Psyllid ID: psy8251


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCISQGKGSKEKKDDEENEYGKPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKLTI
ccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEccccEEEEEccccEEcccccccccccccEEEEEEcc
ccccccccEccccHHHHHHHcccccccccccccccccEcccccHHHHccccccEcccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccccEccccccEEEccccccccccccccEEEcccHHHEEEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccEEcccccEEcccccccccccccccccccccccccEcccccHHHHEEEEEcccccccccccccccEEEcccHHHHHEHHccccccccccccccccccccEEccccHHHHHHHEcccHHHHHHHHHccccccccccHccHHEEccccccccHHHHHHHHccccccccccccccEEEEEccc
MWPRGFRGFRQVINLLKHRrehggnlsfdnchicKETFYKHSELVRHLErehniprsesspwccrfcnkRMMTKLSLGIherihtgqrpyicdwcgvgfrskanllqhqpvhtgqrkynctvcgkafsrkSFVTTHMrvhtgkltgkfgqkmsalsgTAFAVEYEIIQECLfaknggkafsrkSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQieshqttqpQRWAAYRQIgyygrepiqgfhsnvsinklscisqgkgskekkddeeneygkpedfipdVFQAEFSKENDKLLSYLEFcdhhcdrpydcdvcgakftqvgdmrrhrkkhdenggsakdkpgaynktdrysKLTYLLTVTEHKLVIQHFSLVqmnfnspselilltcseptiftnFNVKTQILNLtstfhlfhpltkynlsEQLWVKLTI
mwprgfrgFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLErehniprsesspwccrfCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQhqpvhtgqrkynCTVCGKAFSRKSFVTTHMRVhtgkltgkfgqKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRvhtgkltgkfgQKISALSGIRTQHLQieshqttqpqrWAAYRQIGYYGREPIQGFHSNVSINKLscisqgkgskekkddeeneygkpedfIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRrhrkkhdenggsakdkpgaynktdRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPltkynlseqlwVKLTI
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCISQgkgskekkddeeneygkPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKLTI
****GFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREH*******SPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCI**********************FIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQV***************************DRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKL**
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCISQGKGSKEKKDDEENEYGKPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKLTI
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIE********RWAAYRQIGYYGREPIQGFHSNVSINKLSCI*****************GKPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVG***************AKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKLTI
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCISQGKGSKEKKDDEENEYGKPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWPRGFRGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPIQGFHSNVSINKLSCISQGKGSKEKKDDEENEYGKPEDFIPDVFQAEFSKENDKLLSYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDRYSKLTYLLTVTEHKLVIQHFSLVQMNFNSPSELILLTCSEPTIFTNFNVKTQILNLTSTFHLFHPLTKYNLSEQLWVKLTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query434 2.2.26 [Sep-21-2011]
Q80W31679 Zinc finger protein 569 O yes N/A 0.778 0.497 0.277 1e-29
Q3ZCX4644 Zinc finger protein 568 O yes N/A 0.778 0.524 0.295 1e-29
Q14591655 Zinc finger protein 271 O no N/A 0.785 0.520 0.283 1e-29
P08043459 Zinc finger protein 2 OS= no N/A 0.661 0.625 0.296 2e-29
Q96NI8536 Zinc finger protein 570 O no N/A 0.552 0.447 0.298 2e-29
Q5MCW4686 Zinc finger protein 569 O no N/A 0.737 0.466 0.300 3e-29
O75820626 Zinc finger protein 189 O no N/A 0.744 0.515 0.280 6e-29
Q7TSI0686 Zinc finger protein 12 OS no N/A 0.702 0.444 0.316 9e-29
Q6ZN57461 Zinc finger protein 2 hom no N/A 0.661 0.622 0.293 1e-28
Q8BI99563 Zinc finger protein 879 O no N/A 0.705 0.543 0.297 1e-28
>sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 170/361 (47%), Gaps = 23/361 (6%)

Query: 7   RGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRF 66
           +GF Q ++L++H R H G   ++ CH C + F    +L+ H    H +  S    + C  
Sbjct: 186 KGFSQTLDLIRHLRVHTGGKLYE-CHQCGKGFSHKEKLINH----HKL-HSREQCYECSE 239

Query: 67  CNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKA 126
           C K  +   +L  H+RIHTG++PY+C  CG  F  K+NL+ H+ +HTG++ Y C  CGK+
Sbjct: 240 CGKTFIKMSNLIRHQRIHTGEKPYVCQECGKSFGQKSNLIDHEKIHTGEKPYKCNECGKS 299

Query: 127 FSRKSFVTTHMRVHTGK---LTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRK 183
           FS+K  +  H +VHTG+      + G+    ++  A  +     ++       GKAFS+ 
Sbjct: 300 FSQKQSLVAHQKVHTGEKPYACNECGKAFPRVASLALHMRGHTGEKPYKCDKCGKAFSQF 359

Query: 184 SFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPI 243
           S +  H+RVHTG+   + G+   A S      + I SH   +P      R+   + +  I
Sbjct: 360 SMLIIHVRVHTGEKPYECGECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFI 419

Query: 244 QGFHSNVSINKLSCISQGKGSKEKKD---DEENEYGKPEDFIPDVFQAEFSKENDKLLSY 300
                +       C   GK   +  +    +    G+      +  +A   K N  L+++
Sbjct: 420 THQKIHTREKPYGCNECGKAFIQMSNLVRHQRIHTGEKPYLCKECGKAFSQKSN--LIAH 477

Query: 301 LEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKHDENGGSAKDKPGAYNKTDR-YSKLTY 359
            +   H  ++PY+C+ CG  F+Q  +   H+K H        +KP   NK  + +S++  
Sbjct: 478 EKI--HSGEKPYECNECGKAFSQKQNFITHQKVH------TGEKPYDCNKCGKAFSQIAS 529

Query: 360 L 360
           L
Sbjct: 530 L 530




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 Back     alignment and function description
>sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=2 SV=2 Back     alignment and function description
>sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
426247137 959 PREDICTED: zinc finger protein 84 [Ovis 0.705 0.319 0.298 6e-29
348563182 1386 PREDICTED: zinc finger protein 91-like [ 0.781 0.244 0.269 1e-28
431918350 749 Zinc finger protein 569 [Pteropus alecto 0.721 0.417 0.286 2e-28
426242785 536 PREDICTED: zinc finger protein 570 [Ovis 0.552 0.447 0.301 2e-28
300798037 536 zinc finger protein 570 [Bos taurus] gi| 0.552 0.447 0.301 2e-28
403292919 686 PREDICTED: zinc finger protein 569 [Saim 0.737 0.466 0.303 2e-28
350579429 626 PREDICTED: zinc finger protein 189 isofo 0.744 0.515 0.283 3e-28
359318700 560 PREDICTED: zinc finger protein 569-like 0.735 0.569 0.276 3e-28
350579433 611 PREDICTED: zinc finger protein 189 isofo 0.744 0.528 0.283 3e-28
350585145 536 PREDICTED: zinc finger protein 570 [Sus 0.552 0.447 0.301 3e-28
>gi|426247137|ref|XP_004017343.1| PREDICTED: zinc finger protein 84 [Ovis aries] Back     alignment and taxonomy information
 Score =  135 bits (339), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 162/348 (46%), Gaps = 42/348 (12%)

Query: 7   RGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRF 66
           + F Q  +LL H+  H G   F  C  C + F + S+LVRH +R H   +    P+ C  
Sbjct: 436 KAFSQKSHLLSHQMTHTGEKPFV-CTKCGKAFSRKSQLVRH-QRTHTGEK----PYECSE 489

Query: 67  CNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKA 126
           C K    KLSL  H+RIHTG++PY+C  CG  F  K++L+ HQ  HTG++ Y C+ CGKA
Sbjct: 490 CGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKA 549

Query: 127 FSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEII---QECLFAKNGGKAFSRK 183
           F  KS +  H R HTG+   +  +   A    +  + ++     ++     + GKAFSRK
Sbjct: 550 FGEKSKLIRHQRTHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPFECSDCGKAFSRK 609

Query: 184 SFVTTHMRVHTGKLTGKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGREPI 243
           S +  H R HTG+      +   A S    Q  Q+ +HQ              + G +P 
Sbjct: 610 SHLIPHQRTHTGERPYSCSECRKAFS----QKSQLVNHQRI------------HTGEKPF 653

Query: 244 QGFHSNVSIN---KLSCISQGKGSKEKKDDEENEYGKPEDFIPDVFQAEF---------S 291
           Q      + +   + S +   +    +K     E GK    I ++ + +           
Sbjct: 654 QCSECGKAFSQNRRFSLVLHQRTHTGEKPYVCKECGKTFSQISNLVKHQMIHTGKKPHEC 713

Query: 292 KENDKLLSYLEFC-----DHHCDRPYDCDVCGAKFTQVGDMRRHRKKH 334
           K+ +K  SYL F       H  ++PY+C  CG  F++  ++ RH++ H
Sbjct: 714 KDCNKTFSYLSFLIEHQRTHTGEKPYECTECGKAFSRASNLTRHQRIH 761




Source: Ovis aries

Species: Ovis aries

Genus: Ovis

Family: Bovidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|348563182|ref|XP_003467387.1| PREDICTED: zinc finger protein 91-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|431918350|gb|ELK17576.1| Zinc finger protein 569 [Pteropus alecto] Back     alignment and taxonomy information
>gi|426242785|ref|XP_004015251.1| PREDICTED: zinc finger protein 570 [Ovis aries] Back     alignment and taxonomy information
>gi|300798037|ref|NP_001178282.1| zinc finger protein 570 [Bos taurus] gi|296477702|tpg|DAA19817.1| TPA: zinc finger protein 570 [Bos taurus] Back     alignment and taxonomy information
>gi|403292919|ref|XP_003937474.1| PREDICTED: zinc finger protein 569 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|350579429|ref|XP_003122093.3| PREDICTED: zinc finger protein 189 isoform 1 [Sus scrofa] Back     alignment and taxonomy information
>gi|359318700|ref|XP_003638890.1| PREDICTED: zinc finger protein 569-like [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|350579433|ref|XP_003480605.1| PREDICTED: zinc finger protein 189 isoform 3 [Sus scrofa] Back     alignment and taxonomy information
>gi|350585145|ref|XP_003481887.1| PREDICTED: zinc finger protein 570 [Sus scrofa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
UNIPROTKB|J9P3R2612 J9P3R2 "Uncharacterized protei 0.728 0.516 0.282 3e-42
UNIPROTKB|Q17RR6527 ZNF569 "ZNF569 protein" [Homo 0.728 0.599 0.273 6.6e-41
UNIPROTKB|F1MH55685 ZNF569 "Uncharacterized protei 0.728 0.461 0.279 1.8e-40
UNIPROTKB|F1RKN0686 ZNF569 "Uncharacterized protei 0.728 0.460 0.279 2.4e-40
UNIPROTKB|Q5MCW4686 ZNF569 "Zinc finger protein 56 0.728 0.460 0.273 1.9e-39
UNIPROTKB|Q6ZN57461 ZFP2 "Zinc finger protein 2 ho 0.423 0.399 0.373 5.1e-39
UNIPROTKB|F1N7K0536 ZNF570 "Uncharacterized protei 0.476 0.386 0.340 4.5e-38
UNIPROTKB|J9P173537 ZNF570 "Uncharacterized protei 0.476 0.385 0.340 4.6e-38
UNIPROTKB|J9NSL7525 ZNF71 "Uncharacterized protein 0.423 0.350 0.373 5e-38
UNIPROTKB|A5PJY6612 ZNF189 "Uncharacterized protei 0.490 0.348 0.337 4.2e-37
UNIPROTKB|J9P3R2 J9P3R2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 3.0e-42, Sum P(2) = 3.0e-42
 Identities = 95/336 (28%), Positives = 165/336 (49%)

Query:     7 RGFRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRF 66
             +GF Q ++L++H R H G   ++ C  C++ F    +L++H    H I   E S + C  
Sbjct:   231 KGFSQTLDLIRHLRIHTGEKPYE-CKKCRKAFSHKEKLIKH----HKIHSREQS-YECNE 284

Query:    67 CNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKA 126
             C K  +   +L  H+RIHTG++PY C  CG  F  K+NL+ H+ +HTG++ Y C  CGKA
Sbjct:   285 CGKAFIKMSNLIRHQRIHTGEKPYACKECGKSFSQKSNLIDHEKIHTGEKPYECNECGKA 344

Query:   127 FSRKSFVTTHMRVHTGK---LTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRK 183
             FS+K  +T H +VHTG+      + G+    ++  A  +     ++       GKAFS+ 
Sbjct:   345 FSQKQSLTAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQF 404

Query:   184 SFVTTHMRVHTGKLT---GKFGQKISALSGIRTQHLQIESHQTTQPQRWAAYRQIGYYGR 240
             S +  H+R+HTG+      + G+  S  S + T H++  SH   +P      R+   + +
Sbjct:   405 SMLIIHVRIHTGEKPYECNECGKSFSQSSAL-TVHMR--SHTGEKPYECKECRKAFSHKK 461

Query:   241 EPI--QGFHSNVSINKLSCISQXXXXXXXXXXXXXXXXXPEDFIPDVFQAEFSKENDKLL 298
               I  Q  H+     + +   +                  + +I       FS++++ L+
Sbjct:   462 NFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSN-LI 520

Query:   299 SYLEFCDHHCDRPYDCDVCGAKFTQVGDMRRHRKKH 334
             ++ +   H  ++PY+C+ CG  F+Q  +   H+K H
Sbjct:   521 AHEKI--HSGEKPYECNECGKAFSQKQNFITHQKVH 554


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|Q17RR6 ZNF569 "ZNF569 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MH55 ZNF569 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKN0 ZNF569 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5MCW4 ZNF569 "Zinc finger protein 569" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZN57 ZFP2 "Zinc finger protein 2 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7K0 ZNF570 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P173 ZNF570 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSL7 ZNF71 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJY6 ZNF189 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 434
KOG1074|consensus958 99.94
KOG2462|consensus279 99.93
KOG2462|consensus279 99.91
KOG1074|consensus958 99.91
KOG3608|consensus467 99.89
KOG3608|consensus467 99.86
KOG3623|consensus 1007 99.84
KOG3623|consensus 1007 99.78
KOG3576|consensus267 99.57
KOG3576|consensus267 99.57
PLN03086567 PRLI-interacting factor K; Provisional 99.0
PLN03086567 PRLI-interacting factor K; Provisional 98.98
PHA00733128 hypothetical protein 98.9
PHA00733128 hypothetical protein 98.85
PHA0276855 hypothetical protein; Provisional 98.6
PHA0276855 hypothetical protein; Provisional 98.55
KOG3993|consensus500 98.45
KOG3993|consensus500 98.43
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.36
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.29
PHA0061644 hypothetical protein 98.18
PHA0061644 hypothetical protein 97.97
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.9
PHA0073279 hypothetical protein 97.85
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.81
PHA0073279 hypothetical protein 97.63
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.6
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.54
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.5
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.4
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.18
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.16
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.05
smart0035526 ZnF_C2H2 zinc finger. 97.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.01
COG5189423 SFP1 Putative transcriptional repressor regulating 96.87
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.71
KOG2231|consensus 669 96.51
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.51
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.46
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.25
smart0035526 ZnF_C2H2 zinc finger. 96.01
COG5189423 SFP1 Putative transcriptional repressor regulating 95.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.79
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.53
KOG2231|consensus 669 95.4
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.18
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.97
PRK04860160 hypothetical protein; Provisional 94.88
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.85
PRK04860160 hypothetical protein; Provisional 94.73
KOG2482|consensus423 93.87
KOG1146|consensus 1406 93.52
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.3
COG5236493 Uncharacterized conserved protein, contains RING Z 92.62
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.25
KOG2893|consensus341 91.31
COG5048467 FOG: Zn-finger [General function prediction only] 91.31
COG5048467 FOG: Zn-finger [General function prediction only] 90.61
KOG1146|consensus1406 90.42
KOG2785|consensus390 89.8
KOG2482|consensus423 89.73
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.64
COG5236493 Uncharacterized conserved protein, contains RING Z 89.47
PF04838159 Baculo_LEF5: Baculoviridae late expression factor 87.04
KOG2893|consensus341 86.88
KOG2785|consensus390 86.22
COG404965 Uncharacterized protein containing archaeal-type C 86.2
KOG4173|consensus253 85.62
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.67
COG404965 Uncharacterized protein containing archaeal-type C 82.29
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.3
>KOG1074|consensus Back     alignment and domain information
Probab=99.94  E-value=1.3e-27  Score=234.68  Aligned_cols=124  Identities=27%  Similarity=0.584  Sum_probs=98.6

Q ss_pred             CeecCcCCcccCCHHHHHHHHHhccCCCceeccccccccccchHHHchhhhcCCCC----ceecc---ccCcccCChhHH
Q psy8251          61 PWCCRFCNKRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQR----KYNCT---VCGKAFSRKSFV  133 (434)
Q Consensus        61 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----~~~C~---~C~k~F~~~~~L  133 (434)
                      |..|-+|.++..-++.|+.|.++|+||+||+|.+||+.|.++++|+.|+.+|...-    .+.|+   +|-+.|...-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            35699999999999999999999999999999999999999999999999886543    48899   999999999999


Q ss_pred             HhhhccccCCcccccccccccccccccchhhhhhhhceecccCCcccCChhhHHHHhhhccCC
Q psy8251         134 TTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECLFAKNGGKAFSRKSFVTTHMRVHTGK  196 (434)
Q Consensus       134 ~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~C~~C~~~F~~~~~L~~H~~~H~~~  196 (434)
                      ..|+++|.+.....-..  . .  ..... -..|..|      .+.|.....+..++..|.+.
T Consensus       685 pQhIriH~~~~~s~g~~--a-~--e~~~~-adq~~~~------qk~~~~a~~f~~~~se~~~~  735 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGT--A-A--EGILA-ADQCSSC------QKTFSDARSFSQQISEQPSP  735 (958)
T ss_pred             cceEEeecCCCCCCCcc--c-c--cccch-hcccchh------hhcccccccchhhhhccCCc
Confidence            99999998543311100  0 0  11111 1126666      99999999999999887543



>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04838 Baculo_LEF5: Baculoviridae late expression factor 5 ; InterPro: IPR006923 This is a family of Baculoviridae late expression factor 5, required for late and very late gene expression Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 9e-21
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-12
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-12
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-10
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-10
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-10
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-09
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-09
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-09
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 9e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 7e-08
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-07
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 4e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-06
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 6e-05
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 6e-04
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2ysp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eqw_A42 Solution Structure Of The 6th C2h2 Type Zinc Finger 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 97.8 bits (242), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 60/176 (34%), Positives = 86/176 (48%), Gaps = 18/176 (10%) Query: 31 CHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPY 90 C C ++F + L H +R H + P+ C C K K L H+R HTG++PY Sbjct: 24 CPECGKSFSRSDHLAEH-QRTHTGEK----PYKCPECGKSFSDKKDLTRHQRTHTGEKPY 78 Query: 91 ICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQ 150 C CG F +ANL HQ HTG++ Y C CGK+FS+ + + H R HTG+ K + Sbjct: 79 KCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPE 138 Query: 151 KMSALSGTAFAVEYEI--------IQECLFAKNGGKAFSRKSFVTTHMRVHTGKLT 198 G +F+ E + ++ GK+FSR+ + H R HTGK T Sbjct: 139 -----CGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT 189
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YSP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 507- 539) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EQW|A Chain A, Solution Structure Of The 6th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 484 Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-29
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-26
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-26
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-25
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-19
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-22
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-24
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-24
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-13
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 8e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 4e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 6e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  120 bits (303), Expect = 2e-32
 Identities = 60/189 (31%), Positives = 83/189 (43%), Gaps = 35/189 (18%)

Query: 9   FRQVINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCN 68
                + +       G   +  C  C ++F +   L  H +R H    +   P+ C  C 
Sbjct: 3   EFGSSSSVAQAALEPGEKPYA-CPECGKSFSRSDHLAEH-QRTH----TGEKPYKCPECG 56

Query: 69  KRMMTKLSLGIHERIHTGQRPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFS 128
           K    K  L  H+R HTG++PY C  CG  F  +ANL  HQ  HTG++ Y C  CGK+FS
Sbjct: 57  KSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFS 116

Query: 129 RKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVE--YEIIQECLFAKNGGKAFSRKSFV 186
           + + +  H R HTG                    E  Y+   EC      GK+FSR+  +
Sbjct: 117 QLAHLRAHQRTHTG--------------------EKPYK-CPEC------GKSFSREDNL 149

Query: 187 TTHMRVHTG 195
            TH R HTG
Sbjct: 150 HTHQRTHTG 158


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.74
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.69
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.67
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.63
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.61
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.61
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.53
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.52
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.46
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.44
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.43
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.4
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.4
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.37
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.37
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.36
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.35
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.35
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.35
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.34
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.3
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.3
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.29
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.29
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.29
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.24
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.23
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.14
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.13
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.1
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.08
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.99
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.98
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.97
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.97
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.97
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.96
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.94
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.92
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.92
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.9
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.9
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.87
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.86
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.85
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.85
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.83
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.83
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.81
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.8
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.8
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.79
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.79
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.78
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.78
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.76
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.74
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.72
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.71
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.69
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.68
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.68
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.66
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.66
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.65
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.65
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.64
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.59
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.58
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.53
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.5
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.49
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.46
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.46
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.46
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.44
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.37
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.34
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.34
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.33
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.33
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.32
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.32
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.32
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.31
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.3
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.29
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.28
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.27
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.27
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.26
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.25
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.25
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.25
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.24
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.57
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.56
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.49
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.16
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.13
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.09
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.02
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.98
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.98
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.97
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.97
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.94
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.93
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.93
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.91
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.88
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.88
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.87
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.85
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.06
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.83
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.04
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.82
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.81
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.73
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.87
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.53
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.09
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.95
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.43
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.76
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.38
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.43
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.15
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.92
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.32
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.63
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.23
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.12
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 81.56
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 81.34
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 80.88
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=6.1e-35  Score=256.51  Aligned_cols=153  Identities=38%  Similarity=0.751  Sum_probs=117.2

Q ss_pred             HHHHHHHHHHcCCCCCCCCccchhhhcCCHHHHHHHHHhhcCCCCCCCCCeecCcCCcccCCHHHHHHHHHhccCCCcee
Q psy8251          12 VINLLKHRREHGGNLSFDNCHICKETFYKHSELVRHLEREHNIPRSESSPWCCRFCNKRMMTKLSLGIHERIHTGQRPYI   91 (434)
Q Consensus        12 ~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~   91 (434)
                      ...|..|++.|.++++|. |++|++.|.+...|..|++ .|    .++++|.|+.|++.|.+...|..|+++|.++++|.
T Consensus         6 ~~~l~~h~~~~~~~~~~~-C~~C~~~f~~~~~l~~H~~-~h----~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~   79 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYA-CPECGKSFSRSDHLAEHQR-TH----TGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK   79 (190)
T ss_dssp             --------------------------CCSSHHHHHGGG-CC-------CCEECTTTCCEESSHHHHHHHHHHHHCCCCEE
T ss_pred             hccchhhhhhcCCCCCCc-CCCCccccCCHHHHHHHHH-Hc----CCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCcc
Confidence            467889999999999999 9999999999999999998 45    56789999999999999999999999999999999


Q ss_pred             ccccccccccchHHHchhhhcCCCCceeccccCcccCChhHHHhhhccccCCcccccccccccccccccchhhhhhhhce
Q psy8251          92 CDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVHTGKLTGKFGQKMSALSGTAFAVEYEIIQECL  171 (434)
Q Consensus        92 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~k~F~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~  171 (434)
                      |++|++.|.+...|..|++.|+++++|.|+.|++.|.+...|..|+++|+++++                  |. |+.| 
T Consensus        80 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~------------------~~-C~~C-  139 (190)
T 2i13_A           80 CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKP------------------YK-CPEC-  139 (190)
T ss_dssp             CTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCC------------------EE-CTTT-
T ss_pred             CcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCC------------------eE-CCCC-
Confidence            999999999999999999999999999999999999999999999999999988                  55 6666 


Q ss_pred             ecccCCcccCChhhHHHHhhhccC
Q psy8251         172 FAKNGGKAFSRKSFVTTHMRVHTG  195 (434)
Q Consensus       172 ~C~~C~~~F~~~~~L~~H~~~H~~  195 (434)
                           ++.|.+...|..|+++|++
T Consensus       140 -----~~~f~~~~~L~~H~~~H~~  158 (190)
T 2i13_A          140 -----GKSFSREDNLHTHQRTHTG  158 (190)
T ss_dssp             -----CCEESCHHHHHHHHHHHHC
T ss_pred             -----CcccCCHHHHHHHHHhcCC
Confidence                 9999999999999987654



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 434
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 9e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.004
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 7e-04
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 4e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 53.5 bits (128), Expect = 2e-10
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 88  RPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVH 140
           + Y C  CG  F  K+   +H  +H G R Y C VCGK F  K  +  HM++H
Sbjct: 2   KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.52
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.48
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.29
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.21
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.17
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.13
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.11
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.09
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.08
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.04
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.97
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.97
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.95
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.89
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.82
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.8
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.8
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.74
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.73
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.59
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.59
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.57
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.47
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.38
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.37
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.33
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.2
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.01
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.99
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.84
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.82
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.79
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.63
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.62
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.59
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.55
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.35
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.34
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.25
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.23
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.07
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.06
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.02
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.0
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.99
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.92
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.87
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.83
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.74
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.71
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.59
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.56
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.45
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.33
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.29
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.18
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.18
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.16
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.05
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.99
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.86
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.8
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.48
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.37
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.25
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.93
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.73
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.76
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.56
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.36
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.3
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.67
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.91
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 91.17
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 91.15
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 90.91
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.57
d1y0jb136 U-shaped transcription factor, different fingers { 88.93
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.83
d1y0jb136 U-shaped transcription factor, different fingers { 87.34
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.28
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.27
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.93
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.85
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.31
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 85.16
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.15
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 83.31
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.69
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 82.55
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.42
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.52  E-value=2.6e-15  Score=99.51  Aligned_cols=52  Identities=40%  Similarity=0.852  Sum_probs=27.0

Q ss_pred             CceeccccccccccchHHHchhhhcCCCCceeccccCcccCChhHHHhhhccc
Q psy8251          88 RPYICDWCGVGFRSKANLLQHQPVHTGQRKYNCTVCGKAFSRKSFVTTHMRVH  140 (434)
Q Consensus        88 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~k~F~~~~~L~~H~~~h  140 (434)
                      +||.| .||+.|.....|..|+++|++++||.|++||+.|.+.+.|..|+++|
T Consensus         2 K~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            44555 25555555555555555555555555555555555555555555443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure