.290 6e-59
UNIPROTKB|F1M3K5 1881 Ank1 "Protein Ank1" [Rattus no 0.659 0.354 0.290 6.1e-59
UNIPROTKB|F1M651 1888 Ank1 "Protein Ank1" [Rattus no 0.659 0.353 0.290 6.1e-59
FB|FBgn0011747 1549 Ank "Ankyrin" [Drosophila mela 0.599 0.391 0.302 6.8e-59
UNIPROTKB|F1NJ80 1699 ANK3 "Uncharacterized protein" 0.662 0.394 0.292 1.1e-58
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.662 0.385 0.292 1.1e-58
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.662 0.367 0.292 1.2e-58
UNIPROTKB|F1MY81 1136 ANK1 "Uncharacterized protein" 0.649 0.578 0.278 1.3e-58
UNIPROTKB|P16157 ANK1 "Ankyrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 641 (230.7 bits), Expect = 2.8e-59, P = 2.8e-59
 Identities = 192/642 (29%), Positives = 311/642 (48%)

Query:   262 LHSAILNSDIELVKLLLEKGANPLAIEKSRNRTALHVAAIVESVDIVKLLFDYGAEKSVN 321
             LH A  N D     +LL+   NP  + K+   T LH+AA  E++++ +LL + GA  +  
Sbjct:   177 LHIAARNDDTRTAAVLLQNDPNPDVLSKT-GFTPLHIAAHYENLNVAQLLLNRGASVNFT 235

Query:   322 VQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVN 381
              QN  G+TPLHIA RR  + +V++LLD+GA I +   D  TPL CA     + +   L++
Sbjct:   236 PQN--GITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLD 293

Query:   382 HGCDLSVP-EGERTALHMASQFGNLEMVNYLLKH-ININHQDKDGWTPLTCSIKGQASLE 439
             HG  +    +   + +HMA+Q  +L+ V  LL++   I+    D  TPL  +        
Sbjct:   294 HGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHC-GHHR 352

Query:   440 VFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKH-IDINSENDLGKTPIYFAI 498
             V   +++ GA   ++ ++G T LH+AC   ++ ++  L+K    I++  + G TP++ A 
Sbjct:   353 VAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVAS 412

Query:   499 KNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIG-VNLQDNKGCT 557
                HL I   LL+ GA   V      T LH+A      E+  +LL +   VN +     T
Sbjct:   413 FMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQT 472

Query:   558 PLHCAIVGNQLEVFNHLI--NSNADITMYKNDSPLHLACATGNMDMITYAM-KYFDVNIE 614
             PLHCA       +   L+  N+N ++      +PLH+A   G+++ +   + K       
Sbjct:   473 PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACM 532

Query:   615 NDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEA 674
                G TPLHVA  +G +   + LL  ++   N   K+G T L  A +   LD+V++LL  
Sbjct:   533 TKKGFTPLHVAAKYGKVRVAELLLE-RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 591

Query:   675 NADVN--LGDGTYTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGD 732
                 +    +G YTPL+ A  K   +++ + L++YG   N   E+   +TPLH A+  G 
Sbjct:   592 GGSPHSPAWNG-YTPLHIAA-KQNQVEVARSLLQYGGSANA--ESVQGVTPLHLAAQEGH 647

Query:   733 CNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDTSPL 792
                +A  L ++ N +  L N +  T L+  A   ++ +   L+K G   D       +PL
Sbjct:   648 AEMVALLLSKQANGN--LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPL 705

Query:   793 LSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAED 852
               +   G  ++V  LL++ AD N +T K G + LH AA     DI+ LLLK  A  N   
Sbjct:   706 HVASHYGNIKLVKFLLQHQADVNAKT-KLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS 764

Query:   853 KYGKIAFHSACQA---KNWDIVTFLLDAGSNIEKATKYRMTF 891
               G      A +       D++  + D  S +  + K+RM+F
Sbjct:   765 SDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSF 806


GO:0007165 "signal transduction" evidence=IEA
GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=IEA
GO:0015672 "monovalent inorganic cation transport" evidence=IEA
GO:0030863 "cortical cytoskeleton" evidence=IEA
GO:0048821 "erythrocyte development" evidence=IEA
GO:0016529 "sarcoplasmic reticulum" evidence=IEA
GO:0031430 "M band" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0005198 "structural molecule activity" evidence=NAS
GO:0007010 "cytoskeleton organization" evidence=NAS
GO:0030507 "spectrin binding" evidence=IDA;NAS;IPI
GO:0016323 "basolateral plasma membrane" evidence=NAS
GO:0008093 "cytoskeletal adaptor activity" evidence=IDA;TAS
GO:0045199 "maintenance of epithelial cell apical/basal polarity" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0019899 "enzyme binding" evidence=TAS;IPI
GO:0005856 "cytoskeleton" evidence=NAS
GO:0006887 "exocytosis" evidence=NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=TAS
GO:0005829 "cytosol" evidence=TAS
GO:0007411 "axon guidance" evidence=TAS
GO:0014731 "spectrin-associated cytoskeleton" evidence=IDA
GO:0051117 "ATPase binding" evidence=IPI
GO:0072661 "protein targeting to plasma membrane" evidence=IMP
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=IDA
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309620 Ank1 "ankyrin 1, erythrocytic" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3K5 Ank1 "Protein Ank1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M651 Ank1 "Protein Ank1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0011747 Ank "Ankyrin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ80 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY81 ANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-29
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-29
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-28
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-27
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-25
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-24
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-23
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-22
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-21
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-20
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-20
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-20
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 8e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-19
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-19
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-18
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-18
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-17
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-16
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-15
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-15
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-15
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-15
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-14
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-14
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-13
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-13
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-13
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-12
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 1e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-12
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-11
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-11
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-11
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-10
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-10
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-09
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-09
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-08
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 3e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-07
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-07
PHA02716764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 9e-07
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-06
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-06
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 1e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 4e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-05
smart0024830 smart00248, ANK, ankyrin repeats 7e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-05
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 1e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-04
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 1e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 3e-04
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 8e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 8e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 0.001
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.002
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 0.002
PHA02743166 PHA02743, PHA02743, Viral ankyrin protein; Provisi 0.002
PHA02917661 PHA02917, PHA02917, ankyrin-like protein; Provisio 0.002
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 0.003
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.004
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.004
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.004
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
 Score =  128 bits (325), Expect = 2e-31
 Identities = 81/299 (27%), Positives = 128/299 (42%), Gaps = 48/299 (16%)

Query: 241 NLVDKGVPLNYSRRIIETDTPLHSAILNS---DIELVKLLLEKGANPLAIEKSRNRTALH 297
            L+  G  +N+        TPLH  +  S     ++V+LLLE GA+  A E+    T LH
Sbjct: 32  RLLAAGADVNFRGEY--GKTPLHLYLHYSSEKVKDIVRLLLEAGADVNAPERC-GFTPLH 88

Query: 298 VAAIVESV-DIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCL--EIVKILLDKGADIN 354
           +     +  D++KLL   GA   VN ++  G TPLH+      +  +++++LL KGAD+N
Sbjct: 89  LYLYNATTLDVIKLLIKAGA--DVNAKDKVGRTPLHVYLSGFNINPKVIRLLLRKGADVN 146

Query: 355 SGNDDGCTPLFCAIAQN--CLEVFNYLVNHGCDLSVPEGE-RTALHMASQFGNLEMVNYL 411
           + +  G TPL   +      +E+   L++ G D+   +   R+ LH              
Sbjct: 147 ALDLYGMTPLAVLLKSRNANVELLRLLIDAGADVYAVDDRFRSLLH---HHLQ------- 196

Query: 412 LKHININHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFG-- 469
                              S K +A   +   +I AG D  A  M G T LH        
Sbjct: 197 -------------------SFKPRAR--IVRELIRAGCDPAATDMLGNTPLHSMATGSSC 235

Query: 470 -NLAMVNYLVKHIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCL 527
               ++  L+  I IN+ N  G+TP+++A   N+      L+ LGAD+        T L
Sbjct: 236 KRSLVLPLLIAGISINARNRYGQTPLHYAAVFNNPRACRRLIALGADINAVSSDGNTPL 294


Length = 471

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222925 PHA02743, PHA02743, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1011
KOG4177|consensus 1143 100.0
KOG4177|consensus 1143 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0508|consensus615 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4369|consensus 2131 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02795437 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 99.98
KOG0509|consensus 600 99.96
KOG0509|consensus 600 99.96
KOG4369|consensus 2131 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02884300 ankyrin repeat protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.93
KOG0502|consensus296 99.92
KOG0502|consensus296 99.92
KOG0507|consensus 854 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0507|consensus 854 99.89
KOG0514|consensus452 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.87
TIGR00870743 trp transient-receptor-potential calcium channel p 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.86
KOG0505|consensus 527 99.85
KOG0505|consensus 527 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.84
KOG0514|consensus452 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.8
PHA02741169 hypothetical protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG0512|consensus228 99.78
KOG0512|consensus228 99.76
PHA02741169 hypothetical protein; Provisional 99.75
PHA02736154 Viral ankyrin protein; Provisional 99.71
KOG0195|consensus 448 99.7
KOG3676|consensus 782 99.7
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
KOG0195|consensus 448 99.65
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.58
KOG4214|consensus117 99.57
KOG3676|consensus782 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.41
KOG4214|consensus117 99.4
KOG1710|consensus 396 99.38
KOG0515|consensus752 99.36
KOG1710|consensus396 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.3
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.29
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.28
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.28
KOG0515|consensus752 99.27
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.22
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.2
KOG0818|consensus 669 98.63
KOG0782|consensus1004 98.63
KOG0506|consensus622 98.6
PF1360630 Ank_3: Ankyrin repeat 98.59
KOG0783|consensus 1267 98.54
KOG0783|consensus 1267 98.53
PF1360630 Ank_3: Ankyrin repeat 98.5
KOG0506|consensus622 98.45
KOG0818|consensus669 98.44
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.44
KOG0782|consensus1004 98.42
KOG0705|consensus749 98.36
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.34
KOG0705|consensus749 98.24
KOG3609|consensus 822 98.17
KOG3609|consensus 822 98.13
KOG0511|consensus 516 98.08
KOG0522|consensus 560 98.0
KOG0522|consensus560 97.95
KOG2384|consensus223 97.86
KOG0521|consensus785 97.85
KOG2384|consensus223 97.85
KOG0511|consensus516 97.83
KOG0521|consensus785 97.61
KOG0520|consensus 975 97.42
KOG0520|consensus 975 97.39
PLN03077857 Protein ECB2; Provisional 96.93
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.63
KOG2505|consensus591 96.32
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.91
PLN03077857 Protein ECB2; Provisional 95.85
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.63
KOG2505|consensus591 95.59
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.44
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.11
KOG3911|consensus378 94.06
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 93.56
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.14
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 92.2
PLN032181060 maturation of RBCL 1; Provisional 90.87
PLN032181060 maturation of RBCL 1; Provisional 90.54
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.08
KOG3911|consensus378 84.37
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.96
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=9.3e-66  Score=601.43  Aligned_cols=623  Identities=32%  Similarity=0.444  Sum_probs=519.6

Q ss_pred             chHHHHHHHcCCHHHHHHHHHCCCCCCcccCCCCCccccCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCc
Q psy8109         215 YKALCWALQEKKTDIAKLLVDKGVPLNLVDKGVPLNYSRRIIETDTPLHSAILNSDIELVKLLLEKGANPLAIEKSRNRT  294 (1011)
Q Consensus       215 ~t~L~~Aa~~G~~~iv~~Ll~~g~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~g~t  294 (1011)
                      .-+|+.||++|+.+.+..|++.....+....           .+.||+|+|+-.|+.+++++|+..|+.++..... |.|
T Consensus        22 ~~~l~~a~r~~~~~~~~~l~~~e~~~~~~sk-----------~~~~pl~~aa~~~~~~v~~~ll~~~a~v~~~~~~-~~~   89 (1143)
T KOG4177|consen   22 LPALHIAARNDDTNAAKLLLQNEHNADVDSK-----------SGFTPLHIAAHYGNENVAELLLNRGAIVNATARN-GIT   89 (1143)
T ss_pred             chHHHHHHhccchhhcccccccccccchhcc-----------cccCHHHHHhhhhhhhhhhhhhccccccCccccc-Ccc
Confidence            3568888888888888888876554443333           6678888888888888888888888887766665 788


Q ss_pred             HHHHHHHhCCHHHHHHHHHcCCCCCCcccCCCCCCHHHHHHhcCcHHHHHHHHHCCCCCccCCCCCCcHHHHHHHcCChh
Q psy8109         295 ALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLE  374 (1011)
Q Consensus       295 ~L~~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~~ga~~n~~~~~g~t~L~~A~~~g~~~  374 (1011)
                      |||.|+..|+.++++.|+..|+  .++..+.+|.||||.|+..|+.+++.+|+..|++++.++..|.||+++|+.   ..
T Consensus        90 plh~a~~~~~a~~v~~ll~~ga--~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l~~a~~---~~  164 (1143)
T KOG4177|consen   90 PLHVASKRGDAEMVKLLLCRGA--QIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPLHMAAQ---VA  164 (1143)
T ss_pred             HHHHHHhhcchhHHHHHHhccC--chhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCchhhhcc---hh
Confidence            8888888888888888888888  677788888888888888888888888888888888888888888888877   66


Q ss_pred             HHHHHHhcCCCCCCCCCCCcHHHHHHhcCCHHHHHHHHhcc-CccCCCCCCCcHhHHHHhcCCCHHHHHHHHHcCCCccc
Q psy8109         375 VFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLKHI-NINHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKA  453 (1011)
Q Consensus       375 iv~~Ll~~g~~~~~~~~~~t~L~~Aa~~g~~~iv~~Ll~~~-~~~~~~~~~~t~l~~a~~~~~~~~i~~~Ll~~g~~~~~  453 (1011)
                      .+.+|.++-.     .... +++.|+..++.++++.++... +.+..+..+.||+|.++.. ...+++++++.+|+++..
T Consensus       165 ~~~ll~~~~~-----~d~l-~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~-nri~~~eLll~~gadv~a  237 (1143)
T KOG4177|consen  165 CARLLLEYKA-----PDYL-RLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKK-NRIKVVELLLKHGADVSA  237 (1143)
T ss_pred             hhHHhhhccc-----chhh-hhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccc-cccceeeeeeeccCcCCc
Confidence            6677766655     1112 667788888888888887765 6777777777777774433 367777777777777777


Q ss_pred             ccCCCChHHHHHHHcCCHHHHHHHHh-ccCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccCCCCCHHHHHHH
Q psy8109         454 KLMDGTTALHLACYFGNLAMVNYLVK-HIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACE  532 (1011)
Q Consensus       454 ~~~~g~t~L~~Aa~~g~~~iv~~Ll~-~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~t~L~~A~~  532 (1011)
                      .+..|.+|||.|+..|+++++.+|+. ++.++..+..|.||+|.|+..+..++.++|+++|+++........||++.|..
T Consensus       238 ~d~~gl~~lh~a~~~g~~~i~~~l~~~ga~~~~~~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~~~~kt~l~~a~~  317 (1143)
T KOG4177|consen  238 KDESGLTPLHVAAFMGHLDIVKLLLQHGASVNVSTVRGETPLHMAARAGQVEVCKLLLQNGADVLAKARDDQTPLHIASR  317 (1143)
T ss_pred             ccccCccHHHHHHhccchhHHHHHHhcccccCcccccccCcchhhhccchhhhHhhhhccCcccccccccccChhhhhcc
Confidence            77777777777777777777777777 67777777777777777777777777777777777777777777777777777


Q ss_pred             hCCHHHHHHHHhc-cCCCCCCCCCCCHHHHHHhcCCHHHHHHHHhCCCCccccCCCCHHHHHHHcCChhhHHHHHhhccc
Q psy8109         533 FASIEMVSFLLSH-IGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDV  611 (1011)
Q Consensus       533 ~g~~~iv~~Ll~~-~~~~~~~~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~t~l~~A~~~g~~~iv~~Ll~~~~~  611 (1011)
                      .|+.+++.+++.. ...+..+..+.+|+|.++..++.++..++...+..                              .
T Consensus       318 ~g~~~i~~~~l~~~~~~~aar~~g~t~lHlaa~~~~~~~~~~l~~~~~~------------------------------~  367 (1143)
T KOG4177|consen  318 LGHEEIVHLLLQAGATPNAARTAGYTPLHLAAKEGQVEVAGALLEHGAQ------------------------------R  367 (1143)
T ss_pred             cchHHHHHHHhhccCCccccCcCCcccccHhhhhhhHHHHHHhhccccc------------------------------c
Confidence            7777777777776 66667777777777777777777766666655543                              2


Q ss_pred             cccCCCCCcHHHHHHHcCCHHHHHHHHhhCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCcCCCC-CCcHHHH
Q psy8109         612 NIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDG-TYTPLYT  690 (1011)
Q Consensus       612 ~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~-~~t~L~~  690 (1011)
                      ...+..+.||+|.|+..|..+++++++. .|++++.....|.||||.|+..++..+++.++++|++++..+. +.|++|.
T Consensus       368 ~~a~~k~~~pl~la~~~g~~~~v~Lll~-~ga~~~~~gk~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhv  446 (1143)
T KOG4177|consen  368 RQAEEKGFTPLHLAVKSGRVSVVELLLE-AGADPNSAGKNGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHV  446 (1143)
T ss_pred             CcccccCCcchhhhcccCchhHHHhhhh-ccCCcccCCCCCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhh
Confidence            3456678899999999999999999998 8999999999999999999999999999999999999998887 8999999


Q ss_pred             HHHcCCCHHHHHHHHhCCCCCCccCCCCCCCcHHHHHHHCCCHHHHHHHHHHhcCCCcccccCCCccHHHHHHhCCCHHH
Q psy8109         691 ALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDL  770 (1011)
Q Consensus       691 aa~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~t~l~~A~~~g~~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~Aa~~g~~~i  770 (1011)
                      ++......++...+++.|.+++.....  |.||||.|+..|+ .++++.|++. ++..+.....+-+++|.|...+...+
T Consensus       447 aa~~g~~~~~~~~l~~~g~~~n~~s~~--G~T~Lhlaaq~Gh-~~~~~llle~-~~~~~~~~~~~l~~lhla~~~~~v~~  522 (1143)
T KOG4177|consen  447 AAKKGRYLQIARLLLQYGADPNAVSKQ--GFTPLHLAAQEGH-TEVVQLLLEG-GANDNLDAKKGLTPLHLAADEDTVKV  522 (1143)
T ss_pred             hhhcccHhhhhhhHhhcCCCcchhccc--cCcchhhhhccCC-chHHHHhhhc-CCccCccchhccchhhhhhhhhhHHH
Confidence            998333888899999999999999888  9999999999999 9999999998 78888888899999999999999999


Q ss_pred             HHHHHHCCCCCCCCCcCCCCcccccccCChHHHHHHHHHcCCCccccccCCCChHHHHHHHcCCHHHHHHHHhccCCccc
Q psy8109         771 LKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINA  850 (1011)
Q Consensus       771 v~~Ll~~gad~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~~ga~in~  850 (1011)
                      ++.++++|++++.++..|.||||.|+..|+..+|++|+++|++++. .++.|+||||.||..|+.+|+.+|+++|+++|.
T Consensus       523 ~~~l~~~ga~v~~~~~r~~TpLh~A~~~g~v~~VkfLLe~gAdv~a-k~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~vna  601 (1143)
T KOG4177|consen  523 AKILLEHGANVDLRTGRGYTPLHVAVHYGNVDLVKFLLEHGADVNA-KDKLGYTPLHQAAQQGHNDIAELLLKHGASVNA  601 (1143)
T ss_pred             HHHHhhcCCceehhcccccchHHHHHhcCCchHHHHhhhCCccccc-cCCCCCChhhHHHHcChHHHHHHHHHcCCCCCc
Confidence            9999999999999999999999999999999999999999999998 669999999999999999999999999999999


Q ss_pred             ccCCCCCHHHHHHHcCCHHHHHHHHhcCCC-----cccccccCCCHHhhHHh
Q psy8109         851 EDKYGKIAFHSACQAKNWDIVTFLLDAGSN-----IEKATKYRMTFESSKVV  897 (1011)
Q Consensus       851 ~d~~g~taL~~A~~~g~~~iv~~Ll~~ga~-----~~~~~~~g~t~l~~a~~  897 (1011)
                      .|.+|.|||++|++.|+++++++|+..|++     +...+.+|.+|...+..
T Consensus       602 ~d~~g~TpL~iA~~lg~~~~~k~l~~~~~~~~~~~~~~e~~~g~~p~~v~e~  653 (1143)
T KOG4177|consen  602 ADLDGFTPLHIAVRLGYLSVVKLLKVVTATPAATDPVKENRKGAVPEDVAEE  653 (1143)
T ss_pred             ccccCcchhHHHHHhcccchhhHHHhccCccccccchhhhhcccChhhHHHH
Confidence            999999999999999999999999999999     66678889999887654



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG3911|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3911|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-35
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-32
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-28
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-20
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-20
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-17
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-16
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 6e-20
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-15
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-12
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 3e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-19
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-14
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-19
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-19
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-14
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-12
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 9e-19
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-18
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-18
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-18
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-15
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-18
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 8e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-12
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-18
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-18
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-18
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-14
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-14
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-12
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-18
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-17
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-18
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-12
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-12
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-18
1uoh_A226 Human Gankyrin Length = 226 8e-18
1uoh_A226 Human Gankyrin Length = 226 2e-14
1uoh_A226 Human Gankyrin Length = 226 5e-14
1uoh_A226 Human Gankyrin Length = 226 5e-12
1uoh_A226 Human Gankyrin Length = 226 8e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-17
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-17
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-15
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-07
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-17
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 6e-13
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-07
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-17
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-17
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-17
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-15
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-14
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-12
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-11
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-11
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-17
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-16
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-13
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 6e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-17
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-17
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-15
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-14
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-12
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-11
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-17
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-17
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-14
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-16
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-17
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-16
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-15
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-15
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-09
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-15
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-09
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-15
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 6e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-14
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-14
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 6e-14
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-09
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 6e-06
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 4e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-13
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-13
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-13
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-12
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-11
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 7e-13
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-12
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-11
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-12
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 8e-08
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-12
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 9e-12
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 3e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-11
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-11
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 6e-11
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 9e-11
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-10
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-10
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-10
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-10
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-08
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 6e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 9e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-10
3uxg_A172 Crystal Structure Of Rfxank Length = 172 8e-09
3uxg_A172 Crystal Structure Of Rfxank Length = 172 7e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 5e-10
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-08
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-10
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 5e-06
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 4e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-09
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-09
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 6e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-09
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-08
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-09
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 6e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 5e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 9e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 6e-08
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 3e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 5e-06
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 3e-09
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 3e-09
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-09
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 7e-09
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 5e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 6e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 6e-08
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 8e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-07
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-07
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 5e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 7e-07
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 5e-04
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 8e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 5e-04
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 2e-06
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 6e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 4e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 4e-06
1ycs_B239 P53-53bp2 Complex Length = 239 4e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-05
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 1e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 1e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 2e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 8e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 2e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 3e-04
1d9s_A136 Tumor Suppressor P15(Ink4b) Structure By Comparativ 7e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 8e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 148 bits (374), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 121/373 (32%), Positives = 186/373 (49%), Gaps = 12/373 (3%) Query: 328 LTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLS 387 LTPLH+A L IVK LL +GA N N TPL A EV YL+ + ++ Sbjct: 15 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 74 Query: 388 V-PEGERTALHMASQFGNLEMVNYLLK-HININHQDKDGWTPLTCSIKGQASLEVFHSII 445 + ++T LH A++ G+ MV LL+ + N N G TPL + + + +E +++ Sbjct: 75 AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAR-EGHVETVLALL 133 Query: 446 EAGADIKAKLMDGTTALHLACYFGNLAMVNYLV-KHIDINSENDLGKTPIYFAIKNNHLE 504 E A G T LH+A +G + + L+ + N+ G TP++ A+ +N+L+ Sbjct: 134 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLD 193 Query: 505 IFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSHIG-VNLQDNKGCTPLHCAI 563 I LLL G + +T LH+A + +E+ LL + G N + +G TPLH A Sbjct: 194 IVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA 253 Query: 564 VGNQLEVFNHLIN--SNADITMYKNDSPLHLACATGNMDMITYAMKY-FDVNIENDIGET 620 E+ L++ +N ++ +PLHL G++ + +K+ V+ +G T Sbjct: 254 QEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYT 313 Query: 621 PLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVN- 679 PLHVA +G ++ VKFLL + DVN KTK G + L A D+V +LL+ A N Sbjct: 314 PLHVASHYGNIKLVKFLLQHQ-ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNE 372 Query: 680 -LGDGTYTPLYTA 691 DGT TPL A Sbjct: 373 VSSDGT-TPLAIA 384
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1011
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-122
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-121
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-121
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-117
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-84
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-55
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-92
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-88
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-87
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-78
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-30
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-86
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-80
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-80
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-71
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-50
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-42
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-80
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-60
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-78
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-73
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-71
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-63
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-54
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-76
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-70
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-66
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-66
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-66
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-61
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-40
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-37
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-74
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-70
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-66
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-66
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-65
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-57
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-57
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-26
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-73
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-72
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-69
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-67
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-65
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-65
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-58
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-47
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-39
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-28
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-69
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-64
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-57
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-55
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-69
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-60
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-59
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-59
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-58
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-39
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-68
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-67
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-63
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-59
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-59
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-57
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-40
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-67
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-65
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-63
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-55
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-33
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-64
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-63
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-58
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-40
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-63
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-53
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-52
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-50
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-45
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-42
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-40
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-61
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-60
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-60
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-58
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-56
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-53
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-53
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-47
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-47
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-60
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-55
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-54
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-48
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-47
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-47
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-42
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-56
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-55
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-49
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-45
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-44
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-40
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-25
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-54
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-52
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-46
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-36
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-52
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-49
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-49
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-41
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-33
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-52
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-39
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-34
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-34
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-45
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-42
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-40
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-37
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-36
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-50
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-42
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-40
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-37
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-34
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-50
2rfa_A232 Transient receptor potential cation channel subfa 9e-47
2rfa_A232 Transient receptor potential cation channel subfa 7e-46
2rfa_A232 Transient receptor potential cation channel subfa 4e-43
2rfa_A232 Transient receptor potential cation channel subfa 3e-42
2rfa_A232 Transient receptor potential cation channel subfa 4e-27
2rfa_A232 Transient receptor potential cation channel subfa 8e-27
2rfa_A232 Transient receptor potential cation channel subfa 3e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-49
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-45
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-44
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-38
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-46
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-46
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-46
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-43
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-40
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-39
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-49
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-43
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-41
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-39
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-39
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-35
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-30
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-48
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-47
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-46
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-40
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-38
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-37
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-48
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-41
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-40
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-39
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-46
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-44
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-40
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-38
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-36
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-36
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-46
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-37
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-34
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-33
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-31
2etb_A256 Transient receptor potential cation channel subfam 1e-45
2etb_A256 Transient receptor potential cation channel subfam 4e-35
2etb_A256 Transient receptor potential cation channel subfam 1e-33
2etb_A256 Transient receptor potential cation channel subfam 1e-32
2etb_A256 Transient receptor potential cation channel subfam 1e-21
2etb_A256 Transient receptor potential cation channel subfam 1e-12
2pnn_A273 Transient receptor potential cation channel subfa 3e-44
2pnn_A273 Transient receptor potential cation channel subfa 2e-39
2pnn_A273 Transient receptor potential cation channel subfa 6e-35
2pnn_A273 Transient receptor potential cation channel subfa 2e-34
2pnn_A273 Transient receptor potential cation channel subfa 1e-33
2pnn_A273 Transient receptor potential cation channel subfa 4e-33
2pnn_A273 Transient receptor potential cation channel subfa 4e-26
2pnn_A273 Transient receptor potential cation channel subfa 3e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-44
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-40
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-34
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-34
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-42
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-31
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-31
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-41
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-25
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-40
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-37
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-36
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-36
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-33
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-39
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-36
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-32
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-32
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-27
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-39
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-27
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-38
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-33
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-33
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-33
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-32
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-32
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-29
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-28
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-37
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-37
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-36
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-32
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-30
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-37
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-32
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-30
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-35
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-35
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-34
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-34
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-33
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-35
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-34
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-27
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-34
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-33
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-30
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-33
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-30
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-28
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-15
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  380 bits (978), Expect = e-122
 Identities = 128/510 (25%), Positives = 197/510 (38%), Gaps = 83/510 (16%)

Query: 315 GAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADINSGNDDGCTPLFCAIAQNCLE 374
           G          +GLTPLH+A     L IVK LL +GA  N  N    TPL  A      E
Sbjct: 4   GIS--GGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTE 61

Query: 375 VFNYLVNHGCDL-SVPEGERTALHMASQFGNLEMVNYLLKH-ININHQDKDGWTPLTCSI 432
           V  YL+ +   + +  + ++T LH A++ G+  MV  LL++  N N     G TPL    
Sbjct: 62  VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL---- 117

Query: 433 KGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNLAMVNYLVKH-IDINSENDLGK 491
                                         H+A   G++  V  L++           G 
Sbjct: 118 ------------------------------HIAAREGHVETVLALLEKEASQACMTKKGF 147

Query: 492 TPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEMVSFLLSH-IGVNL 550
           TP++ A K   + +  LLL+  A      K+  T LHVA    ++++V  LL      + 
Sbjct: 148 TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS 207

Query: 551 QDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFD 610
               G TPLH A   NQ+EV   L+                                   
Sbjct: 208 PAWNGYTPLHIAAKQNQVEVARSLLQYGGSA----------------------------- 238

Query: 611 VNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEI 670
            N E+  G TPLH+A   G  E V  LL+ K  + N   K G T L     +  + + ++
Sbjct: 239 -NAESVQGVTPLHLAAQEGHAEMVALLLS-KQANGNLGNKSGLTPLHLVAQEGHVPVADV 296

Query: 671 LLEANADVNLGDGT-YTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASY 729
           L++    V+      YTPL+ A     ++ ++K L+++ ADVN   +     +PLH A+ 
Sbjct: 297 LIKHGVMVDATTRMGYTPLHVASHYG-NIKLVKFLLQHQADVNAKTK--LGYSPLHQAAQ 353

Query: 730 RGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLKAGADPDILDLKDT 789
           +G   DI   L++   A     + +  T L  A     + +   L     +   + + D 
Sbjct: 354 QG-HTDIVTLLLKN-GASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSD- 410

Query: 790 SPLLSSCRQGLYEIVDTLLEYNADTNLRTI 819
                  R    E VD +L+ + D     I
Sbjct: 411 -----KHRMSFPETVDEILDVSEDEGEELI 435


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1011
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.62
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.59
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=7.2e-58  Score=529.88  Aligned_cols=396  Identities=28%  Similarity=0.365  Sum_probs=304.4

Q ss_pred             cCCCcccccCCCChHHHHHHHcCCHHHHHHHHh-ccCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccCCCCC
Q psy8109         447 AGADIKAKLMDGTTALHLACYFGNLAMVNYLVK-HIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFT  525 (1011)
Q Consensus       447 ~g~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~-~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~t  525 (1011)
                      .|++++..+..|.||||+|+..|+.++|++|++ +.+++..+..|.||||+|+..|+.+++++|++.|++++..+..|.|
T Consensus         3 ~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t   82 (437)
T 1n11_A            3 PGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQT   82 (437)
T ss_dssp             ------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCC
T ss_pred             CCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCC
Confidence            567777777777777777777777777777777 6677777777777777777777777777777777777777777777


Q ss_pred             HHHHHHHhCCHHHHHHHHhc-cCCCCCCCCCCCHHHHHHhcCCHHHHHHHHhCCCCccccCCCCHHHHHHHcCChhhHHH
Q psy8109         526 CLHVACEFASIEMVSFLLSH-IGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITY  604 (1011)
Q Consensus       526 ~L~~A~~~g~~~iv~~Ll~~-~~~~~~~~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~t~l~~A~~~g~~~iv~~  604 (1011)
                      |||+|+..|+.+++++|+++ ++++..+..|.|||++|+..|+.+++++|++.+++.                       
T Consensus        83 ~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-----------------------  139 (437)
T 1n11_A           83 PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQ-----------------------  139 (437)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCS-----------------------
T ss_pred             HHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCC-----------------------
Confidence            77777777777777777666 555566666666666666666666666666655432                       


Q ss_pred             HHhhccccccCCCCCcHHHHHHHcCCHHHHHHHHhhCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCcCCCCC
Q psy8109         605 AMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDGT  684 (1011)
Q Consensus       605 Ll~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~  684 (1011)
                             +..+..|.||||.|+..|+.+++++|++ .|++++..+..|.|||++|+..|+.+++++|+++|++++     
T Consensus       140 -------~~~~~~g~t~L~~A~~~g~~~~v~~Ll~-~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~-----  206 (437)
T 1n11_A          140 -------ACMTKKGFTPLHVAAKYGKVRVAELLLE-RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH-----  206 (437)
T ss_dssp             -------CCCCTTSCCHHHHHHHTTCHHHHHHHHH-TTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSC-----
T ss_pred             -------cCCCCCCCCHHHHHHHcCCHHHHHHHHh-CCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-----
Confidence                   2233456666666666666666666666 566666666666666666666666666666666555443     


Q ss_pred             CcHHHHHHHcCCCHHHHHHHHhCCCCCCccCCCCCCCcHHHHHHHCCCHHHHHHHHHHhcCCCcccccCCCccHHHHHHh
Q psy8109         685 YTPLYTALMKDPSLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAF  764 (1011)
Q Consensus       685 ~t~L~~aa~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~t~l~~A~~~g~~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~Aa~  764 (1011)
                                                  ..+..  |.||||+|+..|+ .+++++|++. |++++..+..|.||||+|+.
T Consensus       207 ----------------------------~~~~~--g~t~L~~A~~~~~-~~~~~~Ll~~-g~~~~~~~~~g~t~L~~A~~  254 (437)
T 1n11_A          207 ----------------------------SPAWN--GYTPLHIAAKQNQ-VEVARSLLQY-GGSANAESVQGVTPLHLAAQ  254 (437)
T ss_dssp             ----------------------------CCCTT--CCCHHHHHHHTTC-HHHHHHHHHT-TCCTTCCCTTCCCHHHHHHH
T ss_pred             ----------------------------CcCCC--CCCHHHHHHHcCC-HHHHHHHHHc-CCCCCCCCCCCCCHHHHHHH
Confidence                                        33333  7889999999998 8999999988 88899889999999999999


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCcCCCCcccccccCChHHHHHHHHHcCCCccccccCCCChHHHHHHHcCCHHHHHHHHhc
Q psy8109         765 GNNLDLLKFLLKAGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKY  844 (1011)
Q Consensus       765 ~g~~~iv~~Ll~~gad~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~~  844 (1011)
                      .|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|+++|++++. .+..|+||||+|+..|+.++|++|+++
T Consensus       255 ~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~-~~~~g~t~L~~A~~~g~~~~v~~Ll~~  333 (437)
T 1n11_A          255 EGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA-TTRMGYTPLHVASHYGNIKLVKFLLQH  333 (437)
T ss_dssp             TTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTC-CCSSCCCHHHHHHHSSCSHHHHHHHHT
T ss_pred             CCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCC-CCCCCCCHHHHHHHcCcHHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999999999987 778899999999999999999999999


Q ss_pred             cCCcccccCCCCCHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCHHhhHHhhCCHHHHHHhhhcc
Q psy8109         845 NADINAEDKYGKIAFHSACQAKNWDIVTFLLDAGSNIEKATKYRMTFESSKVVEKHVAKLRAANIYV  911 (1011)
Q Consensus       845 ga~in~~d~~g~taL~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~  911 (1011)
                      |+++|.+|..|+||||+|+..|+.++|++|+++|++++..|.+|.||+++|.+.|+.++++.+....
T Consensus       334 gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~~  400 (437)
T 1n11_A          334 QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVT  400 (437)
T ss_dssp             TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHC
T ss_pred             CCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999999999999999888776543



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1011
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-71
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-69
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-68
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-50
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-44
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-39
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-37
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-34
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-34
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-34
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-30
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-29
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-23
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-23
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-32
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-29
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-15
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-28
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-27
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-26
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-25
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-23
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-28
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-26
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-28
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-23
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-22
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-21
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-24
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-23
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-24
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-23
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-23
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-22
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-22
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-19
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-22
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-21
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-18
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-21
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-18
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-16
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-16
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-12
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-15
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-15
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-14
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-12
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-08
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 7e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 7e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 5e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  240 bits (613), Expect = 2e-71
 Identities = 113/399 (28%), Positives = 170/399 (42%), Gaps = 14/399 (3%)

Query: 294 TALHVAAIVESVDIVKLLFDYGAEKSVNVQNVAGLTPLHIACRRKCLEIVKILLDKGADI 353
           T LHVA+ +  + IVK L   GA  S NV NV   TPLH+A R    E+ K LL   A +
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGA--SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV 59

Query: 354 NSGNDDGCTPLFCAIAQNCLEVFNYLVNHGCDLSVPEGERTALHMASQFGNLEMVNYLLK 413
           N+   D  TPL CA       +   L+ +  + ++           +           L 
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119

Query: 414 HIN--INHQDKDGWTPLTCSIKGQASLEVFHSIIEAGADIKAKLMDGTTALHLACYFGNL 471
                     K G+TPL  + K    + V   ++E  A   A   +G T LH+A +  NL
Sbjct: 120 EKEASQACMTKKGFTPLHVAAK-YGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNL 178

Query: 472 AMVNYLVKH-IDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVA 530
            +V  L+      +S    G TP++ A K N +E+   LL+ G     +     T LH+A
Sbjct: 179 DIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLA 238

Query: 531 CEFASIEMVSFLLSHIG-VNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKND-- 587
            +    EMV+ LLS     NL +  G TPLH       + V + LI     +        
Sbjct: 239 AQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGY 298

Query: 588 SPLHLACATGNMDMITY-AMKYFDVNIENDIGETPLHVAVSHGCLEAVKFLLNTKNIDVN 646
           +PLH+A   GN+ ++ +      DVN +  +G +PLH A   G  + V  LL       N
Sbjct: 299 TPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK-NGASPN 357

Query: 647 HKTKDGSTALFFACYDKRLDLVEIL---LEANADVNLGD 682
             + DG+T L  A     + + ++L    +  + V + D
Sbjct: 358 EVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSD 396


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1011
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.82
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.79
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.1e-47  Score=430.64  Aligned_cols=378  Identities=30%  Similarity=0.397  Sum_probs=250.4

Q ss_pred             hHHHHHHHcCCHHHHHHHHh-ccCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccCCCCCHHHHHHHhCCHHH
Q psy8109         460 TALHLACYFGNLAMVNYLVK-HIDINSENDLGKTPIYFAIKNNHLEIFNLLLKLGADVAVKMKSNFTCLHVACEFASIEM  538 (1011)
Q Consensus       460 t~L~~Aa~~g~~~iv~~Ll~-~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~t~L~~A~~~g~~~i  538 (1011)
                      ||||.||..|+.++|++|++ |++++..+..|.||||+|+..|+.+++++|+++|++++..+..|.|||++|+..|+.++
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~   81 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNM   81 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHH
Confidence            67777777777777777777 66777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHhc-cCCCCCCCCCCCHHHHHHhcCCHHHHHHHHhCCCCccccCCCCHHHHHHHcCChhhHHHHHhhccccccCCC
Q psy8109         539 VSFLLSH-IGVNLQDNKGCTPLHCAIVGNQLEVFNHLINSNADITMYKNDSPLHLACATGNMDMITYAMKYFDVNIENDI  617 (1011)
Q Consensus       539 v~~Ll~~-~~~~~~~~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~t~l~~A~~~g~~~iv~~Ll~~~~~~~~~~~  617 (1011)
                      +++|+.. ...........+++..+...+...........+                              ...+..+..
T Consensus        82 ~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------~~~~~~~~~  131 (408)
T d1n11a_          82 VKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKE------------------------------ASQACMTKK  131 (408)
T ss_dssp             HHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTT------------------------------CCSCCCCTT
T ss_pred             HHHHHHhhhccccccccccchhhhhhhhccccccccccccc------------------------------ccccccccc
Confidence            7777665 333444444455555555555544444443333                              233455667


Q ss_pred             CCcHHHHHHHcCCHHHHHHHHhhCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCcCCCC-CCcHHHHHHHcCC
Q psy8109         618 GETPLHVAVSHGCLEAVKFLLNTKNIDVNHKTKDGSTALFFACYDKRLDLVEILLEANADVNLGDG-TYTPLYTALMKDP  696 (1011)
Q Consensus       618 g~t~L~~A~~~g~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~-~~t~L~~aa~~~~  696 (1011)
                      +.++++.|+..++.+++++|++ .+++++..+..+.+||++|+..|+.+++++|+.+|++++..+. +.+|++.+.. ..
T Consensus       132 ~~~~l~~a~~~~~~~~v~~ll~-~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~-~~  209 (408)
T d1n11a_         132 GFTPLHVAAKYGKVRVAELLLE-RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAK-QN  209 (408)
T ss_dssp             SCCHHHHHHHTTCHHHHHHHHH-TTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHH-TT
T ss_pred             cchHHHHHHHcCCHHHHHHHHH-cCCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhc-cc
Confidence            7788888888888888888887 7888888888888888888888888888888888887776555 5566665555 55


Q ss_pred             CHHHHHHHHhCCCCCCccCCCCCCCcHHHHHHHCCCHHHHHHHHHHhcCCCcccccCCCccHHHHHHhCCCHHHHHHHHH
Q psy8109         697 SLDIIKMLVKYGADVNLTNEACYYMTPLHYASYRGDCNDIARFLVEECNADITLRNFNNRTALNFAAFGNNLDLLKFLLK  776 (1011)
Q Consensus       697 ~~~iv~~Ll~~g~~~~~~~~~~~~~t~l~~A~~~g~~~~iv~~Ll~~~g~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~  776 (1011)
                      ..++...++..+......+..  +.||+++|+..++ .++++++... +...+..+..|.|||+.|+..++.+++++|++
T Consensus       210 ~~~~~~~l~~~~~~~~~~~~~--~~t~l~~a~~~~~-~~~~~~~~~~-~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~  285 (408)
T d1n11a_         210 QVEVARSLLQYGGSANAESVQ--GVTPLHLAAQEGH-AEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK  285 (408)
T ss_dssp             CHHHHHHHHHTTCCTTCCCTT--CCCHHHHHHHTTC-HHHHHHHHTT-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHH
T ss_pred             hhhhhhhhhhccccccccCCC--CCCHHHHHHHhCc-HhHhhhhhcc-ccccccccCCCCChhhhhhhcCcHHHHHHHHH
Confidence            555666665555554444444  5566666666666 6666666555 55555566666666666666666666666666


Q ss_pred             CCCCCCCCCcCCCCcccccccCChHHHHHHHHHcCCCccccccCCCChHHHHHHHcCCHHHHHHHHhccCCcccccCCCC
Q psy8109         777 AGADPDILDLKDTSPLLSSCRQGLYEIVDTLLEYNADTNLRTIKHGSTALHTAAFHNQLDIIKLLLKYNADINAEDKYGK  856 (1011)
Q Consensus       777 ~gad~~~~d~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~g~t~L~~Aa~~g~~~iv~~Ll~~ga~in~~d~~g~  856 (1011)
                      +|++++..+..+.|||+.|+..++.++++++++.|++++. .+..|.||||+|+.+|+.++|++|+++||++|.+|..|+
T Consensus       286 ~g~~~~~~~~~~~t~L~~~~~~~~~~~~~~ll~~g~~in~-~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~  364 (408)
T d1n11a_         286 HGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNA-KTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGT  364 (408)
T ss_dssp             HTCCTTCCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTC-CCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSC
T ss_pred             CCCccccccccccccchhhcccCcceeeeeeccccccccc-cCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCC
Confidence            6666666666666666666666666666666666666655 455666666666666666666666666666666666666


Q ss_pred             CHHHHHHHcCCHHHHHHH
Q psy8109         857 IAFHSACQAKNWDIVTFL  874 (1011)
Q Consensus       857 taL~~A~~~g~~~iv~~L  874 (1011)
                      ||||+|++.||.++|++|
T Consensus       365 t~L~~A~~~~~~~iv~~L  382 (408)
T d1n11a_         365 TPLAIAKRLGYISVTDVL  382 (408)
T ss_dssp             CHHHHHHHTTCHHHHHHH
T ss_pred             CHHHHHHHcCCHHHHHHH
Confidence            666666666666665544



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure