Psyllid ID: psy824


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLKRIRPHHALRRSVSQPLGINELSPLLRRKPIGTRPGDGTNSLCCSDDELLSDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRTD
cccccEEEEEEEcccccccccccccccccEEEEcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEEccccccccEEccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEEEccccccEEEEEEcccEEEEEEEcccccccEEEEEEEcccccEEEEccccccccc
cccHHEEEEEEcccEccccccEccEccccEEEEEEcccccEEEEEEccccccccHHHcccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEcccEccccccEccEccccEEEEEEcccccEEEEEEccEEEEEEHHHEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEEEHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHcccHccccccccccccHHHHHcHcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccEEEcccEEEEccEEEEEcccccccEEEEEEEccEEEEEEcccccccEEEEEcEEccccEEEEEccccccccc
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLdrdwwwgtrgEAFEHLSQIIINhsispncdiskslkrirphhalrrsvsqplginelspllrrkpigtrpgdgtnslccsddellsdsessvtslgmdEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLdrdwwwgtrgeasgwfpSAFVRLRVSQEDTVEDCLAALASggsktlrrrtsisllsndqVRSRVVRELINTERDFVKVLHDVsegylaecrrrndmfspeQIQTIFGNLEDILAFQSSFLEDLEtkldwdapykscigetflkhksgfhphlgvtVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAarchssrpptdhpdyVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLnidtsqiinlpdgkgrtd
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLKRIRPHHalrrsvsqplginelspllrrkpigtrpgdgtnslccSDDELLSDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAAlasggsktlrrrtsisllsndqvrsrVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAarchssrpptdhpdyvKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVykarlnidtsqiinlpdgkgrtd
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLKRIRPHHALRRSVSQPLGINELSPLLRRKPIGTRPGDGTNslccsddellsdsessVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRTD
****FVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLK**********************************************************LGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGG***L***TSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERAL**************************************VKITEALEAMRDVAML**********************************QLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIIN*********
***DFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEH************************************LGINEL***********************************************AEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWF*********************************************SRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAA****************EFAPAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRV**GMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQII***D******
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLKRIRPHHALRRSVSQPLGINELSPLLRRKPIGTRPGDGTNSLCCSDDELLSDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELA*************TDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRTD
*DEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINH**************************************************************************DEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVS****************************LSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPD******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEAFEHLSQIIINHSISPNCDISKSLKRIRPHHALRRSVSQPLGINELSPLLRRKPIGTRPGDGTNSLCCSDDELLSDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q9NR80 690 Rho guanine nucleotide ex yes N/A 0.722 0.542 0.393 6e-80
Q5DU57 656 Spermatogenesis-associate yes N/A 0.685 0.541 0.391 6e-78
Q96N96 652 Spermatogenesis-associate no N/A 0.685 0.544 0.384 3e-76
Q3UTH8 516 Rho guanine nucleotide ex no N/A 0.691 0.693 0.396 3e-74
Q58DL7 561 Rho guanine nucleotide ex no N/A 0.691 0.638 0.394 6e-74
O43307 516 Rho guanine nucleotide ex no N/A 0.691 0.693 0.394 6e-74
Q7TNR9 484 Rho guanine nucleotide ex no N/A 0.666 0.712 0.396 2e-73
Q5RDK0 564 Rho guanine nucleotide ex no N/A 0.691 0.634 0.396 2e-73
Q9QX73 493 Rho guanine nucleotide ex no N/A 0.691 0.726 0.389 2e-72
Q69ZK0 1650 Phosphatidylinositol 3,4, no N/A 0.532 0.167 0.280 4e-27
>sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 Back     alignment and function desciption
 Score =  298 bits (763), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 249/422 (59%), Gaps = 48/422 (11%)

Query: 107 PGDGTNSLCCSDDELLSDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEV 166
           PG G   L    +EL+SD              VV AEA+WDHV M+ +ELGF+AGDVIEV
Sbjct: 178 PGGGGEQLAI--NELISDGS------------VVCAEALWDHVTMDDQELGFKAGDVIEV 223

Query: 167 LDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLS 226
           +D  +R+WWWG   +  GWFP++FVRLRV+Q++  +D      + G++      + +  S
Sbjct: 224 MDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDDAPLAGNSGAED---GGAEAQSS 280

Query: 227 NDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQ 286
            DQ+R+ V+ E+++TERD++K L D+ EGY+ +CR+R DMFS EQ++TIFGN+EDI   Q
Sbjct: 281 KDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQ 340

Query: 287 SSFLEDLETKLDWDAPYKSCIGETFLKHKSGF---------HPHLGVTVRHAIKIHCSDK 337
            +F++ LE + + + P+ S +G  FL+H++ F         HP+  V +    K+    K
Sbjct: 341 KAFVKALEQRFNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKL---SK 397

Query: 338 DKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPAAK--ELARMSAARCHSSRP 395
             +    CR L+              +++    DG    P  K  +     A     + P
Sbjct: 398 YVYFFEACRLLQ-------------KMIDISL-DGFLLTPVQKICKYPLQLAELLKYTHP 443

Query: 396 PTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLI 455
              H D+  +  AL AM++VA LINERKRR+E+++K+A WQ  +E WEGEDL+  SS+LI
Sbjct: 444 --QHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELI 501

Query: 456 HQGEVIRVTSGMW-TNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGK 514
           + GE+ RVT     +     FLFDHQL+YCK+D+L+R+   YK RL++D  ++++L DGK
Sbjct: 502 YSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGK 561

Query: 515 GR 516
            R
Sbjct: 562 DR 563




Acts as guanine nucleotide exchange factor (GEF) for RHOA, RAC1 and CDC42 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion. Required for MMP9 up-regulation via the JNK signaling pathway in colorectal tumor cells. Involved in tumor angiogenesis and may play a role in intestinal adenoma formation and tumor progression.
Homo sapiens (taxid: 9606)
>sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=2 SV=2 Back     alignment and function description
>sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 Back     alignment and function description
>sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=2 SV=1 Back     alignment and function description
>sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 Back     alignment and function description
>sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 Back     alignment and function description
>sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 Back     alignment and function description
>sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 Back     alignment and function description
>sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
328781953 923 PREDICTED: hypothetical protein LOC40910 0.791 0.444 0.608 1e-151
350416600 1027 PREDICTED: spermatogenesis-associated pr 0.787 0.397 0.613 1e-150
380019842 1135 PREDICTED: uncharacterized protein LOC10 0.781 0.356 0.605 1e-150
340722378 1027 PREDICTED: spermatogenesis-associated pr 0.787 0.397 0.611 1e-150
322796610 795 hypothetical protein SINV_80505 [Solenop 0.791 0.515 0.608 1e-150
332019008 945 Spermatogenesis-associated protein 13 [A 0.791 0.433 0.608 1e-149
383849116 1021 PREDICTED: spermatogenesis-associated pr 0.781 0.396 0.603 1e-148
307179210 1146 Spermatogenesis-associated protein 13 [C 0.791 0.357 0.605 1e-148
307193179 750 Spermatogenesis-associated protein 13 [H 0.793 0.548 0.602 1e-146
270015460 956 hypothetical protein TcasGA2_TC004065 [T 0.812 0.440 0.598 1e-139
>gi|328781953|ref|XP_392633.4| PREDICTED: hypothetical protein LOC409108 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  541 bits (1394), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 288/473 (60%), Positives = 345/473 (72%), Gaps = 63/473 (13%)

Query: 81  LRRSVSQPLGINELSPLLRRKPIGTR-PG---------DGTNSLCCSDDELLSDSESSVT 130
           LRRS+SQPLGIN+LSPL+R K  G R PG         DG      SDDE++SDSESS+ 
Sbjct: 452 LRRSLSQPLGINQLSPLMRTKTAGARLPGGNVLSEDEQDGRGG--TSDDEMMSDSESSIA 509

Query: 131 SLG---------MDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGT-RG 180
           SL          MDE+ V+LAEAVWDHVAME EEL FRAGDVIEVLD LD+DWWWG+ RG
Sbjct: 510 SLTDRKKSFEQTMDEEVVILAEAVWDHVAMEPEELAFRAGDVIEVLDNLDKDWWWGSCRG 569

Query: 181 EASGWFPSAFVRLRVSQEDTVEDCLAALASGGS--KTLRRRTSISLLSNDQVRSRVVREL 238
           E  GWFP+AFVRLRVSQEDTVEDCLAA+ASGG+  + LRRRTS+SLLSN+QVR+ VVREL
Sbjct: 570 E-HGWFPAAFVRLRVSQEDTVEDCLAAMASGGTSNQQLRRRTSVSLLSNEQVRTSVVREL 628

Query: 239 INTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLD 298
           + TERDFVK+L DV+EGY+AECRRR DMF+ EQI+TIF NLE++L FQS FL+DLET++D
Sbjct: 629 VQTERDFVKILRDVAEGYIAECRRRTDMFTEEQIETIFINLEELLDFQSEFLKDLETRID 688

Query: 299 WDAPYKSCIGETFLKHKSGF---------HPHLGVTVRHAIKIHCSDKDKWLLFCCRSLE 349
           W APYKSC+GE FL H++GF         HP    T++   +++  ++       CR + 
Sbjct: 689 WSAPYKSCVGECFLNHRAGFRMYSEYCNSHPMATATLQ---ELYQHNRYSKFFEACRLM- 744

Query: 350 DKARWLAAFQQERALVEQDREDGLEFAPAAK------ELARMSAARCHSSRPPTDHPDYV 403
                       R L+E    DG    P  +      +LA +           +DHPDY 
Sbjct: 745 ------------RGLIEIPL-DGYLLTPVQRICKYPLQLAELLKY------TKSDHPDYH 785

Query: 404 KITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRV 463
           KI EALEAMRDVA+LINERKRRMESLEKLAAWQ RVEGWEGEDLIE SSQLI+QGE +RV
Sbjct: 786 KIQEALEAMRDVAVLINERKRRMESLEKLAAWQLRVEGWEGEDLIEVSSQLIYQGEAVRV 845

Query: 464 TSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGR 516
           T+GMWTN ITLFLFDHQLVYCK+DILKRNT+VYK R+ +DTS++I++PDGKG+
Sbjct: 846 TTGMWTNNITLFLFDHQLVYCKKDILKRNTYVYKGRIYLDTSEVIDVPDGKGK 898




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350416600|ref|XP_003491011.1| PREDICTED: spermatogenesis-associated protein 13-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380019842|ref|XP_003693810.1| PREDICTED: uncharacterized protein LOC100863896 [Apis florea] Back     alignment and taxonomy information
>gi|340722378|ref|XP_003399583.1| PREDICTED: spermatogenesis-associated protein 13-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322796610|gb|EFZ19084.1| hypothetical protein SINV_80505 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332019008|gb|EGI59547.1| Spermatogenesis-associated protein 13 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383849116|ref|XP_003700192.1| PREDICTED: spermatogenesis-associated protein 13-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307179210|gb|EFN67622.1| Spermatogenesis-associated protein 13 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307193179|gb|EFN76084.1| Spermatogenesis-associated protein 13 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270015460|gb|EFA11908.1| hypothetical protein TcasGA2_TC004065 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
UNIPROTKB|F1NVB0 504 ARHGEF4 "Uncharacterized prote 0.708 0.728 0.405 1.2e-89
UNIPROTKB|E1C9C1 523 ARHGEF9 "Uncharacterized prote 0.704 0.697 0.392 3.5e-84
MGI|MGI:2442507 484 Arhgef4 "Rho guanine nucleotid 0.681 0.729 0.402 5.1e-81
RGD|1586179 484 Arhgef4 "Rho guanine nucleotid 0.681 0.729 0.405 5.1e-81
ZFIN|ZDB-GENE-030131-7745 514 arhgef9b "Cdc42 guanine nucleo 0.694 0.700 0.389 3.6e-80
UNIPROTKB|F1MAZ5 688 ARHGEF4 "Uncharacterized prote 0.704 0.530 0.424 4.3e-77
UNIPROTKB|F1PPF4 591 ARHGEF4 "Uncharacterized prote 0.702 0.615 0.410 1.9e-76
UNIPROTKB|Q9NR80 690 ARHGEF4 "Rho guanine nucleotid 0.702 0.527 0.418 3.9e-76
UNIPROTKB|B1AMR3 495 ARHGEF9 "Rho guanine nucleotid 0.681 0.713 0.389 4.7e-74
UNIPROTKB|D4A9J0443 Arhgef9 "Rho guanine nucleotid 0.681 0.796 0.389 9.7e-74
UNIPROTKB|F1NVB0 ARHGEF4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 750 (269.1 bits), Expect = 1.2e-89, Sum P(2) = 1.2e-89
 Identities = 156/385 (40%), Positives = 242/385 (62%)

Query:   139 VVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQE 198
             VV AEA+WDHV M+ +ELGF+AGDVIEV+D  +++WWWG   ++ GWFP++FVRLRV+Q+
Sbjct:     2 VVYAEALWDHVTMDDQELGFKAGDVIEVMDATNKEWWWGRILDSEGWFPASFVRLRVNQD 61

Query:   199 DTVEDCLAALASG---GSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEG 255
             + +ED    +  G    S +  RR  +   + DQ+R+ V+ E+I+TERD++K L D+ EG
Sbjct:    62 EPMEDYPVKVEGGKDDDSSSGTRRFGMGQTTKDQMRTNVINEIISTERDYIKHLKDICEG 121

Query:   256 YLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHK 315
             Y+ +CR+R DMF+ EQ++TIFGN+EDI   Q  F++ LE K + D P+ S +G  FL+++
Sbjct:   122 YIKQCRKRADMFTEEQLKTIFGNIEDIYRCQKKFVKALEKKFNKDHPHLSEVGSCFLEYQ 181

Query:   316 SGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQ-DRE-DGL 373
             + F  +           +C++     +   R L    +++  F+  R L +  D   DG 
Sbjct:   182 TEFQIY---------SEYCNNHPNACMELSR-LTKVNKYVYFFEACRLLQKMIDISLDGF 231

Query:   374 EFAPAAKELAR-MSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKL 432
                P  K     +  A       P  H D+  +  AL AM++VA LINERKRR+E+++K+
Sbjct:   232 LLTPVQKICKYPLQLAELLKYTNP-QHRDFKDVEAALNAMKNVARLINERKRRLENIDKI 290

Query:   433 AAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLF-LFDHQLVYCKRDILKR 491
             A WQ  +E WEGED++  SS+LI+ GE+ +V+     +   +F LFDHQLV CK+D+L+R
Sbjct:   291 AQWQSSIEDWEGEDVLVRSSELIYSGELTKVSHPQAKSQQRMFFLFDHQLVCCKKDLLRR 350

Query:   492 NTHVYKARLNIDTSQIINLPDGKGR 516
             +   YK+R+N+D  +I+++ DGK +
Sbjct:   351 DILYYKSRINMDDMEILDIEDGKDK 375


GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0030032 "lamellipodium assembly" evidence=IEA
GO:0030676 "Rac guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0046847 "filopodium assembly" evidence=IEA
UNIPROTKB|E1C9C1 ARHGEF9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2442507 Arhgef4 "Rho guanine nucleotide exchange factor (GEF) 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1586179 Arhgef4 "Rho guanine nucleotide exchange factor (GEF) 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7745 arhgef9b "Cdc42 guanine nucleotide exchange factor (GEF) 9b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAZ5 ARHGEF4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPF4 ARHGEF4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR80 ARHGEF4 "Rho guanine nucleotide exchange factor 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1AMR3 ARHGEF9 "Rho guanine nucleotide exchange factor 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A9J0 Arhgef9 "Rho guanine nucleotide exchange factor 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
cd01224139 cd01224, PH_Collybistin_ASEF, Collybistin/APC-stim 1e-41
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 3e-26
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 4e-25
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 2e-23
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 8e-22
cd1197373 cd11973, SH3_ASEF, Src homology 3 domain of APC-St 2e-21
cd1197562 cd11975, SH3_ARHGEF9, Src homology 3 domain of the 2e-19
cd1197454 cd11974, SH3_ASEF2, Src homology 3 domain of APC-S 3e-18
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 2e-17
cd01224139 cd01224, PH_Collybistin_ASEF, Collybistin/APC-stim 3e-16
cd1197373 cd11973, SH3_ASEF, Src homology 3 domain of APC-St 1e-13
smart0032656 smart00326, SH3, Src homology 3 domains 1e-13
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 2e-13
cd1197454 cd11974, SH3_ASEF2, Src homology 3 domain of APC-S 1e-12
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 2e-12
cd1197562 cd11975, SH3_ARHGEF9, Src homology 3 domain of the 3e-12
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 1e-10
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 2e-10
smart0032656 smart00326, SH3, Src homology 3 domains 2e-09
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 2e-09
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 2e-09
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 3e-09
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 4e-09
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 4e-09
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 4e-09
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 5e-09
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 8e-09
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 2e-08
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 6e-08
pfam0001847 pfam00018, SH3_1, SH3 domain 7e-08
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 1e-07
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 1e-07
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 1e-07
cd1179451 cd11794, SH3_DNMBP_N1, First N-terminal Src homolo 1e-07
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 2e-07
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 3e-07
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 4e-07
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 4e-07
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 5e-07
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 6e-07
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 7e-07
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 8e-07
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 8e-07
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 9e-07
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 1e-06
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 1e-06
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 1e-06
cd1195457 cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt 1e-06
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 1e-06
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 1e-06
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 1e-06
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 2e-06
cd1182952 cd11829, SH3_GAS7, Src homology 3 domain of Growth 2e-06
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 2e-06
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 3e-06
cd1183554 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of 3e-06
cd13243147 cd13243, PH_PLEKHG1_G2_G3, Pleckstrin homology dom 3e-06
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 4e-06
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 5e-06
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 5e-06
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 5e-06
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 5e-06
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 7e-06
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 7e-06
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 8e-06
pfam0001847 pfam00018, SH3_1, SH3 domain 8e-06
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 9e-06
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 9e-06
cd1196254 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h 1e-05
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 1e-05
cd1188953 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of 1e-05
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 2e-05
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 2e-05
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 2e-05
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 2e-05
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 2e-05
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 2e-05
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 3e-05
cd1195752 cd11957, SH3_RUSC2, Src homology 3 domain of RUN a 3e-05
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 3e-05
cd1181050 cd11810, SH3_RUSC1_like, Src homology 3 domain of 3e-05
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 3e-05
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 3e-05
cd1179355 cd11793, SH3_ephexin1_like, Src homology 3 domain 4e-05
cd1204753 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do 4e-05
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 4e-05
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 4e-05
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 5e-05
cd1195457 cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt 6e-05
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 6e-05
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 6e-05
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 6e-05
cd1200168 cd12001, SH3_BCAR1, Src homology 3 domain of the C 6e-05
cd1200168 cd12001, SH3_BCAR1, Src homology 3 domain of the C 6e-05
cd1183958 cd11839, SH3_Intersectin_4, Fourth Src homology 3 6e-05
cd1201553 cd12015, SH3_Tks_1, First Src homology 3 domain of 7e-05
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 7e-05
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 8e-05
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 8e-05
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 8e-05
cd1202453 cd12024, SH3_NoxO1_2, Second or C-terminal Src hom 8e-05
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 9e-05
cd1202253 cd12022, SH3_p47phox_2, Second or C-terminal Src h 9e-05
cd1195256 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of 9e-05
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 9e-05
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 9e-05
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 1e-04
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 1e-04
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 1e-04
cd1198952 cd11989, SH3_Intersectin1_2, Second Src homology 3 1e-04
cd1195851 cd11958, SH3_RUSC1, Src homology 3 domain of RUN a 1e-04
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 1e-04
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 2e-04
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 2e-04
cd1183250 cd11832, SH3_Shank, Src homology 3 domain of SH3 a 2e-04
cd1184758 cd11847, SH3_Brk, Src homology 3 domain of Brk (Br 2e-04
cd1184758 cd11847, SH3_Brk, Src homology 3 domain of Brk (Br 2e-04
cd1187658 cd11876, SH3_MLK, Src Homology 3 domain of Mixed L 2e-04
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 2e-04
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 2e-04
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 2e-04
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 2e-04
cd1177452 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain 2e-04
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 3e-04
cd1184456 cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr 3e-04
cd1184456 cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr 3e-04
cd1177957 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain 3e-04
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 4e-04
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 4e-04
cd1181050 cd11810, SH3_RUSC1_like, Src homology 3 domain of 4e-04
cd1195256 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of 4e-04
cd1199052 cd11990, SH3_Intersectin2_2, Second Src homology 3 4e-04
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 4e-04
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 4e-04
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 4e-04
cd1201953 cd12019, SH3_Tks5_4, Fourth Src homology 3 domain 4e-04
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 5e-04
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 5e-04
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 6e-04
cd1200362 cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr 6e-04
cd1200362 cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr 6e-04
cd1177452 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain 7e-04
cd1191659 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H 7e-04
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 8e-04
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 8e-04
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 8e-04
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 9e-04
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 0.001
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 0.001
cd01261109 cd01261, PH_SOS, Son of Sevenless (SOS) Pleckstrin 0.001
cd1201753 cd12017, SH3_Tks_3, Third Src homology 3 domain of 0.001
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 0.001
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 0.001
cd1179554 cd11795, SH3_DNMBP_N2, Second N-terminal Src homol 0.001
cd1189558 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai 0.001
cd1179451 cd11794, SH3_DNMBP_N1, First N-terminal Src homolo 0.002
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 0.002
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 0.002
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 0.002
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 0.002
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 0.002
cd1195851 cd11958, SH3_RUSC1, Src homology 3 domain of RUN a 0.002
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 0.002
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 0.002
cd1186458 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of 0.002
cd1191459 cd11914, SH3_BAIAP2L2, Src Homology 3 domain of Br 0.002
cd1200257 cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( 0.002
cd1200257 cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( 0.002
cd1191761 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H 0.002
cd1175752 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 0.002
cd1199459 cd11994, SH3_Intersectin2_4, Fourth Src homology 3 0.002
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 0.002
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 0.002
cd1179750 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homol 0.002
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 0.003
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 0.003
cd1202453 cd12024, SH3_NoxO1_2, Second or C-terminal Src hom 0.003
cd01261109 cd01261, PH_SOS, Son of Sevenless (SOS) Pleckstrin 0.003
cd1199252 cd11992, SH3_Intersectin2_3, Third Src homology 3 0.003
cd1207453 cd12074, SH3_Tks5_1, First Src homology 3 domain o 0.003
cd1196656 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA 0.003
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 0.003
cd1193955 cd11939, SH3_ephexin1, Src homology 3 domain of th 0.003
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 0.004
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 0.004
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 0.004
>gnl|CDD|241258 cd01224, PH_Collybistin_ASEF, Collybistin/APC-stimulated guanine nucleotide exchange factor pleckstrin homology (PH) domain Back     alignment and domain information
 Score =  145 bits (368), Expect = 1e-41
 Identities = 50/91 (54%), Positives = 70/91 (76%)

Query: 426 MESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNTITLFLFDHQLVYCK 485
           +E+LEKLAAWQ  +EGWEGEDL++ SS+LIH GE+ +++S       T FLFDHQLVYCK
Sbjct: 1   LENLEKLAAWQSSIEGWEGEDLLDRSSELIHSGELSKISSKGKAQERTFFLFDHQLVYCK 60

Query: 486 RDILKRNTHVYKARLNIDTSQIINLPDGKGR 516
           +D+LKR+  +YK R+++D  +I +L DGK +
Sbjct: 61  KDLLKRDNLIYKGRIDLDNMEIEDLEDGKDK 91


Collybistin (also called PEM2) is homologous to the Dbl proteins ASEF (also called ARHGEF4/RhoGEF4) and SPATA13 (Spermatogenesis-associated protein 13; also called ASEF2). It activates CDC42 specifically and not any other Rho-family GTPases. Collybistin consists of an SH3 domain, followed by a RhoGEF/DH and PH domain. In Dbl proteins, the DH and PH domains catalyze the exchange of GDP for GTP in Rho GTPases, allowing them to signal to downstream effectors. It induces submembrane clustering of the receptor-associated peripheral membrane protein gephyrin, which is thought to form a scaffold underneath the postsynaptic membrane linking receptors to the cytoskeleton. It also acts as a tumor suppressor that links adenomatous polyposis coli (APC) protein, a negative regulator of the Wnt signaling pathway and promotes the phosphorylation and degradation of beta-catenin, to Cdc42. Autoinhibition of collybistin is accomplished by the binding of its SH3 domain with both the RhoGEF and PH domains to block access of Cdc42 to the GTPase-binding site. Inactivation promotes cancer progression. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 139

>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor Back     alignment and domain information
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 Back     alignment and domain information
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|241258 cd01224, PH_Collybistin_ASEF, Collybistin/APC-stimulated guanine nucleotide exchange factor pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212728 cd11794, SH3_DNMBP_N1, First N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho GTPase-activating proteins 32 and 33, and similar proteins Back     alignment and domain information
>gnl|CDD|241397 cd13243, PH_PLEKHG1_G2_G3, Pleckstrin homology domain-containing family G members 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 Back     alignment and domain information
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 Back     alignment and domain information
>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin Back     alignment and domain information
>gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 Back     alignment and domain information
>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or SH3B) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212766 cd11832, SH3_Shank, Src homology 3 domain of SH3 and multiple ankyrin repeat domains (Shank) proteins Back     alignment and domain information
>gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 Back     alignment and domain information
>gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 Back     alignment and domain information
>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins Back     alignment and domain information
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins Back     alignment and domain information
>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53, Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2 (BAIAP2)-Like proteins, and similar proteins Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) Back     alignment and domain information
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212952 cd12019, SH3_Tks5_4, Fourth Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate Back     alignment and domain information
>gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate Back     alignment and domain information
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|241292 cd01261, PH_SOS, Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212729 cd11795, SH3_DNMBP_N2, Second N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 Back     alignment and domain information
>gnl|CDD|212728 cd11794, SH3_DNMBP_N1, First N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 Back     alignment and domain information
>gnl|CDD|212847 cd11914, SH3_BAIAP2L2, Src Homology 3 domain of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 2 Back     alignment and domain information
>gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 Back     alignment and domain information
>gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 Back     alignment and domain information
>gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 Back     alignment and domain information
>gnl|CDD|212927 cd11994, SH3_Intersectin2_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 Back     alignment and domain information
>gnl|CDD|241292 cd01261, PH_SOS, Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains Back     alignment and domain information
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212872 cd11939, SH3_ephexin1, Src homology 3 domain of the Rho guanine nucleotide exchange factor, ephexin-1 (also called NGEF or ARHGEF27) Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
KOG2070|consensus 661 100.0
KOG4424|consensus 623 100.0
KOG3523|consensus 695 100.0
KOG2996|consensus 865 100.0
KOG4305|consensus 1029 100.0
KOG3520|consensus 1167 100.0
KOG3518|consensus 521 100.0
KOG3521|consensus 846 100.0
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.97
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.97
KOG3519|consensus 756 99.96
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 99.95
KOG3522|consensus 925 99.94
COG5422 1175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 99.94
KOG4226|consensus379 99.9
KOG4348|consensus627 99.9
KOG1029|consensus1118 99.89
KOG4225|consensus489 99.86
KOG0689|consensus 448 99.84
KOG3531|consensus 1036 99.83
KOG4240|consensus 1025 99.82
KOG4348|consensus 627 99.82
KOG1029|consensus1118 99.81
KOG3524|consensus 850 99.8
KOG4226|consensus379 99.77
KOG4792|consensus293 99.75
KOG3601|consensus222 99.67
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.52
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.52
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.37
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.35
KOG2996|consensus865 99.33
KOG3632|consensus1335 99.3
KOG2199|consensus462 99.3
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.28
KOG1118|consensus366 99.27
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 99.24
KOG2070|consensus 661 99.22
KOG2199|consensus462 99.2
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.19
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 99.18
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.13
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.12
KOG0162|consensus1106 99.1
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.08
KOG1118|consensus366 99.05
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.02
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.0
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.99
KOG4225|consensus489 98.97
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 98.88
KOG2856|consensus472 98.86
KOG0162|consensus1106 98.85
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 98.8
KOG4269|consensus 1112 98.8
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 98.77
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 98.76
KOG2856|consensus472 98.76
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 98.75
KOG4792|consensus293 98.7
KOG1264|consensus1267 98.67
KOG2546|consensus483 98.6
KOG2546|consensus483 98.54
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 98.53
KOG1264|consensus 1267 98.51
KOG0515|consensus752 98.45
KOG3655|consensus484 98.44
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 98.42
KOG1702|consensus264 98.39
KOG0515|consensus752 98.33
KOG3601|consensus222 98.28
KOG1843|consensus473 98.26
KOG1843|consensus473 98.14
KOG3655|consensus484 98.11
KOG1702|consensus264 98.06
KOG3875|consensus362 98.05
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 97.94
KOG0931|consensus 627 97.93
KOG3875|consensus362 97.92
KOG3523|consensus695 97.75
KOG2222|consensus848 97.67
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 97.63
KOG2222|consensus848 97.61
KOG3725|consensus375 97.56
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.55
KOG3771|consensus460 97.53
KOG4773|consensus386 97.52
KOG4278|consensus 1157 97.52
KOG3632|consensus1335 97.49
KOG1451|consensus812 97.38
KOG3771|consensus460 97.31
KOG4429|consensus421 97.3
KOG0197|consensus468 97.25
KOG4278|consensus 1157 97.2
KOG2528|consensus 490 97.19
KOG4429|consensus421 97.14
KOG0609|consensus542 97.12
KOG4773|consensus386 96.96
cd01229129 PH_etc2 Epithelial cell transforming 2 (ECT2) plec 96.89
PF15411116 PH_10: Pleckstrin homology domain 96.78
KOG4575|consensus 874 96.77
KOG3775|consensus482 96.73
KOG0609|consensus542 96.67
KOG3557|consensus721 96.64
KOG2528|consensus490 96.63
KOG0197|consensus468 96.54
KOG4575|consensus 874 96.48
KOG3565|consensus640 96.1
KOG3524|consensus 850 95.85
KOG1451|consensus812 95.72
KOG3725|consensus375 95.71
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 95.54
KOG3775|consensus482 95.41
KOG3557|consensus721 95.33
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 94.76
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 94.2
KOG0199|consensus 1039 93.9
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 93.48
KOG3522|consensus 925 91.18
smart0028763 SH3b Bacterial SH3 domain homologues. 91.18
KOG0199|consensus 1039 90.99
KOG3565|consensus640 90.55
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 89.28
KOG1729|consensus 288 89.15
KOG3705|consensus580 88.83
PRK10884206 SH3 domain-containing protein; Provisional 87.76
KOG3812|consensus475 87.65
KOG3812|consensus475 87.49
KOG0040|consensus 2399 86.77
smart0028763 SH3b Bacterial SH3 domain homologues. 86.43
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 85.3
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 83.8
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 82.19
smart0074361 Agenet Tudor-like domain present in plant sequence 81.74
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 81.71
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 81.67
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 80.82
>KOG2070|consensus Back     alignment and domain information
Probab=100.00  E-value=9.3e-47  Score=359.11  Aligned_cols=357  Identities=20%  Similarity=0.340  Sum_probs=298.2

Q ss_pred             ceeEEEEeecCCCCCCCCCCCCCCCEEEEEecCCCCeEEEEECCeeEEEcCCCEEEcccCCCchHHHHHhhhcCCCcccc
Q psy824          138 FVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLR  217 (518)
Q Consensus       138 ~~~~~~a~~~~~~~~~~eL~~~~g~~i~v~~~~~~~w~~~~~~g~~G~~P~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  217 (518)
                      .+..++|-|.|...+.|||+|.+||+|+|.+..+.|||+|..+|+.||||++||..++... ++...     .|...++.
T Consensus        16 ~pLvvrAkf~F~gsNnDELsf~KgDvItVTq~eeGGWWEGTlng~TGWFPsnYV~eik~e~-pLs~~-----~~~~~~~~   89 (661)
T KOG2070|consen   16 NPLVVRAKFNFQGSNNDELSFSKGDVITVTQVEEGGWWEGTLNGRTGWFPSNYVREIKSEK-PLSPK-----SGTLKSPP   89 (661)
T ss_pred             CceEEEEEeecccCCCceeccccCCEEEEEEeccCcceeccccCccCccchHHHHHHhhcC-CCCcc-----ccCCCCCc
Confidence            3568999999999999999999999999999999999999999999999999999998443 33221     11111222


Q ss_pred             ccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCHHHHHHHhcCHHHHHHHHHHHHHHHHHhh
Q psy824          218 RRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKL  297 (518)
Q Consensus       218 ~~~~~~~~~~~~kR~~ii~ELl~tE~~Yv~~L~~l~~~f~~~l~~~~~~l~~~~~~~lF~ni~~i~~~h~~~l~~L~~~~  297 (518)
                      +.. .+...+...|.-+++.+++||+.|++.|..+...|+.||+ .+.+++..++..|.+|+++|+.+|+.|+.+|+++.
T Consensus        90 k~~-~t~~~~~~Yr~vVLk~~lesEkey~~eLq~lL~t~L~Plq-~s~iLs~~ey~~LmgNfeeI~t~~qdL~~qlEec~  167 (661)
T KOG2070|consen   90 KGF-DTTAINKSYRNVVLKNILESEKEYSKELQTLLSTYLRPLQ-TSEILSSAEYSYLMGNFEEICTFQQDLVQQLEECT  167 (661)
T ss_pred             ccc-cccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh-hccccchHHHHHHhcchHHhHhHHHHHHHHHHHhh
Confidence            221 2234467889999999999999999999999999999998 68899999999999999999999999999999998


Q ss_pred             CCCCCCCCchHHHHHhhhcCcCCchhHHHHHHHHHhcchhhHHHHHHhhcchHHHHHHHHHHHhhccccccCccCCCcch
Q psy824          298 DWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDREDGLEFAP  377 (518)
Q Consensus       298 ~~~~~~~~~ig~~f~~~~~~~~~~~~~~~~~~y~~y~~~~~~a~~~~~~~~~~~~~fl~~~~~~~~~~~~~~l~~~L~~P  377 (518)
                      +... ..+++|.||+..++.++.        +|..||.||+.|+..+.++.+++.+|++..-.  ...+...|..=|.+|
T Consensus       168 ~~~~-~q~RVGg~fln~ap~mkt--------~~~aYcanHP~AV~VL~k~~dELek~me~Qga--sspg~lvLttgLSkP  236 (661)
T KOG2070|consen  168 KLPE-AQQRVGGCFLNLAPQMKT--------LYLAYCANHPSAVNVLTKHSDELEKFMETQGA--SSPGILVLTTGLSKP  236 (661)
T ss_pred             cCch-hhhhhhhHHHhhhHHHHH--------HHHHHHhcCchhhhHHHHhHHHHHHHHHhcCC--CCCCeEEEecccchH
Confidence            6443 367999999999996654        79999999999999999999999999886432  333443466778899


Q ss_pred             hhHHHHHHHhhhhccCCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHhHH-HHHHHHHHHHhcccCCCccccccccceEe
Q psy824          378 AAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRME-SLEKLAAWQQRVEGWEGEDLIETSSQLIH  456 (518)
Q Consensus       378 vQRl~~y~LlL~~l~k~t~~~~~d~~~l~~a~~~~~~~~~~vn~~~~~~e-~~~~l~~~~~~i~~~~~~~l~~~~r~ll~  456 (518)
                      .-|+=||+-||++|.++.+..|||+.+++++...++++...+.+..++.| .++.|.   ..|.+|.+.++... +.+|+
T Consensus       237 frrldkY~~lLQELERhme~~HpDrgD~qrs~avfk~~~~~Cq~lRkqKEleLqiLt---~~i~~w~g~d~s~l-G~iiy  312 (661)
T KOG2070|consen  237 FRRLDKYPTLLQELERHMEDYHPDRGDIQRSMAVFKNLSAQCQELRKQKELELQILT---EPIRNWEGDDISTL-GNIIY  312 (661)
T ss_pred             HHHHHHHHHHHHHHHHhccccCCchHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhc---ccccccccchhhhc-cceEe
Confidence            99999999999999999999999999999999999999999988544433 344443   68889999877775 78999


Q ss_pred             eeeEEEEecCcccceEEEEEeCCeEEEEeeccCCCCceEEEEEeecCCeeEEEcCCCCCCCC
Q psy824          457 QGEVIRVTSGMWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRTD  518 (518)
Q Consensus       457 ~g~l~~~~~~~~~~~~~~fLF~d~ll~~k~~~~~~~~~~~k~~i~l~~~~v~~~~d~~~~~~  518 (518)
                      .|.+.+...+...++||+.||.+.|++.... .....|+|.+.+|+..+.|+..+|.+++.+
T Consensus       313 mg~v~Vqy~~ad~~dRy~~LF~~~llflsvs-~rMs~fIyegKlp~tG~iV~klEdte~~~n  373 (661)
T KOG2070|consen  313 MGQVLVQYAGADEKDRYLLLFPNVLLFLSVS-PRMSGFIYEGKLPTTGMIVTKLEDTENHRN  373 (661)
T ss_pred             eeehhhhhcCcchhhheeeeccceeeeeEec-cccchhhhccccccceeEEeehhhhhcccc
Confidence            9999887777666799999999999999743 223568888999999999999999988753



>KOG4424|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4269|consensus Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0931|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>cd01229 PH_etc2 Epithelial cell transforming 2 (ECT2) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2pz1_A466 Crystal Structure Of Auto-Inhibited Asef Length = 4 1e-80
2dx1_A482 Crystal Structure Of Rhogef Protein Asef Length = 4 2e-77
2dfk_A402 Crystal Structure Of The Cdc42-Collybistin Ii Compl 1e-51
3nmz_D116 Crytal Structure Of Apc Complexed With Asef Length 6e-19
2ysq_A81 Solution Structure Of The Sh3 Domain From Rho Guani 2e-17
3jv3_A283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 3e-10
2vrw_B 406 Critical Structural Role For The Ph And C1 Domains 5e-08
3ky9_A 587 Autoinhibited Vav1 Length = 587 2e-07
3gf9_A295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 2e-07
3bji_A378 Structural Basis Of Promiscuous Guanine Nucleotide 1e-06
2dyb_A341 The Crystal Structure Of Human P40(Phox) Length = 3 2e-06
1oeb_A62 MonaGADS SH3C DOMAIN Length = 62 5e-06
1w6x_A60 Sh3 Domain Of P40phox, Component Of The Nadph Oxida 5e-06
1uti_A58 MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L 5e-06
1h3h_A60 Structural Basis For Specific Recognition Of An Rxx 6e-06
1z9q_A79 Solution Structure Of Sh3 Domain Of P40phox Length 6e-06
2d0n_A59 Crystal Structure Of The C-Terminal Sh3 Domain Of T 6e-06
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 1e-05
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 2e-05
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 3e-05
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 3e-05
2vwf_A58 Grb2 Sh3c (2) Length = 58 5e-05
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 6e-05
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 6e-05
1gri_A217 Grb2 Length = 217 6e-05
2vvk_A56 Grb2 Sh3c (1) Length = 56 7e-05
2d1x_A66 The Crystal Structure Of The Cortactin-Sh3 Domain A 1e-04
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 2e-04
2esw_A61 Atomic Structure Of The N-Terminal Sh3 Domain Of Mo 2e-04
2dl4_A68 Solution Structure Of The First Sh3 Domain Of Stac 2e-04
2df6_A59 Crystal Structure Of The Sh3 Domain Of Betapix In C 2e-04
2ak5_A64 Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length 2e-04
1foe_A377 Crystal Structure Of Rac1 In Complex With The Guani 2e-04
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 3e-04
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 3e-04
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 4e-04
1zsg_A65 Beta Pix-Sh3 Complexed With An Atypical Peptide Fro 4e-04
3p6a_A377 Crystal Structure Of The DhPH DOMAINS OF P115-Rhoge 6e-04
3odo_A375 Crystal Structure Of The DhPH DOMAINS OF P115-Rhoge 6e-04
1f5x_A208 Nmr Structure Of The Y174 Autoinhibited Dbl Homolog 6e-04
1x69_A79 Solution Structures Of The Sh3 Domain Of Human Src 6e-04
2d8j_A77 Solution Structure Of The Sh3 Domain Of Fyn-Related 7e-04
3odw_A536 Crystal Structure Of The Linker-DhPH DOMAINS OF P11 7e-04
1x2p_A68 Solution Structure Of The Sh3 Domain Of The Protein 7e-04
3odx_A417 Crystal Structure Of An N-Terminally Truncated Link 7e-04
2kbt_A142 Attachment Of An Nmr-Invisible Solubility Enhanceme 9e-04
>pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 Back     alignment and structure

Iteration: 1

Score = 297 bits (760), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 159/390 (40%), Positives = 239/390 (61%), Gaps = 34/390 (8%) Query: 139 VVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQE 198 VV AEA+WDHV M+ +ELGF+AGDVIEV+D +R+WWWG + GWFP++FVRLRV+Q+ Sbjct: 30 VVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQD 89 Query: 199 DTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLA 258 + +D + G++ + + S DQ+R+ V+ E+++TERD++K L D+ EGY+ Sbjct: 90 EPADDDAPLAGNSGAED---GGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYVR 146 Query: 259 ECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGF 318 +CR+R DMFS EQ++TIFGN+EDI Q +F++ LE + + + P+ S +G FL+H++ F Sbjct: 147 QCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSELGACFLEHQADF 206 Query: 319 ---------HPHLGVTVRHAIKIHCSDKDKWLLFCCRSLEDKARWLAAFQQERALVEQDR 369 HP+ V + K+ K + CR L+ + +L Sbjct: 207 QIYSEYCNNHPNACVELSRLTKL---SKYVYFFEACRLLQKMI--------DISL----- 250 Query: 370 EDGLEFAPAAK--ELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRME 427 DG P K + A + P H D+ + AL AM++VA LINERKRR+E Sbjct: 251 -DGFLLTPVQKICKYPLQLAELLKYTHP--QHRDFKDVEAALHAMKNVAQLINERKRRLE 307 Query: 428 SLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMW-TNTITLFLFDHQLVYCKR 486 +++K+A WQ +E WEGEDL+ SS+LI+ GE+ RVT + FLFDHQL+YCK+ Sbjct: 308 NIDKIAQWQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKK 367 Query: 487 DILKRNTHVYKARLNIDTSQIINLPDGKGR 516 D+L+R+ YK RL++D ++++L DGK R Sbjct: 368 DLLRRDVLYYKGRLDMDGLEVVDLEDGKDR 397
>pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 Back     alignment and structure
>pdb|2DFK|A Chain A, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 402 Back     alignment and structure
>pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 Back     alignment and structure
>pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|2VRW|B Chain B, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 406 Back     alignment and structure
>pdb|3KY9|A Chain A, Autoinhibited Vav1 Length = 587 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|3BJI|A Chain A, Structural Basis Of Promiscuous Guanine Nucleotide Exchange By The T-Cell Essential Vav1 Length = 378 Back     alignment and structure
>pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 Back     alignment and structure
>pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 Back     alignment and structure
>pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 Back     alignment and structure
>pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 Back     alignment and structure
>pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 Back     alignment and structure
>pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 Back     alignment and structure
>pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 Back     alignment and structure
>pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 Back     alignment and structure
>pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 Back     alignment and structure
>pdb|1FOE|A Chain A, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 377 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 Back     alignment and structure
>pdb|3P6A|A Chain A, Crystal Structure Of The DhPH DOMAINS OF P115-Rhogef (R399e Mutant) Length = 377 Back     alignment and structure
>pdb|3ODO|A Chain A, Crystal Structure Of The DhPH DOMAINS OF P115-Rhogef Length = 375 Back     alignment and structure
>pdb|1F5X|A Chain A, Nmr Structure Of The Y174 Autoinhibited Dbl Homology Domain Length = 208 Back     alignment and structure
>pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 Back     alignment and structure
>pdb|2D8J|A Chain A, Solution Structure Of The Sh3 Domain Of Fyn-Related Kinase Length = 77 Back     alignment and structure
>pdb|3ODW|A Chain A, Crystal Structure Of The Linker-DhPH DOMAINS OF P115-Rhogef Length = 536 Back     alignment and structure
>pdb|1X2P|A Chain A, Solution Structure Of The Sh3 Domain Of The Protein Arginine N-Methyltransferase 2 Length = 68 Back     alignment and structure
>pdb|3ODX|A Chain A, Crystal Structure Of An N-Terminally Truncated Linker-DhPH DOMAINS OF P115-Rhogef Length = 417 Back     alignment and structure
>pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 1e-94
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 4e-11
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 2e-09
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 2e-74
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 8e-10
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 6e-58
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 2e-54
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 3e-52
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 3e-10
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 4e-52
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 6e-50
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 8e-04
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 3e-48
1foe_A377 T-lymphoma invasion and metastasis inducing protei 1e-47
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 7e-42
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 9e-41
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 2e-40
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-39
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 1e-38
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 3e-38
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 8e-38
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 1e-37
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 1e-35
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 6e-35
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 7e-27
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 6e-21
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 1e-23
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 1e-13
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 1e-18
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 2e-09
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 2e-18
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 7e-11
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 4e-17
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 6e-08
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-04
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 3e-16
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 5e-10
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 3e-16
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 6e-10
1uti_A58 GRB2-related adaptor protein 2; signaling protein 3e-16
1uti_A58 GRB2-related adaptor protein 2; signaling protein 3e-11
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 4e-16
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 1e-10
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 7e-16
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 8e-09
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 1e-15
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 3e-10
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 1e-15
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 1e-10
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 3e-15
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 6e-08
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 3e-15
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 1e-09
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 3e-15
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-10
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 4e-15
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 1e-09
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 4e-15
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 4e-09
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 5e-15
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 4e-09
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 5e-15
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 7e-10
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 6e-15
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 6e-09
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 7e-15
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 5e-08
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 7e-15
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 1e-08
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 7e-15
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 8e-09
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 8e-15
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 7e-10
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 9e-15
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 3e-11
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 1e-14
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 8e-09
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-14
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-08
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 1e-14
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 3e-09
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 1e-14
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 3e-07
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 1e-14
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 5e-08
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-14
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 2e-09
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-14
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-09
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 2e-14
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 3e-08
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 2e-14
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 3e-08
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-14
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 3e-09
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 3e-14
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 9e-10
3u23_A65 CD2-associated protein; structural genomics, struc 3e-14
3u23_A65 CD2-associated protein; structural genomics, struc 2e-08
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 3e-14
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 4e-08
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 4e-14
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 2e-08
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-14
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-08
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 5e-14
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 3e-08
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 6e-14
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 6e-09
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 6e-14
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 3e-08
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 6e-14
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 1e-08
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 7e-14
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 3e-09
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 8e-14
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 6e-08
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 8e-14
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 1e-08
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 9e-14
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 2e-08
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 9e-14
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 4e-09
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 9e-14
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-13
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-07
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 1e-13
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 9e-07
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 1e-13
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 3e-08
2dil_A69 Proline-serine-threonine phosphatase-interacting p 1e-13
2dil_A69 Proline-serine-threonine phosphatase-interacting p 5e-08
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-13
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-08
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 1e-13
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 4e-08
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 1e-13
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 2e-07
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 1e-13
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 2e-08
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 1e-13
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 2e-07
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 1e-13
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 2e-07
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 1e-13
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 9e-08
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 1e-13
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 5e-08
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 1e-13
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 4e-08
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 1e-13
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 3e-08
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-13
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-09
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 2e-13
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 7e-08
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 2e-13
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 9e-09
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 2e-13
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 2e-08
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 2e-13
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 1e-07
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 2e-13
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 3e-10
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 2e-13
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 7e-08
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 2e-13
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 4e-08
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 2e-13
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 5e-09
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 2e-13
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 4e-08
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-13
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-07
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 3e-13
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 6e-09
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 4e-13
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 3e-07
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 4e-13
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 8e-08
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 5e-13
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 1e-08
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 6e-13
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 1e-07
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 7e-13
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 2e-08
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 7e-13
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 1e-08
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 7e-13
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 2e-08
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 9e-13
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-08
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 9e-13
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 5e-08
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 9e-13
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 3e-09
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 9e-13
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 9e-13
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 3e-06
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 1e-12
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 8e-08
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 1e-12
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 5e-07
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 1e-12
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 5e-08
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-12
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-06
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 1e-12
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 9e-09
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 2e-12
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 8e-07
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 2e-12
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 2e-08
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-12
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 1e-07
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-12
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-08
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 2e-12
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 3e-08
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 2e-12
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 1e-07
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 2e-12
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 5e-08
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-12
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 3e-09
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 2e-12
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 6e-08
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 2e-12
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 2e-08
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 3e-12
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 8e-09
2j6f_A62 CD2-associated protein; metal-binding, immune resp 3e-12
2j6f_A62 CD2-associated protein; metal-binding, immune resp 1e-07
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 3e-12
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 5e-09
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 4e-12
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 1e-06
2da9_A70 SH3-domain kinase binding protein 1; structural ge 4e-12
2da9_A70 SH3-domain kinase binding protein 1; structural ge 1e-06
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 4e-12
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-08
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 4e-12
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 6e-07
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 5e-12
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 3e-08
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 5e-12
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 1e-08
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 6e-12
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 1e-08
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 6e-12
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 2e-08
1awj_A77 ITK; transferase, regulatory intramolecular comple 6e-12
1awj_A77 ITK; transferase, regulatory intramolecular comple 3e-08
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 6e-12
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 7e-08
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 6e-12
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 1e-06
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 6e-12
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 3e-07
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 8e-12
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 1e-06
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 8e-12
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 3e-06
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 1e-11
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 7e-08
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 1e-11
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 6e-06
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 1e-11
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 6e-06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 1e-11
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-08
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 1e-11
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 3e-06
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-11
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-06
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 2e-11
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 1e-06
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 2e-11
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 3e-07
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 2e-11
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 8e-07
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 2e-11
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-07
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 2e-11
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 1e-05
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 2e-11
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 7e-06
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-11
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 4e-06
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 3e-11
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 2e-07
1wxb_A68 Epidermal growth factor receptor pathway substrate 3e-11
1wxb_A68 Epidermal growth factor receptor pathway substrate 2e-07
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 3e-11
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 2e-08
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 4e-11
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 3e-07
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 4e-11
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 6e-06
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 5e-11
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 1e-07
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 5e-11
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-06
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 6e-11
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 4e-07
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 6e-11
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 8e-08
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 6e-11
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-05
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 7e-11
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 4e-08
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 7e-11
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 1e-06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 8e-11
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 4e-07
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 1e-10
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 7e-07
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-10
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-06
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 1e-10
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 4e-07
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 1e-10
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 1e-05
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 1e-10
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 8e-08
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 1e-10
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 2e-05
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-10
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-07
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 3e-10
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 2e-05
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 3e-10
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 6e-05
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 4e-10
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 6e-06
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 5e-10
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 2e-06
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 5e-10
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 2e-05
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 5e-10
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 3e-05
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 7e-10
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 1e-09
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 1e-05
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-09
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 2e-06
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 2e-09
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-05
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 2e-09
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 9e-04
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 3e-09
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 2e-06
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 4e-09
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-06
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 5e-09
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 2e-06
1i07_A60 Epidermal growth factor receptor kinase substrate 6e-09
1i07_A60 Epidermal growth factor receptor kinase substrate 2e-05
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 8e-09
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 9e-09
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 3e-05
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 1e-08
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 3e-04
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 1e-08
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 1e-04
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 1e-08
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 1e-04
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 2e-08
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 9e-05
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 2e-08
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 1e-04
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 2e-08
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 2e-08
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 3e-08
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 1e-04
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 4e-08
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 6e-08
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 3e-04
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 7e-08
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 8e-05
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-07
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 7e-05
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 9e-07
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-06
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-05
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 6e-06
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 1e-05
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 1e-05
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 7e-05
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-05
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 2e-05
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-04
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
 Score =  294 bits (754), Expect = 1e-94
 Identities = 153/407 (37%), Positives = 240/407 (58%), Gaps = 34/407 (8%)

Query: 123 SDSESSVTSLGMDEDFVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEA 182
              E    +  + +  VV AEA+WDHV M+ +ELGF+AGDVIEV+D  +R+WWWG   + 
Sbjct: 14  GGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADG 73

Query: 183 SGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLRRRTSISLLSNDQVRSRVVRELINTE 242
            GWFP++FVRLRV+Q++  +D      + G++        +  S DQ+R+ V+ E+++TE
Sbjct: 74  EGWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAE---AQSSKDQMRTNVINEILSTE 130

Query: 243 RDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLDWDAP 302
           RD++K L D+ EGY+ +CR+R DMFS EQ++TIFGN+EDI   Q +F++ LE + + + P
Sbjct: 131 RDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERP 190

Query: 303 YKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDK--WLLFCCRSLEDKARWLAAFQQ 360
           + S +G  FL+H++ F  +           +C++       L     L     +  A + 
Sbjct: 191 HLSELGACFLEHQADFQIY---------SEYCNNHPNACVELSRLTKLSKYVYFFEACRL 241

Query: 361 ERALVEQDREDGLEFAPA---------AKELARMSAARCHSSRPPTDHPDYVKITEALEA 411
            + +++   +  L   P            EL +      ++      H D+  +  AL A
Sbjct: 242 LQKMIDISLDGFL-LTPVQKICKYPLQLAELLK------YT---HPQHRDFKDVEAALHA 291

Query: 412 MRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLIHQGEVIRVTSGMWTNT 471
           M++VA LINERKRR+E+++K+A WQ  +E WEGEDL+  SS+LI+ GE+ RVT     + 
Sbjct: 292 MKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQ 351

Query: 472 -ITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKGRT 517
               FLFDHQL+YCK+D+L+R+   YK RL++D  ++++L DGK R 
Sbjct: 352 QRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGKDRD 398


>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Length = 185 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 100.0
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 100.0
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 100.0
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 100.0
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 100.0
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 100.0
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 100.0
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 100.0
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 100.0
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 100.0
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 100.0
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 100.0
1foe_A377 T-lymphoma invasion and metastasis inducing protei 100.0
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 100.0
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 100.0
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 100.0
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 100.0
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 100.0
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 100.0
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 100.0
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.92
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.91
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.91
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.88
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.81
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.76
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.65
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.65
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.63
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.62
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 99.6
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.58
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.58
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.55
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.55
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.55
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.55
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.54
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.54
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.54
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.54
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.54
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.54
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.54
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.54
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.54
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.54
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.54
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.53
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.53
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.53
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.53
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.53
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.53
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.53
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.52
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.52
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.52
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.52
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.52
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.52
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.52
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.52
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.52
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.52
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.52
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.52
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.52
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.52
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.52
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.52
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.51
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.51
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.51
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.51
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.51
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.51
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.51
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.51
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.51
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.51
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.51
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.51
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.51
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.51
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.51
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.51
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.51
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.51
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.51
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.51
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.51
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.51
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.5
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.5
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.5
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.5
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.5
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.5
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.5
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.5
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.5
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.5
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.5
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.5
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.5
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.5
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.5
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.5
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.5
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.5
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.49
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.49
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.49
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.49
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.49
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.49
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.49
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.49
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.49
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.49
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.49
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.49
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.49
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.49
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.49
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.49
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.49
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.49
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.49
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.49
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.49
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.48
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.48
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.48
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.48
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.48
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.48
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.48
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.48
3u23_A65 CD2-associated protein; structural genomics, struc 99.48
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.48
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.48
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.48
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.48
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.48
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.48
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.48
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.47
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.47
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.47
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.47
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.47
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.47
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.47
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.47
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.47
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.47
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.47
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.47
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.47
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.47
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.47
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.47
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.47
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.47
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.47
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.46
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.46
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.46
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.46
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.46
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.46
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.46
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.46
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.46
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.46
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.46
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.46
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.46
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.46
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.46
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.46
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.46
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.46
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.46
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.45
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.45
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.45
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.45
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.45
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.45
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.45
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.45
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.45
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.45
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.45
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.45
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.45
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.45
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.45
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.45
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.45
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.45
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.45
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.45
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.45
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.45
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.45
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.45
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.45
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.45
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.45
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.45
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.45
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.45
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.45
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.44
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.44
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.44
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.44
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.44
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.44
1i07_A60 Epidermal growth factor receptor kinase substrate 99.44
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.44
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.44
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.44
3u23_A65 CD2-associated protein; structural genomics, struc 99.44
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.44
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.44
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.44
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.44
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.44
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.44
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.44
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.44
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.44
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.44
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.44
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.43
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.43
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.43
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.43
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.43
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.43
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.43
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.43
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.43
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.43
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.43
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.43
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.43
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.43
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.43
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.43
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.43
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.42
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.42
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.42
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.42
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.42
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.42
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.42
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.42
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.42
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.42
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.42
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.42
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.42
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.42
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.42
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.42
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.41
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.41
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.41
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.41
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.41
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.41
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.41
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.41
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.41
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.41
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.41
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.41
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.41
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.41
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.41
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.41
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.41
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.41
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.4
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.4
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.4
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.4
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.4
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.4
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.4
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.4
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.4
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.4
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.4
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.4
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.39
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.39
1i07_A60 Epidermal growth factor receptor kinase substrate 99.39
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.39
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.39
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.39
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.39
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.39
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.38
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.38
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.38
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.38
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.38
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.38
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.38
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.38
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.38
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.38
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.37
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.37
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.37
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.37
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.37
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.36
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.36
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.36
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.35
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.34
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.34
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.33
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.33
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.33
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.33
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.32
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.32
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.31
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.31
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.31
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.31
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.31
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.3
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.3
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.3
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.3
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.29
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.29
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.29
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.29
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.29
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.28
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.28
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.27
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.27
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.27
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.27
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.26
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.26
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.25
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.24
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.23
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.22
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.22
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.21
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.21
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.19
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.16
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.16
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.16
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.15
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.15
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.13
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.12
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.12
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.11
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.1
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 99.1
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.09
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.68
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.05
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.04
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.04
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.02
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 99.01
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.0
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.99
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.96
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.91
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.88
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.87
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.87
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.86
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.84
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.83
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.8
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.8
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.79
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.79
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.75
1kjw_A295 Postsynaptic density protein 95; protein-protein i 98.74
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.73
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.73
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.69
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.67
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.67
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.64
1kjw_A295 Postsynaptic density protein 95; protein-protein i 98.6
4dey_A337 Voltage-dependent L-type calcium channel subunit; 98.59
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.57
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 98.52
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.51
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.51
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.44
4dey_A337 Voltage-dependent L-type calcium channel subunit; 98.43
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.4
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.17
3kfv_A308 Tight junction protein ZO-3; structural genomics c 98.16
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.13
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.06
2xkx_A721 Disks large homolog 4; structural protein, scaffol 98.05
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.0
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.98
3kfv_A308 Tight junction protein ZO-3; structural genomics c 97.97
4gou_A518 EHRGS-rhogef; RGS domain, DH domain, PH domain, RH 97.97
2xkx_A721 Disks large homolog 4; structural protein, scaffol 97.96
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.91
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.86
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 97.82
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.75
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.51
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.09
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 95.58
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 94.03
2kt8_A76 Probable surface protein; SH3 family, structural g 93.97
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 92.8
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 91.25
2kt8_A76 Probable surface protein; SH3 family, structural g 87.58
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 87.26
3npf_A306 Putative dipeptidyl-peptidase VI; structural genom 87.12
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 87.05
2d9y_A117 Pleckstrin homology domain-containing protein fami 86.85
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 86.83
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 86.67
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 86.4
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 86.34
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 85.5
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 84.87
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 84.86
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 84.85
2yry_A122 Pleckstrin homology domain-containing family A mem 84.28
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 83.48
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 82.2
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 81.79
2dkp_A128 Pleckstrin homology domain-containing family A mem 81.38
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 81.01
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
Probab=100.00  E-value=1e-64  Score=526.13  Aligned_cols=365  Identities=41%  Similarity=0.759  Sum_probs=312.8

Q ss_pred             ceeEEEEeecCCCCCCCCCCCCCCCEEEEEecCCCCeEEEEECCeeEEEcCCCEEEcccCCCchHHHHHhhhcCCCcccc
Q psy824          138 FVVLAEAVWDHVAMEAEELGFRAGDVIEVLDTLDRDWWWGTRGEASGWFPSAFVRLRVSQEDTVEDCLAALASGGSKTLR  217 (518)
Q Consensus       138 ~~~~~~a~~~~~~~~~~eL~~~~g~~i~v~~~~~~~w~~~~~~g~~G~~P~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  217 (518)
                      ....++|+|||.+..++||+|++||+|.|++..++|||.|+.+|+.||||++||+.+.+..++.+.+...........  
T Consensus        29 ~~~~~~al~~~~~~~~~eL~~~~gd~i~v~~~~~~~Ww~g~~~g~~G~~P~~yv~~~~~~~~~~~~~~~~~~~~~~~~--  106 (466)
T 2pz1_A           29 SVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDDAPLAGNSGAED--  106 (466)
T ss_dssp             CCEEEEESSCBCCCCTTBCCBCTTCEEEEEECCSSSEEEEEETTEEEEEEGGGEEECSCC--------------------
T ss_pred             CccEEEEccccCCCCCCcCCCCCCCEEEEEEecCCCEEEEEECCcEEEEehhHeeeccCccccCCCCCCCCCcccccc--
Confidence            357899999999999999999999999999999999999999999999999999998876655444322111111000  


Q ss_pred             ccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCHHHHHHHhcCHHHHHHHHHHHHHHHHHhh
Q psy824          218 RRTSISLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKL  297 (518)
Q Consensus       218 ~~~~~~~~~~~~kR~~ii~ELl~tE~~Yv~~L~~l~~~f~~~l~~~~~~l~~~~~~~lF~ni~~i~~~h~~~l~~L~~~~  297 (518)
                       ....++.+++.+|+++|+||++||++||++|+.+.+.|+.|+....++++..++..||+||++|+.+|+.||..|+.+.
T Consensus       107 -~~~~~~~~~~~kR~~vi~ELl~TE~~Yv~~L~~l~~~y~~~l~~~~~~l~~~~~~~iF~ni~~I~~~h~~fL~~Le~~~  185 (466)
T 2pz1_A          107 -GGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRF  185 (466)
T ss_dssp             ------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHCTTTCCHHHHHHHHTTHHHHHHHHHHHHHHHHHHC
T ss_pred             -CCCCccChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcCCCCHHHHHHHHcCHHHHHHHHHHHHHHHHHHH
Confidence             1123356789999999999999999999999999999999997566889999999999999999999999999999998


Q ss_pred             CCCCCCCCchHHHHHhhhcCcCCchhHHHHHHHHHhcchhhHHHHHH--hhcchHHHHHHHHHHHhhccccccCccCCCc
Q psy824          298 DWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLLFC--CRSLEDKARWLAAFQQERALVEQDREDGLEF  375 (518)
Q Consensus       298 ~~~~~~~~~ig~~f~~~~~~~~~~~~~~~~~~y~~y~~~~~~a~~~~--~~~~~~~~~fl~~~~~~~~~~~~~~l~~~L~  375 (518)
                      ..+.+....||++|+++.+.|+.         |..||.||+.+...+  +.+++.|..|++.|+..+.+.+.. |.+||+
T Consensus       186 ~~~~~~~~~ig~~fl~~~~~f~~---------Y~~Y~~n~~~a~~~l~~~~~~~~f~~f~~~~~~~~~~~~l~-L~~~Li  255 (466)
T 2pz1_A          186 NRERPHLSELGACFLEHQADFQI---------YSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDIS-LDGFLL  255 (466)
T ss_dssp             CSSCGGGCCCHHHHHHTHHHHTT---------HHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHTCCSCC-HHHHHH
T ss_pred             ccCCCccchHHHHHHHhhHHHHH---------HHHHHHhhHHHHHHHHHHHhccHHHHHHHHHHHhhhhccCC-HHHHhh
Confidence            64455567899999999999977         999999999986533  234567899999998877666655 999999


Q ss_pred             chhhHHHHHHHhhhhccCCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhcccCCCccccccccceE
Q psy824          376 APAAKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQRVEGWEGEDLIETSSQLI  455 (518)
Q Consensus       376 ~PvQRl~~y~LlL~~l~k~t~~~~~d~~~l~~a~~~~~~~~~~vn~~~~~~e~~~~l~~~~~~i~~~~~~~l~~~~r~ll  455 (518)
                      +|||||+||+|||++|+|+|+.+|+||..|+.|++.++.++..+|+.+++.|+.+++.+++.+|.||++.+|..++|+||
T Consensus       256 ~PvQRi~rY~LLL~~llk~t~~~~~d~~~l~~Al~~i~~v~~~iNe~~r~~e~~~~l~~lq~~i~~~~~~~l~~~~r~li  335 (466)
T 2pz1_A          256 TPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELI  335 (466)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSCTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSBTCCSSCHHHHCSCEE
T ss_pred             hHHHHhhhHHHHHHHHHhcCCCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCcccccccceeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999888999999999


Q ss_pred             eeeeEEEEecC-cccceEEEEEeCCeEEEEeeccCCCCceEEEEEeecCCeeEEEcCCCCC
Q psy824          456 HQGEVIRVTSG-MWTNTITLFLFDHQLVYCKRDILKRNTHVYKARLNIDTSQIINLPDGKG  515 (518)
Q Consensus       456 ~~g~l~~~~~~-~~~~~~~~fLF~d~ll~~k~~~~~~~~~~~k~~i~l~~~~v~~~~d~~~  515 (518)
                      ++|.+.++... .+.+++++|||||+||+||++..++..|.|+++|+|.++.|.+++|+++
T Consensus       336 ~~G~l~~~~~~~~~~~~r~~fLF~d~Ll~~k~~~~~~~~~~~k~~i~l~~~~v~~~~d~~~  396 (466)
T 2pz1_A          336 YSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGKD  396 (466)
T ss_dssp             EEEEEEEECTTTCCEEEEEEEEETTEEEEEEECSSCTTCEEEEEEEETTTCEEEECCSBSC
T ss_pred             EeeeEEEEecCCCCeeEEEEEEECCEEEEEEeccccCCceEEeeeeeccceEEEeCCCCcc
Confidence            99999988652 3357899999999999999876667889999999999999999999864



>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 2e-31
d1txda1234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 2e-28
d1ki1b1210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 2e-27
d1xcga1228 a.87.1.1 (A:714-941) Rho guanine nucleotide exchan 3e-27
d1by1a_209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 9e-27
d1foea1206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 2e-26
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 9e-26
d1dbha1207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 3e-25
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 4e-18
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 2e-17
d2dfka2162 b.55.1.1 (A:240-401) Rho guanine nucleotide exchan 8e-17
d2dfka2162 b.55.1.1 (A:240-401) Rho guanine nucleotide exchan 2e-12
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-15
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-08
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 9e-15
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 7e-09
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-14
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 8e-09
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-14
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-08
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 2e-14
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 8e-09
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-14
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-08
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-14
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-08
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 4e-14
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 4e-07
d1dbha2133 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H 4e-14
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 5e-14
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 3e-08
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 8e-14
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-07
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 2e-13
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 1e-07
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 2e-13
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 3e-07
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-13
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-07
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 3e-13
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 1e-06
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 4e-13
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 2e-08
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 6e-13
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-06
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 8e-13
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 4e-08
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 8e-13
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 1e-08
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 1e-12
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 3e-08
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 3e-12
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 5e-08
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-12
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 4e-08
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 3e-12
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 5e-07
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 6e-12
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 1e-06
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 7e-12
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 3e-07
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 8e-12
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 1e-07
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 8e-12
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-07
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 1e-11
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 4e-07
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-11
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 9e-07
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 2e-11
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 8e-07
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 3e-11
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 5e-06
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 4e-11
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 2e-05
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-11
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 9e-05
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 4e-11
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 7e-07
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 8e-11
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 5e-06
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 2e-10
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 1e-04
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 4e-10
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 1e-05
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 4e-10
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 8e-06
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 4e-10
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 4e-05
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 5e-10
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 1e-06
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 2e-09
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 7e-06
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 2e-09
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 1e-04
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 4e-09
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 2e-04
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 3e-08
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 5e-08
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 4e-05
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 2e-07
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 2e-06
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 0.003
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 3e-06
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 6e-04
d1ntya2121 b.55.1.1 (A:1415-1535) Triple functional domain pr 5e-06
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 5e-06
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 4e-05
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 8e-05
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 0.003
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-04
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure

class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: Rho guanine nucleotide exchange factor 9, Collybistin
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  118 bits (296), Expect = 2e-31
 Identities = 71/213 (33%), Positives = 107/213 (50%), Gaps = 24/213 (11%)

Query: 223 SLLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDI 282
            L + DQ+R+ V+ E+++TER ++K L D+ EGYL +CR+R DMFS EQ++ IFGN+EDI
Sbjct: 7   PLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDI 66

Query: 283 LAFQSSFLEDLETKLDWDAPYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLL 342
             FQ  F+ DLE + + D P+ S IG  FL+H+ GF  +      H             L
Sbjct: 67  YRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNH-------LDACMEL 119

Query: 343 FCCRSLEDKARWLAAFQQERALVEQDREDGL--------EFAPAAKELARMSAARCHSSR 394
                      +  A +  + +++   +  L        ++     EL + +        
Sbjct: 120 SKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYT-------- 171

Query: 395 PPTDHPDYVKITEALEAMRDVAMLINERKRRME 427
              DH DY  +  AL  MR+V   INERKRR+E
Sbjct: 172 -AQDHSDYRYVAAALAVMRNVTQQINERKRRLE 203


>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1ki1b1210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 100.0
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 100.0
d1xcga1228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 100.0
d1txda1234 Rho guanine nucleotide exchange factor 12 {Human ( 100.0
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 100.0
d1dbha1207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 100.0
d1by1a_209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 99.97
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.96
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.68
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.66
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.65
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.65
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.64
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.63
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.63
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.62
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.62
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.61
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.6
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.6
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.58
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.57
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.57
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.56
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.56
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.56
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.56
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.55
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.55
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.55
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.55
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.55
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.54
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.54
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.54
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.53
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.53
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.53
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.53
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.53
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 99.53
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.52
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.52
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.52
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.52
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.51
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.51
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.5
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.5
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.49
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.49
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.49
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.49
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.49
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.48
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.48
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.48
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.47
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.47
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.47
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.46
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.46
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.46
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.46
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.45
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.45
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.45
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.45
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.45
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.45
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.44
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.43
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.43
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.43
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.43
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.42
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.42
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.42
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.42
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.41
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.41
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.4
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.4
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.4
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.39
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.39
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.38
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.37
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.36
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.36
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.35
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.35
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.34
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.33
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.32
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.32
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.29
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 99.25
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.19
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 99.05
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.04
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.97
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.97
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 98.86
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 98.86
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.79
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.76
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 98.66
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.65
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 95.83
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 94.27
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 92.9
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 92.49
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 91.0
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 90.66
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 89.79
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 89.73
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 89.23
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 88.53
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 86.91
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 85.0
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 84.97
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 83.64
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 83.48
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 83.46
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 83.29
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 83.01
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 82.97
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: GEF of intersectin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-35  Score=273.18  Aligned_cols=203  Identities=18%  Similarity=0.247  Sum_probs=182.8

Q ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCHHHHHHHhcCHHHHHHHHHHHHHHHHHhhC-C-CC
Q psy824          224 LLSNDQVRSRVVRELINTERDFVKVLHDVSEGYLAECRRRNDMFSPEQIQTIFGNLEDILAFQSSFLEDLETKLD-W-DA  301 (518)
Q Consensus       224 ~~~~~~kR~~ii~ELl~tE~~Yv~~L~~l~~~f~~~l~~~~~~l~~~~~~~lF~ni~~i~~~h~~~l~~L~~~~~-~-~~  301 (518)
                      +++++.||+++|+||++||+.||++|+.+.+.|+.|+. ..+++++.++..||+|+++|+.+|+.|+..|+.+.. + ..
T Consensus         3 l~~~e~kR~~vi~Elv~tE~~Yv~~L~~l~~~y~~~l~-~~~~l~~~~~~~lF~~i~~l~~~h~~~l~~L~~~~~~~~~~   81 (210)
T d1ki1b1           3 LTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLM-ESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEK   81 (210)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHH-HHTSSCHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHCTT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-hcCCCCHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHccccc
Confidence            45678999999999999999999999999999999997 467899999999999999999999999999988763 2 23


Q ss_pred             CCCCchHHHHHhhhcCcCCchhHHHHHHHHHhcchhhHHHH---HHhhcchHHHHHHHHHHHhhccccccCccCCCcchh
Q psy824          302 PYKSCIGETFLKHKSGFHPHLGVTVRHAIKIHCSDKDKWLL---FCCRSLEDKARWLAAFQQERALVEQDREDGLEFAPA  378 (518)
Q Consensus       302 ~~~~~ig~~f~~~~~~~~~~~~~~~~~~y~~y~~~~~~a~~---~~~~~~~~~~~fl~~~~~~~~~~~~~~l~~~L~~Pv  378 (518)
                      .....||++|+.+.+.|+.         |..||.+|+.+..   .+.+.++.+..|++.++..+.+.+.. |.+||++|+
T Consensus        82 ~~~~~ig~~f~~~~~~~~~---------Y~~Y~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~~~L~~Pv  151 (210)
T d1ki1b1          82 MPVKMIGDILSAQLPHMQP---------YIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLEMDPRCKGMP-LSSFILKPM  151 (210)
T ss_dssp             SCCCCCHHHHHHHGGGGTH---------HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHTSGGGTTCC-HHHHTTHHH
T ss_pred             cchhHHHHHHHHHHHHhhH---------HHHHHHcChHHHHHHHHHHhhcHHHHHHHHHHhhCcccccCC-HHHHHHhHH
Confidence            3457899999999999877         8889999998854   44556788899999988877777665 999999999


Q ss_pred             hHHHHHHHhhhhccCCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Q psy824          379 AKELARMSAARCHSSRPPTDHPDYVKITEALEAMRDVAMLINERKRRMESLEKLAAWQQ  437 (518)
Q Consensus       379 QRl~~y~LlL~~l~k~t~~~~~d~~~l~~a~~~~~~~~~~vn~~~~~~e~~~~l~~~~~  437 (518)
                      ||+++|++||++|+|+||++|+|+..|..|++.+++++..+|+.++..|+..+|.++|+
T Consensus       152 qRl~rY~llL~~l~k~t~~~~~d~~~l~~a~~~~~~~~~~vn~~~~~~e~~~~l~~lQ~  210 (210)
T d1ki1b1         152 QRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQA  210 (210)
T ss_dssp             HHHHHHHHHHHHHHTTSCTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHhCCCCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999874



>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure