Psyllid ID: psy8133

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGSA
cEEEEEEccEEEEEccccccHHHHHHHHccccEEEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccc
cEEEEEEccEEEEEEccccccEEEHHEcccccEEEEEEcccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHccccc
grvevsrenkylstlapgkvfGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYndflksvpifkdlpeetLIKISDVLEESLGSA
grvevsrenkylstlapgkvfgELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGSA
GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGSA
**********YLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDV********
GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG**RQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGS*
*********KYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGSA
GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLG**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEESLGSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
Q03043 1088 cGMP-dependent protein ki no N/A 0.959 0.087 0.842 2e-41
P32023 934 cGMP-dependent protein ki yes N/A 0.959 0.101 0.842 2e-41
Q13976 671 cGMP-dependent protein ki no N/A 0.898 0.132 0.684 2e-33
P00516 671 cGMP-dependent protein ki yes N/A 0.898 0.132 0.684 2e-33
O77676 671 cGMP-dependent protein ki yes N/A 0.898 0.132 0.684 2e-33
P0C605 671 cGMP-dependent protein ki no N/A 0.898 0.132 0.673 3e-33
Q64595 762 cGMP-dependent protein ki no N/A 0.939 0.122 0.526 6e-22
Q61410 762 cGMP-dependent protein ki no N/A 0.939 0.122 0.526 7e-22
Q13237 762 cGMP-dependent protein ki no N/A 0.939 0.122 0.516 2e-21
O76360 780 cGMP-dependent protein ki yes N/A 0.959 0.121 0.431 3e-19
>sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 Back     alignment and function desciption
 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (91%)

Query: 1   GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG 60
           GRVEVSRE KYLSTL+  KV GELAILYNC+RTATI A ++C LWAIERQCFQTIMMRTG
Sbjct: 563 GRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTG 622

Query: 61  LIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEES 95
           LIRQAEY+DFLKSVPIFKDL E+TLIKISDVLEE+
Sbjct: 623 LIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEET 657

Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 2
>sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 Back     alignment and function description
>sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 Back     alignment and function description
>sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 Back     alignment and function description
>sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 Back     alignment and function description
>sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
255349294 744 cGMP-dependent protein kinase G [Spodopt 0.959 0.127 0.936 8e-47
357605199 1061 PKG-Ib [Danaus plexippus] 0.959 0.089 0.926 1e-46
260595791 592 cGMP-dependent protein kinase foraging p 0.959 0.160 0.936 1e-46
375364637 708 cGMP-dependent protein kinase foraging i 1.0 0.139 0.898 7e-46
112983098 738 protein kinase, cGMP-dependent, type I [ 0.959 0.128 0.915 7e-46
328714469 923 PREDICTED: cGMP-dependent protein kinase 1.0 0.107 0.898 7e-46
375364635 776 cGMP-dependent protein kinase foraging i 1.0 0.127 0.898 9e-46
18643248 744 PKG-Ib [Bombyx mori] gi|18643250|gb|AAL7 0.959 0.127 0.915 9e-46
110225911 743 PKG/For protein [Lobesia botrana] 0.959 0.127 0.915 9e-46
242009000 542 cAMP-dependent protein kinase catalytic 0.959 0.175 0.926 2e-45
>gi|255349294|gb|ACU09499.1| cGMP-dependent protein kinase G [Spodoptera exigua] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/95 (93%), Positives = 94/95 (98%)

Query: 1   GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG 60
           GRVEVSRENKYLST+APGKVFGELAILYNCKRTATIKAA+DC+LWAIERQCFQTIMMRTG
Sbjct: 220 GRVEVSRENKYLSTMAPGKVFGELAILYNCKRTATIKAATDCRLWAIERQCFQTIMMRTG 279

Query: 61  LIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEES 95
           LIRQAEY DFLKSVPIFKDLPE+TLIKISDVLEE+
Sbjct: 280 LIRQAEYTDFLKSVPIFKDLPEDTLIKISDVLEET 314

Source: Spodoptera exigua

Species: Spodoptera exigua

Genus: Spodoptera

Family: Noctuidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357605199|gb|EHJ64503.1| PKG-Ib [Danaus plexippus] Back     alignment and taxonomy information
>gi|260595791|gb|ACX46913.1| cGMP-dependent protein kinase foraging protein [Mythimna separata] Back     alignment and taxonomy information
>gi|375364637|gb|AFA55182.1| cGMP-dependent protein kinase foraging isozyme 2 variant 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|112983098|ref|NP_001037051.1| protein kinase, cGMP-dependent, type I [Bombyx mori] gi|18643252|gb|AAL76257.1|AF465602_1 PKG-II [Bombyx mori] Back     alignment and taxonomy information
>gi|328714469|ref|XP_001952091.2| PREDICTED: cGMP-dependent protein kinase, isozyme 2 forms cD5/T2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|375364635|gb|AFA55181.1| cGMP-dependent protein kinase foraging isozyme 2 variant 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|18643248|gb|AAL76255.1|AF465600_1 PKG-Ib [Bombyx mori] gi|18643250|gb|AAL76256.1|AF465601_1 PKG-Ia [Bombyx mori] Back     alignment and taxonomy information
>gi|110225911|gb|ABG56236.1| PKG/For protein [Lobesia botrana] Back     alignment and taxonomy information
>gi|242009000|ref|XP_002425281.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] gi|212509046|gb|EEB12543.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
FB|FBgn0000721 1088 for "foraging" [Drosophila mel 0.959 0.087 0.842 6.9e-37
UNIPROTKB|B1ALS0181 PRKG1 "cGMP-dependent protein 0.959 0.524 0.684 3.3e-31
UNIPROTKB|Q5SQU3 659 PRKG1 "cGMP-dependent protein 0.959 0.144 0.684 1.9e-30
UNIPROTKB|P00516 671 PRKG1 "cGMP-dependent protein 0.959 0.141 0.684 2.1e-30
UNIPROTKB|Q13976 671 PRKG1 "cGMP-dependent protein 0.959 0.141 0.684 2.1e-30
UNIPROTKB|O77676 671 PRKG1 "cGMP-dependent protein 0.959 0.141 0.684 2.1e-30
UNIPROTKB|F1NE85 685 F1NE85 "cGMP-dependent protein 0.959 0.138 0.684 2.2e-30
UNIPROTKB|F1MY76 686 PRKG1 "cGMP-dependent protein 0.959 0.138 0.684 2.2e-30
MGI|MGI:108174 671 Prkg1 "protein kinase, cGMP-de 0.959 0.141 0.673 4.3e-30
ZFIN|ZDB-GENE-040426-1308 667 prkg1a "protein kinase, cGMP-d 0.959 0.142 0.673 1.9e-29
FB|FBgn0000721 for "foraging" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 408 (148.7 bits), Expect = 6.9e-37, P = 6.9e-37
 Identities = 80/95 (84%), Positives = 87/95 (91%)

Query:     1 GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG 60
             GRVEVSRE KYLSTL+  KV GELAILYNC+RTATI A ++C LWAIERQCFQTIMMRTG
Sbjct:   563 GRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTG 622

Query:    61 LIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEES 95
             LIRQAEY+DFLKSVPIFKDL E+TLIKISDVLEE+
Sbjct:   623 LIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEET 657
GO:0004690 "cyclic nucleotide-dependent protein kinase activity" evidence=ISS
GO:0030536 "larval feeding behavior" evidence=IMP;TAS
GO:0004692 "cGMP-dependent protein kinase activity" evidence=NAS;IDA
GO:0006468 "protein phosphorylation" evidence=NAS;IDA
GO:0008345 "larval locomotory behavior" evidence=IMP
GO:0046959 "habituation" evidence=IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0007631 "feeding behavior" evidence=TAS
GO:0008016 "regulation of heart contraction" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=IDA
GO:0007616 "long-term memory" evidence=IMP
GO:0007614 "short-term memory" evidence=IMP
GO:0032095 "regulation of response to food" evidence=IMP
UNIPROTKB|B1ALS0 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13976 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O77676 PRKG1 "cGMP-dependent protein kinase 1" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE85 F1NE85 "cGMP-dependent protein kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY76 PRKG1 "cGMP-dependent protein kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:108174 Prkg1 "protein kinase, cGMP-dependent, type I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1308 prkg1a "protein kinase, cGMP-dependent, type Ia" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00516KGP1_BOVIN2, ., 7, ., 1, 1, ., 1, 20.68420.89890.1326yesN/A
O77676KGP1_RABIT2, ., 7, ., 1, 1, ., 1, 20.68420.89890.1326yesN/A
P32023KGP25_DROME2, ., 7, ., 1, 1, ., 1, 20.84210.95950.1017yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 5e-17
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 2e-12
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 3e-09
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 1e-08
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 69.7 bits (171), Expect = 5e-17
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 1   GRVEVSREN-----KYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTI 55
           G VEV + +     + +  L PG +FGELA+L N  R+AT++A +D +L  + R  F+ +
Sbjct: 44  GSVEVYKLDEDGREQIVGFLGPGDLFGELALLGNGPRSATVRALTDSELLVLPRSDFRRL 103

Query: 56  MMRTGLIRQAEY 67
           +     + +   
Sbjct: 104 LQEYPELARRLL 115

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
KOG0614|consensus 732 99.78
KOG1113|consensus368 99.69
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.24
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.21
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.16
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.13
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.13
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.12
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.11
cd00038115 CAP_ED effector domain of the CAP family of transc 99.03
PRK09391230 fixK transcriptional regulator FixK; Provisional 98.77
KOG0498|consensus 727 98.76
PRK11161235 fumarate/nitrate reduction transcriptional regulat 98.73
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 98.65
COG2905 610 Predicted signal-transduction protein containing c 98.63
KOG0500|consensus536 98.62
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 98.61
KOG0614|consensus 732 98.53
KOG0499|consensus 815 98.52
KOG1113|consensus368 98.37
PLN02868 413 acyl-CoA thioesterase family protein 98.24
KOG0501|consensus 971 97.77
KOG2968|consensus 1158 97.62
KOG2968|consensus 1158 97.55
PF04831153 Popeye: Popeye protein conserved region; InterPro: 97.16
PRK11832207 putative DNA-binding transcriptional regulator; Pr 96.97
KOG2378|consensus 573 96.3
KOG3542|consensus 1283 86.72
KOG0498|consensus 727 80.51
>KOG0614|consensus Back     alignment and domain information 
Probab=99.78  E-value=1.6e-19  Score=125.57  Aligned_cols=99  Identities=60%  Similarity=1.031  Sum_probs=96.5

Q ss_pred             CeEEEEECCeEEeeeCCCCeeeehhhhcCCcceeEEEEccceEEEEECHHHHHHHHHhhhHHHHHHHHHHhhcCCCCCCC
Q psy8133           1 GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDL   80 (99)
Q Consensus         1 G~v~v~~~~~~v~~l~~G~~fGe~~l~~~~~~~~~~~a~~~~~~~~i~~~~f~~~l~~~~~~~~~~~~~~l~~~~~~~~l   80 (99)
                      |++.|+++++.+..+++|..|||.+++++++|++|++|.+++.+|.|+++.|+.+++.....+...+.+|++.+++|.++
T Consensus       204 G~~~V~~~g~ll~~m~~gtvFGELAILynctRtAsV~alt~~~lWaidR~vFq~IM~~tg~~r~~~~~~fLrsv~~~q~l  283 (732)
T KOG0614|consen  204 GELQVSREGKLLGKMGAGTVFGELAILYNCTRTASVRALTDVRLWAIDREVFQAIMMRTGLERHEQYMNFLRSVPLFQNL  283 (732)
T ss_pred             ceEEEeeCCeeeeccCCchhhhHHHHHhCCcchhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhccC
Confidence            78889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhHhhhccCCC
Q psy8133          81 PEETLIKISDVLEESLGSA   99 (99)
Q Consensus        81 ~~~~~~~l~~~~~~~~~~a   99 (99)
                      +++.+.++++.+..++|.|
T Consensus       284 ~Ee~L~KiaD~le~~~Yd~  302 (732)
T KOG0614|consen  284 PEELLLKIADVLEEEYYDA  302 (732)
T ss_pred             CHHHHHHHHHHHHHHhhcC
Confidence            9999999999999999975

>KOG1113|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
3shr_A 299 Crystal Structure Of Cgmp-Dependent Protein Kinase 6e-35
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 2e-24
3of1_A246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 6e-16
4din_B 381 Novel Localization And Quaternary Structure Of The 1e-13
2qcs_B 291 A Complex Structure Between The Catalytic And Regul 1e-13
1ne4_A283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 1e-13
1rl3_A 288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 1e-13
2qvs_B 310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 1e-11
1cx4_A 305 Crystal Structure Of A Deletion Mutant Of The Type 5e-10
3tnp_B 416 Structure And Allostery Of The Pka Riib Tetrameric 9e-10
3tnq_A 416 Structure And Allostery Of The Pka Riib Tetrameric 1e-09
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 1e-09
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-09
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 7e-06
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 2e-05
4ev0_A216 Crystal Structure Of Thermus Thermophilus Catabolit 8e-05
3otf_A220 Structural Basis For The Camp-Dependent Gating In H 2e-04
3u11_A210 Tetramerization Dynamics Of The C-Terminus Underlie 2e-04
4hbn_A205 Crystal Structure Of The Human Hcn4 Channel C-termi 5e-04
2q0a_A200 Structure And Rearrangements In The Carboxy-Termina 7e-04
3u10_A210 Tetramerization Dynamics Of The C-Terminus Underlie 7e-04
1q3e_A207 Hcn2j 443-645 In The Presence Of Cgmp Length = 207 8e-04
3ffq_A202 Hcn2i 443-640 Apo-State Length = 202 8e-04
3bpz_A202 Hcn2-I 443-460 E502k In The Presence Of Camp Length 8e-04
>pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 Back     alignment and structure 
Iteration: 1

 Score =  142 bits (357), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%)
Query: 1   GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG 60
           G+VEV++E   L T+ PGKVFGELAILYNC RTAT+K   + KLWAI+RQCFQTIMMRTG
Sbjct: 89  GKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTG 148
Query: 61  LIRQAEYNDFLKSVPIFKDLPEETLIKISDVLEES 95
           LI+  EY +FLKSVP F+ LPEE L K++DVLEE+
Sbjct: 149 LIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET 183
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|4EV0|A Chain A, Crystal Structure Of Thermus Thermophilus Catabolite Activator Protein Length = 216 Back     alignment and structure
>pdb|3OTF|A Chain A, Structural Basis For The Camp-Dependent Gating In Human Hcn4 Channel Length = 220 Back     alignment and structure
>pdb|3U11|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|4HBN|A Chain A, Crystal Structure Of The Human Hcn4 Channel C-terminus Carrying The S672r Mutation Length = 205 Back     alignment and structure
>pdb|2Q0A|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 200 Back     alignment and structure
>pdb|3U10|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of Cgmp Length = 207 Back     alignment and structure
>pdb|3FFQ|A Chain A, Hcn2i 443-640 Apo-State Length = 202 Back     alignment and structure
>pdb|3BPZ|A Chain A, Hcn2-I 443-460 E502k In The Presence Of Camp Length = 202 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-32
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-31
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 6e-16
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 3e-31
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-15
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 1e-29
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 7e-29
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 5e-13
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 1e-28
4din_B381 CAMP-dependent protein kinase type I-beta regulat 4e-14
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 2e-28
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 9e-15
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 5e-28
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-04
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 2e-19
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 5e-19
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 1e-10
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 1e-14
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 1e-04
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 7e-13
3gyd_A 187 CNMP-BD protein, cyclic nucleotide-binding domain; 3e-04
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 1e-12
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 5e-12
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-11
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 2e-11
3ukn_A212 Novel protein similar to vertebrate potassium VOL 4e-11
2pqq_A149 Putative transcriptional regulator; APC7345, strep 6e-11
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 2e-09
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 2e-04
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 3e-09
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 9e-09
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-08
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 6e-08
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 1e-07
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-07
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 4e-07
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 1e-06
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-06
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 8e-06
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 9e-06
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 1e-05
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-05
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 2e-05
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 2e-05
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 2e-05
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 2e-05
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 6e-05
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 6e-05
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 3e-04
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 3e-04
1ft9_A222 Carbon monoxide oxidation system transcription reg 4e-04
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
 Score =  109 bits (274), Expect = 1e-32
 Identities = 47/67 (70%), Positives = 55/67 (82%)

Query: 1   GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTG 60
           G+VEV++E   L T+ PGKVFGELAILYNC RTAT+K   + KLWAI+RQCFQTIMMRTG
Sbjct: 73  GKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTG 132

Query: 61  LIRQAEY 67
           LI+  EY
Sbjct: 133 LIKHTEY 139
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.75
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.74
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.74
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.73
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.66
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.52
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.52
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.49
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.48
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.48
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.47
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.43
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.4
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.39
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.39
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.37
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.36
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.35
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.32
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.31
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.3
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.3
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.3
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.29
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.28
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.28
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.28
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.28
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.27
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.26
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.26
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.25
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.25
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.25
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.23
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.22
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.21
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.21
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.18
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.18
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.17
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.15
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.1
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.1
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.04
3b02_A195 Transcriptional regulator, CRP family; structural 99.01
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.0
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 98.98
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 98.97
1ft9_A222 Carbon monoxide oxidation system transcription reg 98.89
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 98.85
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 98.62
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 94.16
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 93.36
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 91.96
4f8a_A 160 Potassium voltage-gated channel subfamily H membe; 91.0
2z69_A 154 DNR protein; beta barrel, dimerization helix, tran 89.96
3gyd_A 187 CNMP-BD protein, cyclic nucleotide-binding domain; 89.48
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 89.01
2pqq_A 149 Putative transcriptional regulator; APC7345, strep 88.93
1wgp_A 137 Probable cyclic nucleotide-gated ION channel 6; cy 88.01
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 87.38
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 86.6
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 84.64
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 84.32
3mdp_A 142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 83.75
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 82.71
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 81.3
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 80.73
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=1.2e-17  Score=113.11  Aligned_cols=99  Identities=33%  Similarity=0.634  Sum_probs=95.2

Q ss_pred             CeEEEEECCeEEeeeCCCCeeeehhhhcCCcceeEEEEccceEEEEECHHHHHHHHHhhhHHHHHHHHHHhhcCCCCCCC
Q psy8133           1 GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEYNDFLKSVPIFKDL   80 (99)
Q Consensus         1 G~v~v~~~~~~v~~l~~G~~fGe~~l~~~~~~~~~~~a~~~~~~~~i~~~~f~~~l~~~~~~~~~~~~~~l~~~~~~~~l   80 (99)
                      |.|++.++++.+..+++|++|||.+++.+.||+++++|.++|.+|.|+++.|..++.+++..+..++..++++++.|..+
T Consensus       180 G~v~v~~~~~~v~~l~~G~~fGe~all~~~~r~atv~A~~~~~l~~i~~~~f~~ll~~~~~~~~~~~~~~L~~v~~f~~L  259 (381)
T 4din_B          180 GEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESL  259 (381)
T ss_dssp             SEEEEEETTEEEEEEESSCCBCGGGGTSCCBCSSEEEESSSCEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHCSTTTTC
T ss_pred             eEEEEEECCeEeeeCCCCCEEEchHHhcCCCcceEEEECCCEEEEEEchHHHHHhhhhhhHHHHHHHHHHhhhhHHHHhc
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhHhhhccCCC
Q psy8133          81 PEETLIKISDVLEESLGSA   99 (99)
Q Consensus        81 ~~~~~~~l~~~~~~~~~~a   99 (99)
                      +..++..+++.+..+.|++
T Consensus       260 s~~el~~l~~~~~~~~~~~  278 (381)
T 4din_B          260 EKWERLTVADALEPVQFED  278 (381)
T ss_dssp             CTTHHHHHHTTCBCCCBCS
T ss_pred             cHHHHHHHHHhhhhccCCC
Confidence            9999999999999888874
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 99
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 3e-11
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 2e-09
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 1e-07
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 1e-04
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 2e-06
d1cx4a2 147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 1e-04
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 3e-04
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 4e-04
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 8e-04
d1wgpa_ 137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 0.001
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 54.0 bits (129), Expect = 3e-11
 Identities = 20/47 (42%), Positives = 32/47 (68%)

Query: 21  FGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEY 67
           FGELA++Y   R AT+KA ++ KLW I+R  ++ I+M + L ++  Y
Sbjct: 90  FGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMY 136
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.64
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.5
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.47
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.44
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.42
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.4
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.4
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.39
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.35
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.34
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.32
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.28
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.26
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.21
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.2
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.13
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.0
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 94.97
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 94.78
d1o7fa2 155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 94.7
d1wgpa_ 137 Probable cyclic nucleotide-gated ion channel 6 {Th 94.39
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 92.85
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 92.75
d1zyba2 147 Probable transcription regulator BT4300, N-termina 88.07
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 84.29
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.64  E-value=6.8e-16  Score=89.95  Aligned_cols=67  Identities=36%  Similarity=0.745  Sum_probs=62.4

Q ss_pred             CeEEEEECCeEEeeeCCCCeeeehhhhcCCcceeEEEEccceEEEEECHHHHHHHHHhhhHHHHHHH
Q psy8133           1 GRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAASDCKLWAIERQCFQTIMMRTGLIRQAEY   67 (99)
Q Consensus         1 G~v~v~~~~~~v~~l~~G~~fGe~~l~~~~~~~~~~~a~~~~~~~~i~~~~f~~~l~~~~~~~~~~~   67 (99)
                      |.+.+..++..+..+++|++|||.+++.+.+++++++|.++|.++.|++++|..++++++..+++++
T Consensus        70 G~v~v~~~~~~~~~l~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~f~~ll~~~~~~~r~~y  136 (136)
T d1ne6a1          70 GEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMY  136 (136)
T ss_dssp             SCEEEEETTEEEEEECTTCEECCHHHHHCCCCCSEEEESSCEEEEEEEHHHHHHHTHHHHHHHHHHH
T ss_pred             CceeeeccccccceeccccccccHHHcCCCcceEEEEEccCEEEEEEEHHHHHHHHhhCHHHHHhhC
Confidence            7888888888999999999999999999999999999999999999999999999999998776653
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure