Psyllid ID: psy8190


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSLKIIQSSKESNSIKKNNAISSSQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRNIKIKMKNNIKQI
ccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHcccHHHHccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHcccHHHccccccccccccccHHHHHHHHccccccccccccccccccc
cccccEccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEccHcccccccccHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHccccEccccccccHHHHcHEEccccHHHHHHHHHHHHHcccEEEcccEEcccccHHHHHHHHHHHHcccccccccccHcEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHccccEEEccEccccccccHHHHHHHHHHccccccHccHccccccccc
MSLKIIQSskesnsikknnaisSSQSLIWKLDEVinlfnlpfndLLFRAQKVHRKYFDANEIELAVLLSIKtggctedcgycpqsthynteitATKILSIESVITAAQKAksdgatrfCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDyynhnldtspklygdiistrDYENRLNTLKNVRNVGiniccggiiglseSRDQRAELIFQLAnlnpypesvpinnlvqikgtplygssildpLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAgansifygdkllttdntktnddsKLLKKLGINTRNIKIKMKNNIKQI
mslkiiqsskesnsikknnaisSSQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQkaksdgatrFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTtdntktnddskllkklgintrnikikmknnikqi
MSLkiiqsskesnsikknnaisssqsLIWKLDEVInlfnlpfndllfRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVginiccggiigLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGdkllttdntktnddSKLLKKLGintrnikikmknnikQI
*************************SLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIR********GETTQAFCFLAGANSIFYGDKLLTTDN********LLKKLGINTRNI***********
***************************IWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGI****************
**************IKKNNAISSSQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRNIKIKMKNNIKQI
**************************LIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTR*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKIIQSSKESNSIKKNNAISSSQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRNIKIKMKNNIKQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query348 2.2.26 [Sep-21-2011]
A4G1F1339 Biotin synthase OS=Hermin yes N/A 0.910 0.935 0.659 1e-135
A6SU66339 Biotin synthase OS=Janthi yes N/A 0.910 0.935 0.659 1e-134
Q12D73343 Biotin synthase 2 OS=Pola yes N/A 0.936 0.950 0.600 1e-126
B2JKH4351 Biotin synthase OS=Burkho yes N/A 0.873 0.866 0.657 1e-126
Q21W43349 Biotin synthase OS=Rhodof yes N/A 0.905 0.902 0.616 1e-125
Q146K5360 Biotin synthase OS=Burkho yes N/A 0.873 0.844 0.631 1e-123
A1VUJ4345 Biotin synthase OS=Polaro yes N/A 0.885 0.892 0.616 1e-123
B2SWS5361 Biotin synthase OS=Burkho yes N/A 0.873 0.842 0.631 1e-123
Q1LS73345 Biotin synthase OS=Ralsto yes N/A 0.951 0.959 0.598 1e-123
A3N520336 Biotin synthase OS=Burkho yes N/A 0.902 0.934 0.621 1e-122
>sp|A4G1F1|BIOB_HERAR Biotin synthase OS=Herminiimonas arsenicoxydans GN=bioB PE=3 SV=1 Back     alignment and function desciption
 Score =  481 bits (1239), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 209/317 (65%), Positives = 266/317 (83%)

Query: 29  WKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHY 88
           W +D+V+ LFNLPFN+L+FRAQ VHR++FD +E+ELA LLSIKTGGC EDCGYCPQ+  Y
Sbjct: 20  WPVDDVLALFNLPFNELMFRAQTVHREHFDPSEVELATLLSIKTGGCPEDCGYCPQAARY 79

Query: 89  NTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLE 148
           +T +TA KIL +E V+TAA++AK+ GATRFCMGAAWRE KDRDL+ +E M+ EVK +G+E
Sbjct: 80  DTGVTAQKILPLEEVLTAAREAKAHGATRFCMGAAWREPKDRDLEKVEEMVREVKAMGME 139

Query: 149 TCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGIN 208
           TC TLGML E QA +LK  GLDYYNHNLDT+P+ Y ++ISTRDY+NR++TL  VRNVGI 
Sbjct: 140 TCATLGMLGEGQAEKLKNAGLDYYNHNLDTAPEFYSNVISTRDYQNRIDTLARVRNVGIK 199

Query: 209 ICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRT 268
           +CCGGI+G+ ESR QRA LI QL N++PYPESVP+NNLVQ++GTPL+G+  +DPLEF+RT
Sbjct: 200 VCCGGIVGMGESRLQRAGLIAQLCNMDPYPESVPVNNLVQVEGTPLHGTDPIDPLEFVRT 259

Query: 269 IAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLK 328
           +AVARITMP +R+R+SAGR+EMGE  QA CF+AGANSIFYGDKLLTT N +   D +LL+
Sbjct: 260 VAVARITMPKARVRLSAGRREMGEAIQALCFVAGANSIFYGDKLLTTGNPEALADQELLE 319

Query: 329 KLGINTRNIKIKMKNNI 345
           KLG++TR+  I  + ++
Sbjct: 320 KLGMHTRSTAIDARCDV 336




Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism.
Herminiimonas arsenicoxydans (taxid: 204773)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 6
>sp|A6SU66|BIOB_JANMA Biotin synthase OS=Janthinobacterium sp. (strain Marseille) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|Q12D73|BIOB2_POLSJ Biotin synthase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioB2 PE=3 SV=2 Back     alignment and function description
>sp|B2JKH4|BIOB_BURP8 Biotin synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|Q21W43|BIOB_RHOFD Biotin synthase OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|Q146K5|BIOB_BURXL Biotin synthase OS=Burkholderia xenovorans (strain LB400) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|A1VUJ4|BIOB_POLNA Biotin synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|B2SWS5|BIOB_BURPP Biotin synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=bioB PE=3 SV=1 Back     alignment and function description
>sp|Q1LS73|BIOB_RALME Biotin synthase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=bioB PE=3 SV=2 Back     alignment and function description
>sp|A3N520|BIOB_BURP6 Biotin synthase OS=Burkholderia pseudomallei (strain 668) GN=bioB PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
329910730336 Biotin synthase [Oxalobacteraceae bacter 0.954 0.988 0.644 1e-135
134093392339 biotin synthase [Herminiimonas arsenicox 0.910 0.935 0.659 1e-133
152980099339 biotin synthetase [Janthinobacterium sp. 0.910 0.935 0.659 1e-132
445493867349 biotin synthase BioB [Janthinobacterium 0.965 0.962 0.633 1e-131
340789431374 biotin synthase [Collimonas fungivorans 0.936 0.871 0.633 1e-130
395760525348 biotin synthase [Janthinobacterium livid 0.951 0.951 0.608 1e-127
91787465344 biotin synthase [Polaromonas sp. JS666] 0.936 0.947 0.600 1e-124
254810651343 RecName: Full=Biotin synthase 2 0.936 0.950 0.600 1e-124
186474939351 biotin synthase [Burkholderia phymatum S 0.873 0.866 0.657 1e-124
421750360345 biotin synthase [Cupriavidus necator HPC 0.873 0.881 0.651 1e-124
>gi|329910730|ref|ZP_08275370.1| Biotin synthase [Oxalobacteraceae bacterium IMCC9480] gi|327546098|gb|EGF31162.1| Biotin synthase [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 214/332 (64%), Positives = 267/332 (80%)

Query: 12  SNSIKKNNAISSSQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIK 71
           S +I    A  +  +  W +++V+ LFNLPFN+LLFRAQ++HR++FD  E+ELA LLSIK
Sbjct: 3   SQTIAFQAATPTIVASTWPVEDVLALFNLPFNELLFRAQQIHREHFDPTEVELATLLSIK 62

Query: 72  TGGCTEDCGYCPQSTHYNTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRD 131
           TGGC EDCGYCPQ+  Y+T +TA KIL + +V+ AA++AK+ GATRFCMGAAWRE KDRD
Sbjct: 63  TGGCPEDCGYCPQAARYDTGVTAQKILPLATVLEAARQAKAHGATRFCMGAAWREPKDRD 122

Query: 132 LDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRD 191
           L+ +E M+ EVK +GLETC TLGML   QA +LK  GLDYYNHNLDT+P+ YG++ISTRD
Sbjct: 123 LEQVEEMVREVKALGLETCATLGMLGVGQAEKLKDAGLDYYNHNLDTAPEFYGNVISTRD 182

Query: 192 YENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKG 251
           Y++RL+TL  VR  GI +CCGGI+G+ ESR QRA L+ QLANL PYPESVP+N+LVQ++G
Sbjct: 183 YQHRLDTLGRVRGAGIKVCCGGIVGMGESRLQRAGLVAQLANLTPYPESVPVNHLVQVEG 242

Query: 252 TPLYGSSILDPLEFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDK 311
           TPLYGS  LDPLEF+RTIAVARITMPT+R+R+SAGR++MGE  QA CFLAGANSIFYGDK
Sbjct: 243 TPLYGSEALDPLEFVRTIAVARITMPTARVRLSAGRRQMGEAVQAMCFLAGANSIFYGDK 302

Query: 312 LLTTDNTKTNDDSKLLKKLGINTRNIKIKMKN 343
           LLTT N +  +D  LL KLG+ TR  KI+ + 
Sbjct: 303 LLTTGNPEVEEDQALLAKLGMRTRATKIEAEG 334




Source: Oxalobacteraceae bacterium IMCC9480

Species: Oxalobacteraceae bacterium IMCC9480

Genus:

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|134093392|ref|YP_001098467.1| biotin synthase [Herminiimonas arsenicoxydans] gi|254810719|sp|A4G1F1.1|BIOB_HERAR RecName: Full=Biotin synthase gi|133737295|emb|CAL60338.1| Biotin synthase [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|152980099|ref|YP_001351813.1| biotin synthetase [Janthinobacterium sp. Marseille] gi|254810721|sp|A6SU66.1|BIOB_JANMA RecName: Full=Biotin synthase gi|151280176|gb|ABR88586.1| biotin synthetase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|445493867|ref|ZP_21460911.1| biotin synthase BioB [Janthinobacterium sp. HH01] gi|444790028|gb|ELX11575.1| biotin synthase BioB [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|340789431|ref|YP_004754896.1| biotin synthase [Collimonas fungivorans Ter331] gi|340554698|gb|AEK64073.1| Biotin synthase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|395760525|ref|ZP_10441194.1| biotin synthase [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|91787465|ref|YP_548417.1| biotin synthase [Polaromonas sp. JS666] gi|91696690|gb|ABE43519.1| biotin synthase [Polaromonas sp. JS666] Back     alignment and taxonomy information
>gi|254810651|sp|Q12D73.2|BIOB2_POLSJ RecName: Full=Biotin synthase 2 Back     alignment and taxonomy information
>gi|186474939|ref|YP_001856409.1| biotin synthase [Burkholderia phymatum STM815] gi|254810620|sp|B2JKH4.1|BIOB_BURP8 RecName: Full=Biotin synthase gi|184191398|gb|ACC69363.1| biotin synthase [Burkholderia phymatum STM815] Back     alignment and taxonomy information
>gi|421750360|ref|ZP_16187599.1| biotin synthase [Cupriavidus necator HPC(L)] gi|409770595|gb|EKN53193.1| biotin synthase [Cupriavidus necator HPC(L)] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
UNIPROTKB|P12996346 bioB "biotin synthase monomer" 0.870 0.875 0.508 5.4e-79
TIGR_CMR|SO_2740350 SO_2740 "biotin synthase" [She 0.870 0.865 0.498 2.3e-78
UNIPROTKB|Q9KSZ4350 bioB "Biotin synthase" [Vibrio 0.870 0.865 0.501 3.8e-78
TIGR_CMR|VC_1112350 VC_1112 "biotin synthase" [Vib 0.870 0.865 0.501 3.8e-78
TIGR_CMR|CBU_1007321 CBU_1007 "biotin synthase" [Co 0.816 0.884 0.510 1.7e-75
TIGR_CMR|CPS_2594346 CPS_2594 "biotin synthase" [Co 0.870 0.875 0.498 2.1e-75
TIGR_CMR|NSE_0612325 NSE_0612 "biotin synthase" [Ne 0.873 0.935 0.453 1.4e-71
TIGR_CMR|ECH_0352326 ECH_0352 "biotin synthase" [Eh 0.870 0.929 0.455 6.1e-71
TIGR_CMR|APH_0218322 APH_0218 "biotin synthase" [An 0.870 0.940 0.452 1.8e-69
TIGR_CMR|SPO_3338318 SPO_3338 "biotin synthase" [Ru 0.870 0.952 0.445 8.2e-67
UNIPROTKB|P12996 bioB "biotin synthase monomer" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 794 (284.6 bits), Expect = 5.4e-79, P = 5.4e-79
 Identities = 154/303 (50%), Positives = 204/303 (67%)

Query:    29 WKLDEVIXXXXXXXXXXXXRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHY 88
             W L +V              AQ+VHR++FD  +++++ LLSIKTG C EDC YCPQS+ Y
Sbjct:     7 WTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query:    89 NTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLE 148
              T + A +++ +E V+ +A+KAK+ G+TRFCMGAAW+   +RD+  +E M+  VK +GLE
Sbjct:    67 KTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLE 126

Query:   149 TCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVXXX 208
              C+TLG L+E+QA RL   GLDYYNHNLDTSP+ YG+II+TR Y+ RL+TL+ VR+    
Sbjct:   127 ACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIK 186

Query:   209 XXXXXXXXLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRT 268
                     L E+   RA L+ QLANL   PESVPIN LV++KGTPL  +  +D  +FIRT
Sbjct:   187 VCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRT 246

Query:   269 IAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGXXXXXXXXXXXXXXSKLLK 328
             IAVARI MPTS +R+SAGR++M E TQA CF+AGANSIFYG               +L +
Sbjct:   247 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 306

Query:   329 KLG 331
             KLG
Sbjct:   307 KLG 309




GO:0005515 "protein binding" evidence=IPI
GO:0046872 "metal ion binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA;IDA
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA;IDA
GO:0004076 "biotin synthase activity" evidence=IEA;IDA
GO:0009102 "biotin biosynthetic process" evidence=IEA;IMP
TIGR_CMR|SO_2740 SO_2740 "biotin synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KSZ4 bioB "Biotin synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1112 VC_1112 "biotin synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1007 CBU_1007 "biotin synthase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2594 CPS_2594 "biotin synthase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0612 NSE_0612 "biotin synthase" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0352 ECH_0352 "biotin synthase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0218 APH_0218 "biotin synthase" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3338 SPO_3338 "biotin synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1YNS2BIOB_BURA42, ., 8, ., 1, ., 60.60630.90510.9292yesN/A
B2SWS5BIOB_BURPP2, ., 8, ., 1, ., 60.63150.87350.8421yesN/A
A3N520BIOB_BURP62, ., 8, ., 1, ., 60.62100.90220.9345yesN/A
B1Y502BIOB_LEPCP2, ., 8, ., 1, ., 60.60890.89650.9043yesN/A
Q21W43BIOB_RHOFD2, ., 8, ., 1, ., 60.61630.90510.9025yesN/A
Q1BT34BIOB_BURCA2, ., 8, ., 1, ., 60.6250.87350.8967yesN/A
Q0AE72BIOB_NITEC2, ., 8, ., 1, ., 60.60950.90510.9319yesN/A
Q2T1Q4BIOB_BURTA2, ., 8, ., 1, ., 60.63720.87930.9107yesN/A
B4E9L4BIOB_BURCJ2, ., 8, ., 1, ., 60.6250.87350.8967yesN/A
A6SU66BIOB_JANMA2, ., 8, ., 1, ., 60.65930.91090.9351yesN/A
Q477A1BIOB_CUPPJ2, ., 8, ., 1, ., 60.63810.87350.8888yesN/A
B2UDA1BIOB_RALPJ2, ., 8, ., 1, ., 60.61180.87350.8467yesN/A
Q0VMD0BIOB_ALCBS2, ., 8, ., 1, ., 60.58680.87640.7963yesN/A
Q63Y25BIOB_BURPS2, ., 8, ., 1, ., 60.6250.89650.9285yesN/A
Q1GZA6BIOB_METFK2, ., 8, ., 1, ., 60.60650.87640.9104yesN/A
Q7VVF1BIOB_BORPE2, ., 8, ., 1, ., 60.60510.88790.9223yesN/A
Q7WB85BIOB_BORPA2, ., 8, ., 1, ., 60.60640.89080.9253yesN/A
Q12F39BIOB1_POLSJ2, ., 8, ., 1, ., 60.59550.90220.9317noN/A
Q0BBD4BIOB_BURCM2, ., 8, ., 1, ., 60.58820.92810.9528yesN/A
Q2KWF1BIOB_BORA12, ., 8, ., 1, ., 60.58250.88790.9566yesN/A
B1JZE1BIOB_BURCC2, ., 8, ., 1, ., 60.6250.87350.8967yesN/A
B4S0P9BIOB_ALTMD2, ., 8, ., 1, ., 60.60960.89080.8288yesN/A
Q609V2BIOB_METCA2, ., 8, ., 1, ., 60.57890.87350.9325yesN/A
A9I023BIOB_BORPD2, ., 8, ., 1, ., 60.59270.93670.9588yesN/A
Q2Y9Y9BIOB_NITMU2, ., 8, ., 1, ., 60.61110.87930.8947yesN/A
Q1LS73BIOB_RALME2, ., 8, ., 1, ., 60.59810.95110.9594yesN/A
Q12D73BIOB2_POLSJ2, ., 8, ., 1, ., 60.60060.93670.9504yesN/A
B2JKH4BIOB_BURP82, ., 8, ., 1, ., 60.65780.87350.8660yesN/A
A2S7R3BIOB_BURM92, ., 8, ., 1, ., 60.62100.90220.9345yesN/A
B8GTH4BIOB_THISH2, ., 8, ., 1, ., 60.60320.87640.8970yesN/A
A3MNG1BIOB_BURM72, ., 8, ., 1, ., 60.62100.90220.9345yesN/A
Q62MW9BIOB_BURMA2, ., 8, ., 1, ., 60.62100.90220.9345yesN/A
Q0KF86BIOB_CUPNH2, ., 8, ., 1, ., 60.59150.93390.9475yesN/A
Q39CE4BIOB_BURS32, ., 8, ., 1, ., 60.59130.92810.95yesN/A
A4JIB7BIOB_BURVG2, ., 8, ., 1, ., 60.60710.88500.9085yesN/A
Q7WMQ3BIOB_BORBR2, ., 8, ., 1, ., 60.60640.89080.9253yesN/A
Q3JWR8BIOB_BURP12, ., 8, ., 1, ., 60.6250.89650.9285yesN/A
Q3J9D5BIOB_NITOC2, ., 8, ., 1, ., 60.60.87640.8840yesN/A
A3NQS1BIOB_BURP02, ., 8, ., 1, ., 60.6250.89650.9285yesN/A
B2AGA0BIOB_CUPTR2, ., 8, ., 1, ., 60.64140.87350.8941yesN/A
Q82SL7BIOB_NITEU2, ., 8, ., 1, ., 60.59930.90800.9376yesN/A
Q8Y2R9BIOB_RALSO2, ., 8, ., 1, ., 60.58930.90220.8722yesN/A
A1VUJ4BIOB_POLNA2, ., 8, ., 1, ., 60.61680.88500.8927yesN/A
Q7NPW1BIOB_CHRVO2, ., 8, ., 1, ., 60.57680.91660.9755yesN/A
Q146K5BIOB_BURXL2, ., 8, ., 1, ., 60.63150.87350.8444yesN/A
A9AE44BIOB_BURM12, ., 8, ., 1, ., 60.6250.87350.8967yesN/A
A0KB05BIOB_BURCH2, ., 8, ., 1, ., 60.6250.87350.8967yesN/A
A1V817BIOB_BURMS2, ., 8, ., 1, ., 60.62100.90220.9345yesN/A
A2SGQ6BIOB_METPP2, ., 8, ., 1, ., 60.62410.87930.9272yesN/A
A4G1F1BIOB_HERAR2, ., 8, ., 1, ., 60.65930.91090.9351yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.60.991
3rd Layer2.8.10.976

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
TIGR00433296 TIGR00433, bioB, biotin synthase 1e-160
PRK15108345 PRK15108, PRK15108, biotin synthase; Provisional 1e-157
PLN02389379 PLN02389, PLN02389, biotin synthase 1e-141
COG0502335 COG0502, BioB, Biotin synthase and related enzymes 1e-139
PRK06256336 PRK06256, PRK06256, biotin synthase; Validated 8e-90
PRK08508279 PRK08508, PRK08508, biotin synthase; Provisional 6e-56
smart0087694 smart00876, BATS, Biotin and Thiamin Synthesis ass 7e-36
pfam0696893 pfam06968, BATS, Biotin and Thiamin Synthesis asso 2e-30
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family 6e-29
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 3e-16
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 7e-14
TIGR03957317 TIGR03957, rSAM_HmdB, 5,10-methenyltetrahydrometha 5e-11
COG1060370 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH a 8e-09
TIGR03550322 TIGR03550, F420_cofG, 7,8-didemethyl-8-hydroxy-5-d 9e-09
TIGR03910347 TIGR03910, pyrrolys_PylB, pyrrolysine biosynthesis 2e-07
PRK06245336 PRK06245, cofG, FO synthase subunit 1; Reviewed 6e-06
PRK07094323 PRK07094, PRK07094, biotin synthase; Provisional 2e-05
PRK12928290 PRK12928, PRK12928, lipoyl synthase; Provisional 6e-05
COG0320306 COG0320, LipA, Lipoate synthase [Coenzyme metaboli 4e-04
TIGR00510302 TIGR00510, lipA, lipoate synthase 8e-04
TIGR03551343 TIGR03551, F420_cofH, 7,8-didemethyl-8-hydroxy-5-d 0.002
>gnl|CDD|232973 TIGR00433, bioB, biotin synthase Back     alignment and domain information
 Score =  450 bits (1160), Expect = e-160
 Identities = 144/297 (48%), Positives = 196/297 (65%), Gaps = 5/297 (1%)

Query: 36  NLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITAT 95
            L + P  DLL  AQ++ R +F  N+++L  +++ K+GGC EDC YC QS HY T I   
Sbjct: 2   ELPDEPLLDLLAAAQRIRRHFF-GNKVDLCSIINAKSGGCPEDCKYCAQSAHYKTGIEKY 60

Query: 96  KILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKK-IGLETCLTLG 154
            +LS+E V+ AA+KAK+ GA+RFCM  + R   DR+ + +   I E+K+  GLE C +LG
Sbjct: 61  PLLSVEEVLEAAKKAKAAGASRFCMVTSGRGPSDREFEKVLEAIREIKEETGLEVCASLG 120

Query: 155 MLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGINICCGGI 214
           +L+E QA RLK  G+D YNHNL+TSP  Y +I +T  Y++RL TLK  R  G+++C GGI
Sbjct: 121 LLSEEQAQRLKDAGVDRYNHNLETSPSYYPNICTTHTYDDRLETLKRARKAGLSVCSGGI 180

Query: 215 IGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRTIAVARI 274
           IG+ E+ + R EL F LA L+   +SVPIN LV I GTPL  +  LDP E +RTIA+ R 
Sbjct: 181 IGMGETMEDRIELAFALAELD--VDSVPINFLVPIPGTPLEDAPPLDPEECLRTIALFRF 238

Query: 275 TMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLG 331
            MP + IR++ GR+ M    QA CFLAGANSIF GD  LTT   +  +D ++L+ LG
Sbjct: 239 IMPDAEIRLAGGRELMLRELQALCFLAGANSIFTGD-YLTTAGREAEEDLEMLEDLG 294


Catalyzes the last step of the biotin biosynthesis pathway. All members of the seed alignment are in the immediate gene neighborhood of a bioA gene [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]. Length = 296

>gnl|CDD|185063 PRK15108, PRK15108, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|215219 PLN02389, PLN02389, biotin synthase Back     alignment and domain information
>gnl|CDD|223576 COG0502, BioB, Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235755 PRK06256, PRK06256, biotin synthase; Validated Back     alignment and domain information
>gnl|CDD|236279 PRK08508, PRK08508, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|214877 smart00876, BATS, Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>gnl|CDD|219245 pfam06968, BATS, Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>gnl|CDD|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|217866 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|188472 TIGR03957, rSAM_HmdB, 5,10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdB Back     alignment and domain information
>gnl|CDD|223988 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132589 TIGR03550, F420_cofG, 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>gnl|CDD|188425 TIGR03910, pyrrolys_PylB, pyrrolysine biosynthesis radical SAM protein Back     alignment and domain information
>gnl|CDD|180485 PRK06245, cofG, FO synthase subunit 1; Reviewed Back     alignment and domain information
>gnl|CDD|180835 PRK07094, PRK07094, biotin synthase; Provisional Back     alignment and domain information
>gnl|CDD|237261 PRK12928, PRK12928, lipoyl synthase; Provisional Back     alignment and domain information
>gnl|CDD|223397 COG0320, LipA, Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233002 TIGR00510, lipA, lipoate synthase Back     alignment and domain information
>gnl|CDD|132590 TIGR03551, F420_cofH, 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 348
PRK15108345 biotin synthase; Provisional 100.0
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 100.0
PLN02389379 biotin synthase 100.0
PRK08444353 hypothetical protein; Provisional 100.0
PRK06256336 biotin synthase; Validated 100.0
PRK05926370 hypothetical protein; Provisional 100.0
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 100.0
PRK08508279 biotin synthase; Provisional 100.0
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 100.0
PRK07360371 FO synthase subunit 2; Reviewed 100.0
PRK08445348 hypothetical protein; Provisional 100.0
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 100.0
KOG2900|consensus380 100.0
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 100.0
PRK05927350 hypothetical protein; Provisional 100.0
PRK07094323 biotin synthase; Provisional 100.0
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 100.0
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 100.0
PRK09234843 fbiC FO synthase; Reviewed 100.0
PRK09613469 thiH thiamine biosynthesis protein ThiH; Reviewed 100.0
PRK09234 843 fbiC FO synthase; Reviewed 100.0
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related 100.0
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 100.0
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav 100.0
PRK06267350 hypothetical protein; Provisional 100.0
PRK06245336 cofG FO synthase subunit 1; Reviewed 100.0
PRK05904353 coproporphyrinogen III oxidase; Provisional 99.97
PRK07379400 coproporphyrinogen III oxidase; Provisional 99.97
PRK06294370 coproporphyrinogen III oxidase; Provisional 99.96
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 99.96
PRK09057380 coproporphyrinogen III oxidase; Provisional 99.96
PRK06582390 coproporphyrinogen III oxidase; Provisional 99.96
PRK08207488 coproporphyrinogen III oxidase; Provisional 99.96
PRK09058449 coproporphyrinogen III oxidase; Provisional 99.96
PRK12928290 lipoyl synthase; Provisional 99.96
PRK05799374 coproporphyrinogen III oxidase; Provisional 99.96
PRK08446350 coproporphyrinogen III oxidase; Provisional 99.96
PRK05628375 coproporphyrinogen III oxidase; Validated 99.96
PRK08599377 coproporphyrinogen III oxidase; Provisional 99.96
PRK05660378 HemN family oxidoreductase; Provisional 99.95
PRK08898394 coproporphyrinogen III oxidase; Provisional 99.95
PRK05481289 lipoyl synthase; Provisional 99.95
PRK08208430 coproporphyrinogen III oxidase; Validated 99.95
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 99.94
PTZ00413398 lipoate synthase; Provisional 99.94
TIGR00510302 lipA lipoate synthase. The family shows strong seq 99.94
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 99.94
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 99.94
TIGR01579414 MiaB-like-C MiaB-like tRNA modifying enzyme. This 99.94
TIGR00538455 hemN oxygen-independent coproporphyrinogen III oxi 99.93
PRK13347453 coproporphyrinogen III oxidase; Provisional 99.93
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 99.93
PRK14331437 (dimethylallyl)adenosine tRNA methylthiotransferas 99.93
PRK08629433 coproporphyrinogen III oxidase; Provisional 99.93
PRK09249453 coproporphyrinogen III oxidase; Provisional 99.93
PRK14327509 (dimethylallyl)adenosine tRNA methylthiotransferas 99.93
COG1856275 Uncharacterized homolog of biotin synthetase [Func 99.92
PLN02428349 lipoic acid synthase 99.92
TIGR00089429 RNA modification enzyme, MiaB family. This subfami 99.92
PRK14325444 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
TIGR01125430 MiaB-like tRNA modifying enzyme YliG, TIGR01125. T 99.92
PRK14332449 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14329467 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14340445 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14339420 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14335455 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
TIGR01574438 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3 99.92
PRK14328439 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14336418 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14326502 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14338459 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14330434 (dimethylallyl)adenosine tRNA methylthiotransferas 99.92
PRK14334440 (dimethylallyl)adenosine tRNA methylthiotransferas 99.91
TIGR01578420 MiaB-like-B MiaB-like tRNA modifying enzyme, archa 99.91
PRK14337446 (dimethylallyl)adenosine tRNA methylthiotransferas 99.91
PRK14333448 (dimethylallyl)adenosine tRNA methylthiotransferas 99.91
PRK14862440 rimO ribosomal protein S12 methylthiotransferase; 99.91
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 99.9
TIGR01211 522 ELP3 histone acetyltransferase, ELP3 family. The S 99.9
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 99.89
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, 99.88
COG1242312 Predicted Fe-S oxidoreductase [General function pr 99.86
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 99.83
COG1243 515 ELP3 Histone acetyltransferase [Transcription / Ch 99.8
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 99.79
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 99.79
COG1032490 Fe-S oxidoreductase [Energy production and convers 99.78
PLN02951373 Molybderin biosynthesis protein CNX2 99.78
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 99.78
PRK00955620 hypothetical protein; Provisional 99.77
PRK01254707 hypothetical protein; Provisional 99.77
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 99.77
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 99.76
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 99.74
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 99.71
PRK05301378 pyrroloquinoline quinone biosynthesis protein PqqE 99.68
smart0087694 BATS Biotin and Thiamin Synthesis associated domai 99.68
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 99.67
PF0696893 BATS: Biotin and Thiamin Synthesis associated doma 99.67
TIGR01290 442 nifB nitrogenase cofactor biosynthesis protein Nif 99.67
TIGR02493235 PFLA pyruvate formate-lyase 1-activating enzyme. A 99.67
TIGR02109358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 99.64
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 99.64
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; P 99.58
TIGR02495191 NrdG2 anaerobic ribonucleoside-triphosphate reduct 99.52
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy produc 99.5
PRK13762322 tRNA-modifying enzyme; Provisional 99.5
PRK14455356 ribosomal RNA large subunit methyltransferase N; P 99.5
PRK14456368 ribosomal RNA large subunit methyltransferase N; P 99.49
PRK14463349 ribosomal RNA large subunit methyltransferase N; P 99.47
COG2516339 Biotin synthase-related enzyme [General function p 99.47
PRK14460354 ribosomal RNA large subunit methyltransferase N; P 99.47
KOG2672|consensus360 99.46
COG2100414 Predicted Fe-S oxidoreductase [General function pr 99.44
COG4277404 Predicted DNA-binding protein with the Helix-hairp 99.44
PRK14469343 ribosomal RNA large subunit methyltransferase N; P 99.44
PRK14468343 ribosomal RNA large subunit methyltransferase N; P 99.42
TIGR00238331 KamA family protein. Note that the E. coli homolog 99.42
PRK14459373 ribosomal RNA large subunit methyltransferase N; P 99.41
TIGR03820417 lys_2_3_AblA lysine-2,3-aminomutase. This model de 99.4
PRK14467348 ribosomal RNA large subunit methyltransferase N; P 99.37
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 99.37
TIGR00048355 radical SAM enzyme, Cfr family. A Staphylococcus s 99.36
PRK14462356 ribosomal RNA large subunit methyltransferase N; P 99.36
TIGR03278404 methan_mark_10 putative methanogenesis marker prot 99.35
PRK14470336 ribosomal RNA large subunit methyltransferase N; P 99.35
PRK14466345 ribosomal RNA large subunit methyltransferase N; P 99.35
KOG4355|consensus547 99.33
PRK13758370 anaerobic sulfatase-maturase; Provisional 99.33
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 99.31
PRK14457345 ribosomal RNA large subunit methyltransferase N; P 99.31
COG0535347 Predicted Fe-S oxidoreductases [General function p 99.29
PRK14454342 ribosomal RNA large subunit methyltransferase N; P 99.29
PRK13745 412 anaerobic sulfatase-maturase; Provisional 99.26
COG0731296 Fe-S oxidoreductases [Energy production and conver 99.22
PRK11194372 ribosomal RNA large subunit methyltransferase N; P 99.21
PRK14465342 ribosomal RNA large subunit methyltransferase N; P 99.19
COG1244358 Predicted Fe-S oxidoreductase [General function pr 99.19
KOG2492|consensus552 99.17
COG2108353 Uncharacterized conserved protein related to pyruv 99.14
PRK14453347 chloramphenicol/florfenicol resistance protein; Pr 99.12
TIGR02494295 PFLE_PFLC glycyl-radical enzyme activating protein 99.11
PRK14464344 ribosomal RNA large subunit methyltransferase N; P 99.09
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) 99.06
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 99.03
PRK10076213 pyruvate formate lyase II activase; Provisional 98.97
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn 98.9
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 98.89
COG1533297 SplB DNA repair photolyase [DNA replication, recom 98.86
COG5014228 Predicted Fe-S oxidoreductase [General function pr 98.76
KOG2535|consensus 554 98.75
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport 98.67
COG0820349 Predicted Fe-S-cluster redox enzyme [General funct 98.66
KOG2876|consensus323 98.55
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 98.49
PF13353139 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 98.43
PF00682237 HMGL-like: HMGL-like of this family is not conserv 98.42
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 98.4
TIGR02826147 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosph 98.34
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of 98.34
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 98.27
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 98.23
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 98.18
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 98.18
COG1625414 Fe-S oxidoreductase, related to NifB/MoaA family [ 98.16
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 98.14
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 98.13
PF13394119 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 98.12
PLN02746347 hydroxymethylglutaryl-CoA lyase 98.07
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 98.04
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 98.03
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 98.01
TIGR02491154 NrdG anaerobic ribonucleoside-triphosphate reducta 98.0
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 97.99
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 97.88
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 97.75
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 97.75
PRK00915 513 2-isopropylmalate synthase; Validated 97.69
PRK11121154 nrdG anaerobic ribonucleotide reductase-activating 97.68
PRK12330 499 oxaloacetate decarboxylase; Provisional 97.66
PRK14041 467 oxaloacetate decarboxylase; Provisional 97.64
PRK09389 488 (R)-citramalate synthase; Provisional 97.63
COG0602212 NrdG Organic radical activating enzymes [Posttrans 97.58
PRK08091228 ribulose-phosphate 3-epimerase; Validated 97.55
PRK12331 448 oxaloacetate decarboxylase; Provisional 97.54
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 97.51
PRK12581 468 oxaloacetate decarboxylase; Provisional 97.5
PRK09282 592 pyruvate carboxylase subunit B; Validated 97.48
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 97.37
PRK08005210 epimerase; Validated 97.36
PRK14040 593 oxaloacetate decarboxylase; Provisional 97.26
PRK14057254 epimerase; Provisional 97.23
COG1964 475 Predicted Fe-S oxidoreductases [General function p 97.21
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 97.16
PRK14042 596 pyruvate carboxylase subunit B; Provisional 97.13
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 97.12
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 97.11
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.09
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 97.07
PLN03228 503 methylthioalkylmalate synthase; Provisional 97.02
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 96.93
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 96.88
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 96.86
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.81
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 96.8
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 96.79
PRK11613282 folP dihydropteroate synthase; Provisional 96.79
PLN02321 632 2-isopropylmalate synthase 96.73
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 96.62
TIGR00970 564 leuA_yeast 2-isopropylmalate synthase, yeast type. 96.51
KOG3111|consensus224 96.51
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 96.49
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 96.42
PRK14847333 hypothetical protein; Provisional 96.38
PF05853272 DUF849: Prokaryotic protein of unknown function (D 96.19
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 95.82
PRK12999 1146 pyruvate carboxylase; Reviewed 95.81
PRK13753279 dihydropteroate synthase; Provisional 95.74
TIGR01496257 DHPS dihydropteroate synthase. This model represen 95.65
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 95.51
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 95.42
PRK14024241 phosphoribosyl isomerase A; Provisional 95.31
PLN02334229 ribulose-phosphate 3-epimerase 94.98
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 94.86
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 94.78
cd00423258 Pterin_binding Pterin binding enzymes. This family 94.69
PLN02617538 imidazole glycerol phosphate synthase hisHF 94.68
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 94.65
PRK15452 443 putative protease; Provisional 94.52
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 94.5
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 94.43
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.41
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 94.32
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 94.23
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 94.21
TIGR00284499 dihydropteroate synthase-related protein. This pro 94.2
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 94.04
COG0826 347 Collagenase and related proteases [Posttranslation 93.87
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.86
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 93.84
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 93.83
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 93.82
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 93.71
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 93.63
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 93.33
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 93.19
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 93.16
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 93.03
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 92.92
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 92.91
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 92.79
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 92.78
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 92.64
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 92.36
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 92.33
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 92.32
PRK03739 552 2-isopropylmalate synthase; Validated 92.04
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 91.77
PRK11572248 copper homeostasis protein CutC; Provisional 91.43
KOG2550|consensus503 91.29
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 91.25
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 91.13
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 91.04
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 90.92
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.92
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 90.91
cd00740252 MeTr MeTr subgroup of pterin binding enzymes. This 90.89
PF05913357 DUF871: Bacterial protein of unknown function (DUF 90.73
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 90.48
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 90.45
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 90.4
PF10113 505 Fibrillarin_2: Fibrillarin-like archaeal protein; 90.35
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.33
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.31
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 90.27
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 90.17
KOG2367|consensus 560 90.16
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 90.15
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 90.03
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 89.97
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 89.75
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 89.63
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 89.48
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 89.36
cd01321345 ADGF Adenosine deaminase-related growth factors (A 89.16
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 89.1
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 89.08
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.98
PRK07709285 fructose-bisphosphate aldolase; Provisional 88.94
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 88.86
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 88.78
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 88.76
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.59
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 88.53
PRK12330499 oxaloacetate decarboxylase; Provisional 88.35
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 88.35
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 88.3
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 88.3
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 88.25
PTZ00124362 adenosine deaminase; Provisional 88.0
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 87.95
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.86
COG1816345 Add Adenosine deaminase [Nucleotide transport and 87.79
PRK08610286 fructose-bisphosphate aldolase; Reviewed 87.76
COG3589360 Uncharacterized conserved protein [Function unknow 87.5
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 87.5
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 87.45
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 87.31
PRK00507221 deoxyribose-phosphate aldolase; Provisional 87.23
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 87.17
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 87.04
PLN02591250 tryptophan synthase 86.9
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 86.83
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 86.75
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 86.7
COG3142241 CutC Uncharacterized protein involved in copper re 86.67
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 86.57
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 86.39
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 86.16
PRK06806281 fructose-bisphosphate aldolase; Provisional 86.12
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 86.06
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 86.05
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 85.91
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 85.91
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 85.9
PRK08185283 hypothetical protein; Provisional 85.81
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 85.76
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 85.69
cd02812219 PcrB_like PcrB_like proteins. One member of this f 85.65
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 85.27
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 85.18
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 84.8
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 84.78
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 84.75
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 84.59
PRK00507221 deoxyribose-phosphate aldolase; Provisional 84.43
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 84.38
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 84.38
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 84.35
PRK05581220 ribulose-phosphate 3-epimerase; Validated 84.24
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 84.14
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 83.97
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 83.74
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 83.51
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 83.29
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 83.11
PRK12331 448 oxaloacetate decarboxylase; Provisional 83.07
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 82.93
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 82.83
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 82.81
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 82.75
PRK02227238 hypothetical protein; Provisional 82.74
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.58
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 82.55
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 82.32
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 82.24
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 82.24
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 82.18
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 82.14
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coe 82.09
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 81.8
TIGR01430324 aden_deam adenosine deaminase. This family include 81.75
smart00642166 Aamy Alpha-amylase domain. 81.68
TIGR01334277 modD putative molybdenum utilization protein ModD. 81.51
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 81.46
PF01208343 URO-D: Uroporphyrinogen decarboxylase (URO-D); Int 81.32
TIGR01463340 mtaA_cmuA methyltransferase, MtaA/CmuA family. Thi 81.15
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 81.12
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 81.03
TIGR03586327 PseI pseudaminic acid synthase. 80.88
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 80.71
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 80.55
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 80.36
PRK12581468 oxaloacetate decarboxylase; Provisional 80.16
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 80.1
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 80.07
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 80.05
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.9e-59  Score=433.05  Aligned_cols=322  Identities=55%  Similarity=0.962  Sum_probs=294.5

Q ss_pred             ccCCCCCHHHHHHhhcCChHHHHHHHHHHHHhhcCCCceEEEEEEEeecCCCCCCCCcCCCCCCCCCCCccccccCHHHH
Q psy8190          24 SQSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESV  103 (348)
Q Consensus        24 ~~~~~ls~~e~~~Ll~~~~~~l~~~A~~~~~~~~~g~~v~~~~~i~i~t~~C~~~C~fC~~~~~~~~~~~~~~~~~~eei  103 (348)
                      +-+++||++|++.|++.|+.+|++.|+++|+++|.++.|+++.++++.|++|+.+|.||++++.+....+.+..++++||
T Consensus         2 ~~~~~l~~~e~~~l~~~~l~~l~~~A~~ir~~~fg~~~v~l~~i~~~~Tn~C~~~C~yC~~~~~~~~~~~~~~~ls~eEI   81 (345)
T PRK15108          2 AHRPRWTLSQVTELFEKPLLELLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQV   81 (345)
T ss_pred             CccCCCCHHHHHHHHcccHHHHHHHHHHHHHHhcCCCEEEEEEeEEEECCCcCCCCcCCCCcccCCCCCCcccCCCHHHH
Confidence            34679999999999988999999999999999995578999999998899999999999999754334445556999999


Q ss_pred             HHHHHHHHhCCCCEEEEeccCCCCCcccHHHHHHHHHHHHhcCcEEEEecCCCCHHHHHHHHHhCCCeeeccCCCCHHHH
Q psy8190         104 ITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLY  183 (348)
Q Consensus       104 ~~~~~~~~~~G~~~i~l~gg~~~~~~~~~~~~~~l~~~i~~~~~~i~~~~g~l~~e~l~~Lk~aG~~~i~~g~et~~e~l  183 (348)
                      ++.++.+.+.|+++|++++++..|+..+.+++.++++.+++.++.++++.|.++++.++.|+++|++++++++||+++.|
T Consensus        82 ~~~a~~~~~~G~~~i~i~~~g~~p~~~~~e~i~~~i~~ik~~~i~v~~s~G~ls~e~l~~LkeAGld~~n~~leT~p~~f  161 (345)
T PRK15108         82 LESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLETCMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFY  161 (345)
T ss_pred             HHHHHHHHHcCCCEEEEEecCCCCCcchHHHHHHHHHHHHhCCCEEEEeCCcCCHHHHHHHHHcCCCEEeeccccChHhc
Confidence            99999999999999999877656656678999999999998888889999999999999999999999999999999999


Q ss_pred             hccCCCCCHHHHHHHHHHHHHcCCeeeEeEeeecCCCHHHHHHHHHHHHhcCCCCCeeecccccccCCCCCCCCCCCCHH
Q psy8190         184 GDIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPL  263 (348)
Q Consensus       184 ~~i~~~~~~~~~~~~i~~~~~~G~~i~~~~i~Glget~e~~~~~l~~l~~l~~~~~~i~~~~l~P~~gT~l~~~~~~~~~  263 (348)
                      ..+++++++++|+++++.++++|+.+++++|+|+|||.+|+++++..++++++.+++|++++|+|.+||||++.++.++.
T Consensus       162 ~~I~~~~~~~~rl~~i~~a~~~G~~v~sg~i~GlgEt~ed~v~~~~~l~~l~~~~~~ip~~~~~P~~gTpl~~~~~~~~~  241 (345)
T PRK15108        162 GNIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF  241 (345)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHcCCceeeEEEEeCCCCHHHHHHHHHHHHhccCCCCEEEeCCccCCCCCCCCCCCCCCHH
Confidence            99999999999999999999999999999999999999999999999999954378999999999999999988889999


Q ss_pred             HHHHHHHHHHHHCCCCceeccccccccchhhHHHHHHhCcceeeeCCeeccCCCCCchHHHHHHHHcCCCchhhhhHHhh
Q psy8190         264 EFIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRNIKIKMKN  343 (348)
Q Consensus       264 ~~~~~~a~~R~~lp~~~i~~s~g~~~l~~~~~~~~l~~GAn~~~~~~~~~~~~g~~~~~~~~~i~~~G~~p~~~~~~~~~  343 (348)
                      +.++++|++|+++|+..+++++||..++.+.++.+|.+|||++|.|++++|+.|.+.+++.+||+++||+|++|+-.--+
T Consensus       242 e~lr~iAi~Rl~lp~~~i~i~~g~~~~~~~~~~~~l~~Gan~~~~g~~~ltt~g~~~~~~~~~i~~~g~~~~~~~~~~~~  321 (345)
T PRK15108        242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTAVLAGD  321 (345)
T ss_pred             HHHHHHHHHHHHCCCceeeecccHhHhChhhHHHHHHcCCcEEEECCccccCCCCCHHHHHHHHHHcCCCcccccccccc
Confidence            99999999999999999999999988888899999999999999999877888999999999999999999999976555


Q ss_pred             hh
Q psy8190         344 NI  345 (348)
Q Consensus       344 ~~  345 (348)
                      |.
T Consensus       322 ~~  323 (345)
T PRK15108        322 NE  323 (345)
T ss_pred             hh
Confidence            43



>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>KOG2900|consensus Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>TIGR00089 RNA modification enzyme, MiaB family Back     alignment and domain information
>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type Back     alignment and domain information
>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>smart00876 BATS Biotin and Thiamin Synthesis associated domain Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>PF06968 BATS: Biotin and Thiamin Synthesis associated domain; InterPro: IPR010722 Biotin synthase (BioB), 2 Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>KOG2672|consensus Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR00238 KamA family protein Back     alignment and domain information
>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03820 lys_2_3_AblA lysine-2,3-aminomutase Back     alignment and domain information
>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>TIGR00048 radical SAM enzyme, Cfr family Back     alignment and domain information
>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>KOG4355|consensus Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2492|consensus Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2535|consensus Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>KOG2876|consensus Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PF13353 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF13394 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 1TV7_A 2FB2_A 2FB3_A Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>KOG3111|consensus Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK14847 hypothetical protein; Provisional Back     alignment and domain information
>PF05853 DUF849: Prokaryotic protein of unknown function (DUF849); InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03739 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd00740 MeTr MeTr subgroup of pterin binding enzymes Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF10113 Fibrillarin_2: Fibrillarin-like archaeal protein; InterPro: IPR016760 Members of this protein family are HmdC, whose gene regularly occurs in the context of genes for HmdA (5,10-methenyltetrahydromethanopterin hydrogenase) and the radical SAM protein HmdB involved in biosynthesis of the HmdA cofactor Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>KOG2367|consensus Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG1816 Add Adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PF01208 URO-D: Uroporphyrinogen decarboxylase (URO-D); InterPro: IPR000257 Uroporphyrinogen decarboxylase (URO-D), the fifth enzyme of the haem biosynthetic pathway, catalyses the sequential decarboxylation of the four acetyl side chains of uroporphyrinogen to yield coproporphyrinogen [] Back     alignment and domain information
>TIGR01463 mtaA_cmuA methyltransferase, MtaA/CmuA family Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
1r30_A369 The Crystal Structure Of Biotin Synthase, An S- Ade 3e-89
3iiz_A348 X-Ray Structure Of The Fefe-Hydrogenase Maturase Hy 4e-05
3ciw_A348 X-Ray Structure Of The [fefe]-Hydrogenase Maturase 5e-05
3cix_A348 X-ray Structure Of The [fefe]-hydrogenase Maturase 6e-05
>pdb|1R30|A Chain A, The Crystal Structure Of Biotin Synthase, An S- Adenosylmethionine-dependent Radical Enzyme Length = 369 Back     alignment and structure

Iteration: 1

Score = 325 bits (832), Expect = 3e-89, Method: Compositional matrix adjust. Identities = 154/303 (50%), Positives = 204/303 (67%) Query: 29 WKLDEVIXXXXXXXXXXXXRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHY 88 W L +V AQ+VHR++FD +++++ LLSIKTG C EDC YCPQS+ Y Sbjct: 30 WTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 89 Query: 89 NTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLE 148 T + A +++ +E V+ +A+KAK+ G+TRFCMGAAW+ +RD+ +E M+ VK +GLE Sbjct: 90 KTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLE 149 Query: 149 TCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVXXX 208 C+TLG L+E+QA RL GLDYYNHNLDTSP+ YG+II+TR Y+ RL+TL+ VR+ Sbjct: 150 ACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIK 209 Query: 209 XXXXXXXXLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRT 268 L E+ RA L+ QLANL PESVPIN LV++KGTPL + +D +FIRT Sbjct: 210 VCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRT 269 Query: 269 IAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGXXXXXXXXXXXXXXSKLLK 328 IAVARI MPTS +R+SAGR++M E TQA CF+AGANSIFYG +L + Sbjct: 270 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 329 Query: 329 KLG 331 KLG Sbjct: 330 KLG 332
>pdb|3IIZ|A Chain A, X-Ray Structure Of The Fefe-Hydrogenase Maturase Hyde From T. Maritima In Complex With S-Adenosyl-L-Methionine Length = 348 Back     alignment and structure
>pdb|3CIW|A Chain A, X-Ray Structure Of The [fefe]-Hydrogenase Maturase Hyde From Thermotoga Maritima Length = 348 Back     alignment and structure
>pdb|3CIX|A Chain A, X-ray Structure Of The [fefe]-hydrogenase Maturase Hyde From Thermotoga Maritima In Complex With Thiocyanate Length = 348 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 0.0
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 1e-107
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 1e-106
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Length = 369 Back     alignment and structure
 Score =  517 bits (1334), Expect = 0.0
 Identities = 176/307 (57%), Positives = 232/307 (75%)

Query: 29  WKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHY 88
           W L +V  LF  P  DLLF AQ+VHR++FD  +++++ LLSIKTG C EDC YCPQS+ Y
Sbjct: 30  WTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 89

Query: 89  NTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLE 148
            T + A +++ +E V+ +A+KAK+ G+TRFCMGAAW+   +RD+  +E M+  VK +GLE
Sbjct: 90  KTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLE 149

Query: 149 TCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGIN 208
            C+TLG L+E+QA RL   GLDYYNHNLDTSP+ YG+II+TR Y+ RL+TL+ VR+ GI 
Sbjct: 150 ACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIK 209

Query: 209 ICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRT 268
           +C GGI+GL E+   RA L+ QLANL   PESVPIN LV++KGTPL  +  +D  +FIRT
Sbjct: 210 VCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRT 269

Query: 269 IAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLK 328
           IAVARI MPTS +R+SAGR++M E TQA CF+AGANSIFYG KLLTT N + + D +L +
Sbjct: 270 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 329

Query: 329 KLGINTR 335
           KLG+N +
Sbjct: 330 KLGLNPQ 336


>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Length = 350 Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Length = 348 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 100.0
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 100.0
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 100.0
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 99.94
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 99.94
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 99.81
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.79
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 99.78
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.4 99.66
3rfa_A404 Ribosomal RNA large subunit methyltransferase N; r 99.57
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 99.51
3can_A182 Pyruvate-formate lyase-activating enzyme; structur 99.01
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 98.57
4fhd_A368 Spore photoproduct lyase; partial TIM-barrel, DNA 98.47
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 98.4
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 98.3
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 98.26
3ble_A337 Citramalate synthase from leptospira interrogans; 98.16
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 97.84
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 97.84
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 97.63
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 97.61
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 97.54
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 97.51
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 97.42
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.37
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 97.29
3lot_A314 Uncharacterized protein; protein of unknown functi 97.03
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 96.89
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 96.83
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 96.79
3e49_A311 Uncharacterized protein DUF849 with A TIM barrel; 96.76
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 96.6
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 96.52
3e02_A311 Uncharacterized protein DUF849; structural genomic 96.42
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 96.4
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 96.38
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 96.2
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.18
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 96.08
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 96.02
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 96.02
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 95.93
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 95.91
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 95.91
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 95.89
3no5_A275 Uncharacterized protein; PFAM DUF849 domain contai 95.87
2y7e_A282 3-keto-5-aminohexanoate cleavage enzyme; lyase, al 95.79
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 95.72
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 95.7
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 95.36
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.25
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 95.09
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 95.07
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 94.97
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 94.92
3chv_A284 Prokaryotic domain of unknown function (DUF849) W 94.86
3c6c_A316 3-keto-5-aminohexanoate cleavage enzyme; DUF849 fa 94.85
3hq1_A 644 2-isopropylmalate synthase; LEUA, mycobacterium tu 94.75
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 94.55
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 94.47
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 94.45
1x7f_A 385 Outer surface protein; structural genomics, unknow 94.14
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 94.0
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 93.88
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 93.87
2bmb_A545 Folic acid synthesis protein FOL1; folate biosynth 93.85
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 93.73
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 93.7
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 93.32
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.19
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 93.14
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 92.98
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.95
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 92.88
4i6k_A294 Amidohydrolase family protein; enzyme function ini 92.66
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 92.07
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.06
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 92.02
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 91.94
2p0o_A372 Hypothetical protein DUF871; structural genomics, 91.94
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 91.23
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 90.98
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 90.71
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 90.52
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 90.47
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 90.06
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 89.98
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 89.64
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 89.43
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 89.25
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 89.19
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 88.75
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 88.34
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 88.03
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 87.87
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 87.8
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 87.74
3oa3_A288 Aldolase; structural genomics, seattle structural 87.62
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 87.56
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 87.47
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 87.43
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 87.43
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 87.42
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 87.41
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 87.11
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 86.62
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 86.09
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 85.65
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 85.61
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 85.55
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 85.39
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 85.36
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 85.29
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 84.85
3fst_A304 5,10-methylenetetrahydrofolate reductase; TIM barr 84.63
3feq_A423 Putative amidohydrolase; unknown source, sargasso 84.56
4gxw_A380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 84.5
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 84.23
1u83_A276 Phosphosulfolactate synthase; structural genomics, 84.21
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 84.1
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 83.8
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 83.5
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 83.31
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 82.93
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 82.93
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 82.05
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 81.9
3lmz_A257 Putative sugar isomerase; structural genomics, joi 81.82
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 81.82
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 81.44
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 81.42
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 81.1
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 80.65
3o0f_A301 Putative metal-dependent phosphoesterase; structur 80.61
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
Probab=100.00  E-value=1.5e-50  Score=383.51  Aligned_cols=315  Identities=56%  Similarity=0.983  Sum_probs=287.4

Q ss_pred             cCCCCCHHHHHHhhcCChHHHHHHHHHHHHhhcCCCceEEEEEEEeecCCCCCCCCcCCCCCCCCCCCccccccCHHHHH
Q psy8190          25 QSLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVI  104 (348)
Q Consensus        25 ~~~~ls~~e~~~Ll~~~~~~l~~~A~~~~~~~~~g~~v~~~~~i~i~t~~C~~~C~fC~~~~~~~~~~~~~~~~~~eei~  104 (348)
                      ...++|.+|+..|++.|+.+|+..|+++++++|.|+.|.++.++++.|++|+++|.||+++..+.....+++.+++++|+
T Consensus        26 ~~~~ls~~e~~~l~~~~~~~L~~~A~~~~~~~~~~~~v~~~~~i~i~t~~C~~~C~yC~~~~~~~~~~~~~~~~s~eei~  105 (369)
T 1r30_A           26 HRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVL  105 (369)
T ss_dssp             -CCCCCSTTTHHHHHSCHHHHHHHHHHHHHHHSCTTCCEEEEEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHH
T ss_pred             ccCCCCHHHHHHHHhccHHHHHHHHHHHHHHhcCCCEEEEEEEEEEECCCCcccCccCCCCCcCCCCCcccccCCHHHHH
Confidence            46789999999999999999999999999998866899999899966999999999999987543333456568999999


Q ss_pred             HHHHHHHhCCCCEEEEeccCCCCCcccHHHHHHHHHHHHhcCcEEEEecCCCCHHHHHHHHHhCCCeeeccCCCCHHHHh
Q psy8190         105 TAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYG  184 (348)
Q Consensus       105 ~~~~~~~~~G~~~i~l~gg~~~~~~~~~~~~~~l~~~i~~~~~~i~~~~g~l~~e~l~~Lk~aG~~~i~~g~et~~e~l~  184 (348)
                      ++++.+.+.|++.|+|+||++.|...+.+++.++++.+++.++++++++|.++++.++.|+++|++++++++||++++|+
T Consensus       106 ~~~~~~~~~g~~~i~~~gg~~~p~~~~~~~l~~ll~~ik~~g~~i~~t~G~l~~e~l~~L~~aGvd~v~i~les~~e~~~  185 (369)
T 1r30_A          106 ESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG  185 (369)
T ss_dssp             HHHHHHHHTTCSEEEEEECCSSCCTTTHHHHHHHHHHHHHTTSEEEEECSSCCHHHHHHHHHHCCCEEECCCBSCHHHHH
T ss_pred             HHHHHHHHcCCcEEEEEeCCCCCCcCCHHHHHHHHHHHHHcCCeEEEecCCCCHHHHHHHHHCCCCEEeecCcCCHHHHH
Confidence            99999888999999998875345556789999999999998889999999999999999999999999999999999999


Q ss_pred             ccCCCCCHHHHHHHHHHHHHcCCeeeEeEeeecCCCHHHHHHHHHHHHhcCCCCCeeecccccccCCCCCCCCCCCCHHH
Q psy8190         185 DIISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLE  264 (348)
Q Consensus       185 ~i~~~~~~~~~~~~i~~~~~~G~~i~~~~i~Glget~e~~~~~l~~l~~l~~~~~~i~~~~l~P~~gT~l~~~~~~~~~~  264 (348)
                      .+++++++++++++++.++++|+.+++++|+|++||.+++.++++++++++..+++++++.|+|.|||||++.++++.++
T Consensus       186 ~i~~~~~~~~~l~~i~~a~~~Gi~v~~~~I~Gl~et~ed~~~~l~~l~~l~~~~~~i~~~~l~p~~gT~l~~~~~~~~~~  265 (369)
T 1r30_A          186 NIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFD  265 (369)
T ss_dssp             HHCCSSCHHHHHHHHHHHHHHHCEEECCEEECSSCCHHHHHHHHHHHHSSSSCCSEEEEEECCCCTTSTTSSCCCCCHHH
T ss_pred             HhCCCCCHHHHHHHHHHHHHcCCeeeeeeEeeCCCCHHHHHHHHHHHHhhcCCCCEEEeeeeeecCCCcCCCCCCCCHHH
Confidence            99999999999999999999999999999999999999999999999999744789999999999999999888999999


Q ss_pred             HHHHHHHHHHHCCCCceeccccccccchhhHHHHHHhCcceeeeCCeeccCCCCCchHHHHHHHHcCCCchhhhh
Q psy8190         265 FIRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRNIKI  339 (348)
Q Consensus       265 ~~~~~a~~R~~lp~~~i~~s~g~~~l~~~~~~~~l~~GAn~~~~~~~~~~~~g~~~~~~~~~i~~~G~~p~~~~~  339 (348)
                      .+++++++|.++|+..++++++|+++++..++.++++|||+++.|+++.+.+|++.+++.++++++|+.|++|.-
T Consensus       266 ~~~~~~~~r~~l~~~~i~i~~~~~~l~~~~~~~~l~~Gan~~~~g~~~~t~~~~~~~~~~~~i~~~g~~~~~~~~  340 (369)
T 1r30_A          266 FIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTAV  340 (369)
T ss_dssp             HHHHHHHHHHHCTTSEEEEESSGGGSCHHHHHHHHHHTCCEEECSSBSSSSBCCCHHHHHHHHHHTTCCSCCCC-
T ss_pred             HHHHHHHHHHhCCCCceEeecchhhcChHHHHHHhhCCCceEEeCCeeeCCCCCCHHHHHHHHHHcCCCeecccc
Confidence            999999999999998888888899988888999999999999999988899999999999999999999998874



>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A* Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>4fhd_A Spore photoproduct lyase; partial TIM-barrel, DNA repair, damaged DNA; HET: EEM 0TT; 2.00A {Geobacillus thermodenitrificans} PDB: 4fhc_A* 4fhg_A* 4fhe_A* 4fhf_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3lot_A Uncharacterized protein; protein of unknown function, structural genomics, joint CENT structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3e49_A Uncharacterized protein DUF849 with A TIM barrel; structural genomics, joint center for structural genomics; HET: MSE; 1.75A {Burkholderia xenovorans LB400} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3e02_A Uncharacterized protein DUF849; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia xenovorans LB400} Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>2y7e_A 3-keto-5-aminohexanoate cleavage enzyme; lyase, aldolase; 1.28A {Candidatus cloacamonas acidaminovoransorganism_taxid} PDB: 2y7d_A 2y7f_A* 2y7g_A Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A Back     alignment and structure
>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; DUF849 family protein, TIM beta/alpha-barrel fold, structura genomics; HET: MSE; 1.72A {Ralstonia eutropha} Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>2bmb_A Folic acid synthesis protein FOL1; folate biosynthesis, transferase, ligase, multifunctional enzyme; HET: PMM; 2.3A {Saccharomyces cerevisiae} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3fst_A 5,10-methylenetetrahydrofolate reductase; TIM barrel, flavin, amino-acid biosynthesis, FAD, flavoprotein, methionine biosynthesis, NAD; HET: FAD MRY; 1.65A {Escherichia coli k-12} PDB: 3fsu_A* 1zp3_A* 1zpt_A* 1zrq_A* 1zp4_A* 2fmn_A* 2fmo_A* 1b5t_A* Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3o0f_A Putative metal-dependent phosphoesterase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: AMP; 1.94A {Bifidobacterium adolescentis} PDB: 3e0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 348
d1r30a_312 c.1.28.1 (A:) Biotin synthase {Escherichia coli [T 3e-86
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]
 Score =  260 bits (665), Expect = 3e-86
 Identities = 176/305 (57%), Positives = 231/305 (75%)

Query: 29  WKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHY 88
           W L +V  LF  P  DLLF AQ+VHR++FD  +++++ LLSIKTG C EDC YCPQS+ Y
Sbjct: 4   WTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 63

Query: 89  NTEITATKILSIESVITAAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLE 148
            T + A +++ +E V+ +A+KAK+ G+TRFCMGAAW+   +RD+  +E M+  VK +GLE
Sbjct: 64  KTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLE 123

Query: 149 TCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGDIISTRDYENRLNTLKNVRNVGIN 208
            C+TLG L+E+QA RL   GLDYYNHNLDTSP+ YG+II+TR Y+ RL+TL+ VR+ GI 
Sbjct: 124 ACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIK 183

Query: 209 ICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEFIRT 268
           +C GGI+GL E+   RA L+ QLANL   PESVPIN LV++KGTPL  +  +D  +FIRT
Sbjct: 184 VCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRT 243

Query: 269 IAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLK 328
           IAVARI MPTS +R+SAGR++M E TQA CF+AGANSIFYG KLLTT N + + D +L +
Sbjct: 244 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 303

Query: 329 KLGIN 333
           KLG+N
Sbjct: 304 KLGLN 308


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 100.0
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 99.93
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 99.54
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 97.57
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 96.67
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 96.4
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 96.26
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 96.2
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 96.06
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 95.83
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 95.27
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 94.87
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 94.41
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 94.13
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 94.09
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 93.49
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 92.98
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 92.32
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 91.32
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 91.28
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 90.85
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 89.83
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 89.26
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.98
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 88.87
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 87.68
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 87.26
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 87.06
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 86.35
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 86.3
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 85.6
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 84.98
d1sr9a2310 2-isopropylmalate synthase LeuA, catalytic domain 84.29
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 83.54
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 82.73
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 82.18
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 82.04
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 81.89
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 81.31
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 81.08
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 81.07
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 80.72
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 80.49
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 80.48
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 80.12
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.6e-56  Score=411.69  Aligned_cols=311  Identities=57%  Similarity=0.992  Sum_probs=284.0

Q ss_pred             CCCCCHHHHHHhhcCChHHHHHHHHHHHHhhcCCCceEEEEEEEeecCCCCCCCCcCCCCCCCCCCCccccccCHHHHHH
Q psy8190          26 SLIWKLDEVINLFNLPFNDLLFRAQKVHRKYFDANEIELAVLLSIKTGGCTEDCGYCPQSTHYNTEITATKILSIESVIT  105 (348)
Q Consensus        26 ~~~ls~~e~~~Ll~~~~~~l~~~A~~~~~~~~~g~~v~~~~~i~i~t~~C~~~C~fC~~~~~~~~~~~~~~~~~~eei~~  105 (348)
                      +++||+||+++|++.|+.+|+..|+++++++|+++.+++...+++.||+|+++|.||+|++.++.....+..++++++++
T Consensus         1 ~~r~s~ee~~~L~~~~~~dL~~~A~~v~r~~~~~~~~~~~~~~~~~TngC~~~C~fC~~~~~~~~~~~~~~~~~~e~i~~   80 (312)
T d1r30a_           1 RPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLE   80 (312)
T ss_dssp             CCCCCSTTTHHHHHSCHHHHHHHHHHHHHHHSCTTCCEEEEEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHH
T ss_pred             CCCCCHHHHHHHHcCCHHHHHHHHHHHHHHHcCCCEEEEeeeeEeeCCCCCCcCCcCCCCccCCCCCccccccchHHHHH
Confidence            36899999999999999999999999999889667666666665559999999999999886544334445689999999


Q ss_pred             HHHHHHhCCCCEEEEeccCCCCCcccHHHHHHHHHHHHhcCcEEEEecCCCCHHHHHHHHHhCCCeeeccCCCCHHHHhc
Q psy8190         106 AAQKAKSDGATRFCMGAAWRELKDRDLDNIENMICEVKKIGLETCLTLGMLNENQAYRLKKVGLDYYNHNLDTSPKLYGD  185 (348)
Q Consensus       106 ~~~~~~~~G~~~i~l~gg~~~~~~~~~~~~~~l~~~i~~~~~~i~~~~g~l~~e~l~~Lk~aG~~~i~~g~et~~e~l~~  185 (348)
                      +++.+.+.|+.++++++|.........+++.++++.++...+.++++.+.++++.++.|++||++++.+++||+++.+..
T Consensus        81 ~~~~~~~~G~~~~~~~~g~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~e~l~~lk~aG~~~i~~~iEs~~~~~~~  160 (312)
T d1r30a_          81 SARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGN  160 (312)
T ss_dssp             HHHHHHHTTCSEEEEEECCSSCCTTTHHHHHHHHHHHHHTTSEEEEECSSCCHHHHHHHHHHCCCEEECCCBSCHHHHHH
T ss_pred             HHHHHHHcCCEEEEEccCCCCCchhhHHHHHHHHHhcccccceeeeccccchHHHHHHhhcccceeEecccchhhhhhcc
Confidence            99999999999999998854444567889999999999888999999999999999999999999999999998889999


Q ss_pred             cCCCCCHHHHHHHHHHHHHcCCeeeEeEeeecCCCHHHHHHHHHHHHhcCCCCCeeecccccccCCCCCCCCCCCCHHHH
Q psy8190         186 IISTRDYENRLNTLKNVRNVGINICCGGIIGLSESRDQRAELIFQLANLNPYPESVPINNLVQIKGTPLYGSSILDPLEF  265 (348)
Q Consensus       186 i~~~~~~~~~~~~i~~~~~~G~~i~~~~i~Glget~e~~~~~l~~l~~l~~~~~~i~~~~l~P~~gT~l~~~~~~~~~~~  265 (348)
                      +++++++++++++++.++++|+.+++++|+|+|||.+|+++++..+++++..++.++++++.|.|||||++.++++++++
T Consensus       161 ~~~~~~~~~~~~~~~~a~~~Gi~~~~~~i~G~~et~~d~~~~l~~l~~l~~~~~~i~~~~~~p~~gT~l~~~~~~~~~e~  240 (312)
T d1r30a_         161 IITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDF  240 (312)
T ss_dssp             HCCSSCHHHHHHHHHHHHHHHCEEECCEEECSSCCHHHHHHHHHHHHSSSSCCSEEEEEECCCCTTSTTSSCCCCCHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHhccceecceEecCcCcHHHHHHHHHHHHhcCCCCCeeeeccccCCCCcccccccCCCHHHH
Confidence            99999999999999999999999999999999999999999999999997557789999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCCceeccccccccchhhHHHHHHhCcceeeeCCeeccCCCCCchHHHHHHHHcCCCchh
Q psy8190         266 IRTIAVARITMPTSRIRMSAGRKEMGETTQAFCFLAGANSIFYGDKLLTTDNTKTNDDSKLLKKLGINTRN  336 (348)
Q Consensus       266 ~~~~a~~R~~lp~~~i~~s~g~~~l~~~~~~~~l~~GAn~~~~~~~~~~~~g~~~~~~~~~i~~~G~~p~~  336 (348)
                      ++++|++|+++|+..|+++++|++++++.++.+|.+|||++|.|+++++.+|++.+++.+||+++||+|.+
T Consensus       241 l~~iA~~Rl~lp~~~i~i~~~~~~~~~~~~~~~L~~Gan~~~~~~~~~t~~~~~~~~~~~~i~~~G~~P~~  311 (312)
T d1r30a_         241 IRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQ  311 (312)
T ss_dssp             HHHHHHHHHHCTTSEEEEESSGGGSCHHHHHHHHHHTCCEEECSSBSSSSBCCCHHHHHHHHHHTTCCSCC
T ss_pred             HHHHHHHHHhCCCcceEEEechhhcCHHHHHHHHhcCCcEEEecCccccCCCCCHHHHHHHHHHcCCCcCC
Confidence            99999999999999999998899999999999999999999999999899999999999999999999986



>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure