Psyllid ID: psy826
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 329 | ||||||
| 332026184 | 359 | Cysteine-rich with EGF-like domain prote | 0.924 | 0.846 | 0.548 | 6e-99 | |
| 322780812 | 324 | hypothetical protein SINV_05381 [Solenop | 0.948 | 0.962 | 0.552 | 1e-98 | |
| 383850574 | 380 | PREDICTED: cysteine-rich with EGF-like d | 0.945 | 0.818 | 0.547 | 7e-98 | |
| 307210240 | 378 | Cysteine-rich with EGF-like domain prote | 0.945 | 0.822 | 0.534 | 8e-98 | |
| 380014596 | 380 | PREDICTED: cysteine-rich with EGF-like d | 0.948 | 0.821 | 0.537 | 1e-95 | |
| 156555055 | 381 | PREDICTED: cysteine-rich with EGF-like d | 0.960 | 0.829 | 0.535 | 2e-95 | |
| 328786339 | 380 | PREDICTED: cysteine-rich with EGF-like d | 0.948 | 0.821 | 0.531 | 7e-94 | |
| 350406153 | 379 | PREDICTED: cysteine-rich with EGF-like d | 0.945 | 0.820 | 0.513 | 2e-92 | |
| 91095041 | 374 | PREDICTED: similar to AGAP007968-PA [Tri | 0.927 | 0.815 | 0.574 | 8e-92 | |
| 289741833 | 380 | uncharacterized conserved protein [Gloss | 0.960 | 0.831 | 0.507 | 1e-90 |
| >gi|332026184|gb|EGI66326.1| Cysteine-rich with EGF-like domain protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 367 bits (941), Expect = 6e-99, Method: Compositional matrix adjust.
Identities = 169/308 (54%), Positives = 225/308 (73%), Gaps = 4/308 (1%)
Query: 3 GIEKTAKGNFAGGDTAWEEEKQKIYAKSEVRLIEIQEKMCSEVSGFLDQCHNFAADIESE 62
G+EKT++G F GGD+AWEE+K Y++SE+RLIEIQE +C +V QC + A ++E++
Sbjct: 37 GLEKTSRGKFEGGDSAWEEDKLGTYSRSEIRLIEIQENLCKDVERGQVQCQSLAEELENQ 96
Query: 63 IEEWWFKVQHSKAKDSDLYTWLCINKLKRCCPVDHYGADCKPCLGFP-NVCFGNGKCKGN 121
IEEWWFK Q + D+Y ++CI K +RCCP DHYG +C C G+P N+C NGKCKG
Sbjct: 97 IEEWWFKHQDTHP---DIYDYICIEKTERCCPKDHYGPNCTQCPGYPDNICNNNGKCKGA 153
Query: 122 GTRKGNGQCVCNKEYTGELCNECNTGYFQSYKDEKTILCSKCHASCESGCSTGGPKGCTK 181
GTRKGNG C C K Y G++C+EC +GY++SYKDEKT+LCS CH +C+ C GPK C K
Sbjct: 154 GTRKGNGGCFCEKGYIGDICSECASGYYESYKDEKTLLCSVCHTACDGPCRGAGPKDCEK 213
Query: 182 CKSGWAADKDIGCYDINECSDENICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGPDMCEA 241
C +GW ++ GC+DINEC ++IC NQFCVN EG+Y C+ CD +CN C GDGPDMC
Sbjct: 214 CTAGWDMIENKGCFDINECLKDDICPSNQFCVNKEGNYACLACDKACNSCTGDGPDMCIR 273
Query: 242 CAEGYKLQQNICINTQAKSQNTNENLYRYGVYVGLCVATYIIFQKNVFIASIVGVVVAIY 301
C EGY Q N+CIN+ + ENL RY Y GLCVAT II Q+N+++ASI+G++VA+Y
Sbjct: 274 CTEGYHKQDNLCINSDLLGRKKQENLARYLTYFGLCVATCIILQRNIYVASIIGLLVAMY 333
Query: 302 VSVAEYIL 309
+SV+EY++
Sbjct: 334 ISVSEYMI 341
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322780812|gb|EFZ10041.1| hypothetical protein SINV_05381 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383850574|ref|XP_003700870.1| PREDICTED: cysteine-rich with EGF-like domain protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307210240|gb|EFN86890.1| Cysteine-rich with EGF-like domain protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|380014596|ref|XP_003691313.1| PREDICTED: cysteine-rich with EGF-like domain protein 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156555055|ref|XP_001603904.1| PREDICTED: cysteine-rich with EGF-like domain protein 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328786339|ref|XP_394353.3| PREDICTED: cysteine-rich with EGF-like domain protein 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350406153|ref|XP_003487675.1| PREDICTED: cysteine-rich with EGF-like domain protein 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|91095041|ref|XP_971778.1| PREDICTED: similar to AGAP007968-PA [Tribolium castaneum] gi|270014762|gb|EFA11210.1| hypothetical protein TcasGA2_TC005174 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|289741833|gb|ADD19664.1| uncharacterized conserved protein [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 329 | ||||||
| FB|FBgn0031217 | 374 | CG11377 [Drosophila melanogast | 0.963 | 0.847 | 0.469 | 1.6e-86 | |
| ZFIN|ZDB-GENE-040426-1626 | 341 | creld2 "cysteine-rich with EGF | 0.741 | 0.715 | 0.474 | 1.9e-67 | |
| UNIPROTKB|E1BQM1 | 363 | CRELD2 "Uncharacterized protei | 0.775 | 0.702 | 0.439 | 2e-65 | |
| UNIPROTKB|F1SQD9 | 420 | CRELD1 "Uncharacterized protei | 0.823 | 0.645 | 0.409 | 2.2e-59 | |
| UNIPROTKB|Q96HD1 | 420 | CRELD1 "Cysteine-rich with EGF | 0.744 | 0.583 | 0.427 | 7.3e-59 | |
| UNIPROTKB|F1N3P8 | 420 | CRELD1 "Cysteine-rich with EGF | 0.744 | 0.583 | 0.431 | 9.3e-59 | |
| UNIPROTKB|Q5EA46 | 420 | CRELD1 "Cysteine-rich with EGF | 0.744 | 0.583 | 0.431 | 9.3e-59 | |
| UNIPROTKB|F1PD72 | 421 | CRELD1 "Uncharacterized protei | 0.823 | 0.643 | 0.407 | 9.3e-59 | |
| MGI|MGI:2152539 | 420 | Creld1 "cysteine-rich with EGF | 0.744 | 0.583 | 0.427 | 1.2e-58 | |
| RGD|1309412 | 420 | Creld1 "cysteine-rich with EGF | 0.744 | 0.583 | 0.423 | 5.1e-58 |
| FB|FBgn0031217 CG11377 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 865 (309.6 bits), Expect = 1.6e-86, P = 1.6e-86
Identities = 156/332 (46%), Positives = 211/332 (63%)
Query: 2 SGIEKTAKGNFAGGDTAWEEEKQKIYAKSEVRLIEIQEKMCSEVSGF-LDQCHNFAADIE 60
+G+E+T +G+ AGGDTAWEEEK + Y SEVRL+EIQEK+CSE D CHN A + E
Sbjct: 43 AGLERTKRGH-AGGDTAWEEEKLRSYKNSEVRLVEIQEKLCSEGEVINKDHCHNLANEHE 101
Query: 61 SEIEEWWFKVQHSKAKDSDLYTWLCINKLKRCCPVDHYGADCKPCLGFPNVCFGNGKCKG 120
+ +E+W+ H + + DL +WLCI++L CCP++ YG DC C C GNGKCKG
Sbjct: 102 ALLEDWFI---HKQTESPDLQSWLCIDQLTVCCPLNTYGPDCLTC----TECNGNGKCKG 154
Query: 121 NGTRKGNGQCVCNKEYTGELCNECNTGYFQSYKDEKTILCSKCHASC-ESGCSTGGPKGC 179
+GTRKGNG+C C+ Y G CNEC +++S++DEK +LC++CHA+C E GC+ GGPK C
Sbjct: 155 DGTRKGNGKCKCDPGYAGPNCNECGPEHYESFRDEKKLLCTQCHAACGEGGCTGGGPKSC 214
Query: 180 TKCKSGWAADKDIGCYDINECSDE---NICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGP 236
KCK GW+ D + GC DINEC ++ N C QFCVN EGS+ C++CD SC+GC GDGP
Sbjct: 215 RKCKKGWSMDSEAGCVDINECLEQQRPNPCRPQQFCVNNEGSFSCLECDRSCDGCDGDGP 274
Query: 237 DMCEACAEGYKLQQNICINTQAKSQNTNENLYRYGVYVGLCVATYIIFQKNXXXXXX--X 294
DMC CA+GY+L++ C + A+ ++ + R Y G+CVAT +IFQ +
Sbjct: 275 DMCRKCADGYELKEGKCHDISAEQRSNYVSFTRMLTYFGMCVATCVIFQSSTHIAWGCIV 334
Query: 295 XXXXXXXXXXXEYILNDKTAAFDPPSIITKHL 326
EY +N + P I TK L
Sbjct: 335 GAAVAGYIAVSEYWINSEAGGGHQPEIDTKQL 366
|
|
| ZFIN|ZDB-GENE-040426-1626 creld2 "cysteine-rich with EGF-like domains 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQM1 CRELD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQD9 CRELD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96HD1 CRELD1 "Cysteine-rich with EGF-like domain protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N3P8 CRELD1 "Cysteine-rich with EGF-like domain protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EA46 CRELD1 "Cysteine-rich with EGF-like domain protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PD72 CRELD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2152539 Creld1 "cysteine-rich with EGF-like domains 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309412 Creld1 "cysteine-rich with EGF-like domains 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 329 | |||
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 7e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 1e-05 | |
| pfam11938 | 151 | pfam11938, DUF3456, TLR4 regulator and MIR-interac | 2e-05 | |
| smart00261 | 45 | smart00261, FU, Furin-like repeats | 6e-05 | |
| cd00064 | 49 | cd00064, FU, Furin-like repeats | 5e-04 |
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
Score = 41.8 bits (99), Expect = 7e-06
Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
Query: 196 DINECSDENICSGNQFCVNTEGSYRCMQCDP 226
DI+EC+ N C CVNT GSYRC +C P
Sbjct: 1 DIDECASGNPCQNGGTCVNTVGSYRC-ECPP 30
|
Length = 39 |
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221329 pfam11938, DUF3456, TLR4 regulator and MIR-interacting MSAP | Back alignment and domain information |
|---|
| >gnl|CDD|214589 smart00261, FU, Furin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|238021 cd00064, FU, Furin-like repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| KOG4260|consensus | 350 | 100.0 | ||
| KOG1214|consensus | 1289 | 99.25 | ||
| PF11938 | 151 | DUF3456: TLR4 regulator and MIR-interacting MSAP; | 98.89 | |
| KOG1219|consensus | 4289 | 98.86 | ||
| KOG4260|consensus | 350 | 98.68 | ||
| KOG0994|consensus | 1758 | 98.5 | ||
| KOG4289|consensus | 2531 | 98.31 | ||
| KOG1225|consensus | 525 | 98.27 | ||
| KOG0994|consensus | 1758 | 98.27 | ||
| KOG1214|consensus | 1289 | 98.09 | ||
| KOG1217|consensus | 487 | 98.07 | ||
| KOG1225|consensus | 525 | 98.02 | ||
| PF14843 | 132 | GF_recep_IV: Growth factor receptor domain IV; PDB | 97.95 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.93 | |
| PTZ00214 | 800 | high cysteine membrane protein Group 4; Provisiona | 97.72 | |
| KOG4289|consensus | 2531 | 97.71 | ||
| KOG1836|consensus | 1705 | 97.65 | ||
| KOG1219|consensus | 4289 | 97.61 | ||
| PF03302 | 397 | VSP: Giardia variant-specific surface protein; Int | 97.52 | |
| PTZ00214 | 800 | high cysteine membrane protein Group 4; Provisiona | 97.49 | |
| PF14843 | 132 | GF_recep_IV: Growth factor receptor domain IV; PDB | 97.49 | |
| KOG1836|consensus | 1705 | 97.31 | ||
| PF03302 | 397 | VSP: Giardia variant-specific surface protein; Int | 97.28 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.09 | |
| cd00064 | 49 | FU Furin-like repeats. Cysteine rich region. Exact | 97.03 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 96.96 | |
| smart00261 | 46 | FU Furin-like repeats. | 96.95 | |
| KOG1217|consensus | 487 | 96.88 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 96.56 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.48 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.41 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 96.41 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 96.32 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.31 | |
| KOG1226|consensus | 783 | 96.29 | ||
| KOG4052|consensus | 190 | 96.26 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 95.94 | |
| KOG1025|consensus | 1177 | 95.92 | ||
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 95.84 | |
| KOG0196|consensus | 996 | 95.78 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 95.76 | |
| KOG1025|consensus | 1177 | 95.7 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 95.66 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.57 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 95.55 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 95.44 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.39 | |
| smart00261 | 46 | FU Furin-like repeats. | 95.06 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 95.03 | |
| KOG3512|consensus | 592 | 95.01 | ||
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 94.54 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 94.26 | |
| cd00064 | 49 | FU Furin-like repeats. Cysteine rich region. Exact | 94.06 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 94.03 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 93.94 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 93.68 | |
| PF00594 | 42 | Gla: Vitamin K-dependent carboxylation/gamma-carbo | 93.41 | |
| KOG1226|consensus | 783 | 93.41 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 92.75 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 92.74 | |
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 92.48 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 92.42 | |
| smart00069 | 65 | GLA Domain containing Gla (gamma-carboxyglutamate) | 92.22 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 91.72 | |
| KOG3512|consensus | 592 | 90.01 | ||
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 88.67 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 86.61 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 85.83 | |
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 84.27 | |
| cd00185 | 98 | TNFR Tumor necrosis factor receptor (TNFR) domain; | 83.9 | |
| cd00185 | 98 | TNFR Tumor necrosis factor receptor (TNFR) domain; | 83.74 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 83.22 | |
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 81.98 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 80.07 |
| >KOG4260|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-61 Score=418.15 Aligned_cols=272 Identities=43% Similarity=0.952 Sum_probs=235.8
Q ss_pred cchhhccCCCCCCCCchhhhhccCcccccceEEEecccCcccCcc--cCccchhhHHhhhHHHHHHhhhhccCCcccCCC
Q psy826 2 SGIEKTAKGNFAGGDTAWEEEKQKIYAKSEVRLIEIQEKMCSEVS--GFLDQCHNFAADIESEIEEWWFKVQHSKAKDSD 79 (329)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~ee~~~~~y~~se~~~~e~~e~~C~~~~--~~~~~c~~~~~~~~~~~e~~~~~~~~~~~~~~~ 79 (329)
+||+||+|+||+||||||||++|++|+.||+||+||+|++|+..+ ..||+||.+++.+|++||.||++.|+ ..||
T Consensus 42 ~GlerT~r~hfaGGdTAWEEknL~kYk~SE~RLvEilEglCsks~~~n~DfeCh~lle~hEellE~w~~hkq~---e~Pd 118 (350)
T KOG4260|consen 42 EGLERTARHHFAGGDTAWEEKNLSKYKTSETRLVEILEGLCSKSSLPNMDFECHTLLEKHEELLEEWWYHKQH---ESPD 118 (350)
T ss_pred HHHHHHhhhccCCCchhhhhhhhhhccccchhHHHHHHHhhhccCCCCCChHHHHHHHHHHHHHHHHHHHhhc---CCch
Confidence 699999999999999999999999999999999999999999321 23899999999999999999999999 8899
Q ss_pred ccceeecccccCcCCCCCCCCCCccCCCCC-CCCCCCCcccCCCCCCCCceeecCCCCCCCCCCcCCCCccccccCcCCC
Q psy826 80 LYTWLCINKLKRCCPVDHYGADCKPCLGFP-NVCFGNGKCKGNGTRKGNGQCVCNKEYTGELCNECNTGYFQSYKDEKTI 158 (329)
Q Consensus 80 ~~~~~C~~~~~~~C~~G~~G~~C~~C~~~~-~~C~~~~~C~~~~~~~gs~~C~C~~G~~g~~C~~C~~g~y~~~~~~~~~ 158 (329)
+.+|+|++..+++||+|.||++|.+||+++ .+|+++|+|.+++++.|++.|.|.+||.|+.|..|.++||....++...
T Consensus 119 l~~WlCvdqLkvCCp~gtyGpdCl~Cpggser~C~GnG~C~GdGsR~GsGkCkC~~GY~Gp~C~~Cg~eyfes~Rne~~l 198 (350)
T KOG4260|consen 119 LFNWLCVDQLKVCCPDGTYGPDCLQCPGGSERPCFGNGSCHGDGSREGSGKCKCETGYTGPLCRYCGIEYFESSRNEQHL 198 (350)
T ss_pred HHhHhhhhhheeccCCCCcCCccccCCCCCcCCcCCCCcccCCCCCCCCCcccccCCCCCccccccchHHHHhhcccccc
Confidence 999999999999999999999999999866 7999999999999999999999999999999999999999999999999
Q ss_pred CCcCCcccccCCcccCCCCCCccCCCCceecCCCCcccCCCCCCC-CCCCCCceeecCCCCcccCCCcCCCCCCcCCccc
Q psy826 159 LCSKCHASCESGCSTGGPKGCTKCKSGWAADKDIGCYDINECSDE-NICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGPD 237 (329)
Q Consensus 159 ~C~~C~~~C~~~C~~~~~~~C~~C~~G~~~~~~~~C~d~~eC~~~-~~C~~~~~C~n~~gs~~C~~C~~~C~~C~g~~~~ 237 (329)
+|..||..|...|++.++..|..|+.||.++. ..|+|||||... .+|...++|+|+.|||+|.. .+++.. ++.
T Consensus 199 vCt~Ch~~C~~~Csg~~~k~C~kCkkGW~lde-~gCvDvnEC~~ep~~c~~~qfCvNteGSf~C~d-k~Gy~~----g~d 272 (350)
T KOG4260|consen 199 VCTACHEGCLGVCSGESSKGCSKCKKGWKLDE-EGCVDVNECQNEPAPCKAHQFCVNTEGSFKCED-KEGYKK----GVD 272 (350)
T ss_pred hhhhhhhhhhcccCCCCCCChhhhcccceecc-cccccHHHHhcCCCCCChhheeecCCCceEecc-cccccC----ChH
Confidence 99999999998999999999999999999995 789999999987 89999999999999999982 433332 466
Q ss_pred ccccCcccccccCCcccccCcCCCCccccceeeeeeeceeeeEEEee
Q psy826 238 MCEACAEGYKLQQNICINTQAKSQNTNENLYRYGVYVGLCVATYIIF 284 (329)
Q Consensus 238 ~C~~C~~Gy~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 284 (329)
.|..|..++.+.+..|.+++.... .+.+..+.+++..++...+.+
T Consensus 273 ~C~~~~d~~~~kn~~c~ni~~~~r--~v~f~~~~~~~g~cV~~~~p~ 317 (350)
T KOG4260|consen 273 ECQFCADVCASKNRPCMNIDGQYR--CVCFSGLIIIEGFCVWHGSPV 317 (350)
T ss_pred HhhhhhhhcccCCCCcccCCccEE--EEecccceeeeeeeeccCCch
Confidence 777777777777777766653322 334445555555554444333
|
|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF11938 DUF3456: TLR4 regulator and MIR-interacting MSAP; InterPro: IPR021852 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF14843 GF_recep_IV: Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PTZ00214 high cysteine membrane protein Group 4; Provisional | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) | Back alignment and domain information |
|---|
| >PTZ00214 high cysteine membrane protein Group 4; Provisional | Back alignment and domain information |
|---|
| >PF14843 GF_recep_IV: Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >cd00064 FU Furin-like repeats | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >smart00261 FU Furin-like repeats | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG4052|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00261 FU Furin-like repeats | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd00064 FU Furin-like repeats | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF00594 Gla: Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain; InterPro: IPR000294 The GLA (gamma-carboxyglutamic acid-rich) domain contains glutamate residues that have been post-translationally modified by vitamin K-dependent carboxylation to form gamma-carboxyglutamate (Gla) [, , ] | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00069 GLA Domain containing Gla (gamma-carboxyglutamate) residues | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
| >cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains | Back alignment and domain information |
|---|
| >cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 329 | |||
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 3e-10 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 2e-07 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 3e-07 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 5e-05 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 7e-07 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 1e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 8e-07 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 1e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 7e-06 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 9e-06 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 9e-06 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 4e-05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 3e-05 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 4e-05 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 8e-05 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 5e-05 | |
| 1igr_A | 478 | Insulin-like growth factor receptor 1; hormone rec | 7e-05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 8e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-04 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 1e-04 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-04 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-04 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 5e-04 | |
| 1mox_A | 501 | Epidermal growth factor receptor; EGFR, receptor, | 3e-04 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 4e-04 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 7e-04 |
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
Score = 56.2 bits (136), Expect = 3e-10
Identities = 21/84 (25%), Positives = 30/84 (35%), Gaps = 4/84 (4%)
Query: 143 ECNTGYFQSYKDEKTILCSKCHASCESGCSTGGPKGCTKCKSGWAADKDIGCYDINECSD 202
C G+ + +C + C C C G+ D C DI+EC +
Sbjct: 27 VCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTQASCE-CPEGYILDDGFICTDIDECEN 85
Query: 203 ENICSGNQFCVNTEGSYRCMQCDP 226
CS C N G++ C C P
Sbjct: 86 GGFCS--GVCHNLPGTFEC-ICGP 106
|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Length = 501 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.41 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.39 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.33 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.31 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.29 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.23 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.22 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.2 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.19 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.13 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.11 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.09 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.07 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.97 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.95 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.92 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.87 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.86 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.83 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.82 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.82 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.79 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.73 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.67 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.61 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.61 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.6 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.54 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.51 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.51 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.4 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.38 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.35 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.27 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 98.24 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.23 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.23 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.22 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.18 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.15 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.14 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.13 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.08 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.04 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.02 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.98 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 97.89 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.88 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.82 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.81 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.78 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.77 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.72 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.69 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.67 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.65 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.65 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.6 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 97.53 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.46 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.44 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 97.44 | |
| 1nl0_G | 51 | Factor IX; immune system, antibody, GLA domain; HE | 97.36 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.3 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.3 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.27 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.27 | |
| 3i2t_A | 551 | Epidermal growth factor receptor, isoform A; EGFR, | 97.27 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.25 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 97.22 | |
| 1j34_C | 46 | Coagulation factor IX; magnesium ION, calcium ION, | 97.2 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.13 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.13 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.09 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 97.07 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 97.02 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.95 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 96.94 | |
| 1lqv_C | 33 | Vitamin-K dependent protein C; GLA (gamma-carboxyg | 96.92 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.91 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 96.91 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 96.85 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.82 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 96.77 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 96.77 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 96.7 | |
| 1mox_A | 501 | Epidermal growth factor receptor; EGFR, receptor, | 96.69 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.67 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.63 | |
| 3i2t_A | 551 | Epidermal growth factor receptor, isoform A; EGFR, | 96.63 | |
| 1mox_A | 501 | Epidermal growth factor receptor; EGFR, receptor, | 96.62 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.59 | |
| 1n8y_C | 608 | Protooncoprotein; tyrosin kinase receptor, cell su | 96.59 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 96.57 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 96.46 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.44 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.41 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 96.41 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 96.38 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 96.37 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.25 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 96.19 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.18 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 96.16 | |
| 1nl1_A | 147 | Prothrombin; hydrolase; HET: CGU NAG; 1.90A {Bos t | 96.01 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 95.96 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 95.92 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 95.86 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.78 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 95.78 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 95.76 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 95.67 | |
| 1n8y_C | 608 | Protooncoprotein; tyrosin kinase receptor, cell su | 95.67 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 95.31 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 94.64 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 94.54 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 94.11 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 94.07 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 94.01 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 93.84 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 93.65 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 93.5 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 93.4 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 93.16 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 92.99 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 92.72 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 92.18 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 92.1 | |
| 3urf_Z | 171 | Tumor necrosis factor receptor superfamily member; | 91.82 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 90.35 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 90.1 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 89.74 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 89.73 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 89.68 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 89.58 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 89.52 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 89.18 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 88.12 | |
| 3k51_B | 176 | Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, | 87.67 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 87.55 | |
| 3p0y_A | 214 | Epidermal growth factor receptor; beta-sandwich, a | 87.15 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 87.04 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 86.64 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 85.09 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 85.02 | |
| 1ext_A | 162 | Tumor necrosis factor receptor; binding protein, c | 84.54 | |
| 1jma_B | 167 | Herpesvirus entry mediator; V-type IG molecule and | 84.52 | |
| 3qd6_R | 177 | CD40L receptor, tumor necrosis factor receptor sup | 84.0 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 83.9 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 83.7 | |
| 1sg1_X | 161 | Tumor necrosis factor receptor superfamily member | 83.15 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 82.96 | |
| 3me4_A | 216 | Tumor necrosis factor receptor superfamily member; | 82.85 | |
| 3u3p_A | 313 | Tumor necrosis factor receptor superfamily member; | 82.09 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 81.79 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 80.96 | |
| 2hey_R | 146 | Tumor necrosis factor receptor superfamily member; | 80.95 | |
| 3k51_B | 176 | Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, | 80.04 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
Probab=99.41 E-value=2.1e-13 Score=110.54 Aligned_cols=115 Identities=27% Similarity=0.675 Sum_probs=87.3
Q ss_pred cCCCCCCCCCCCCcccCCCCCCCCceeecCCCCCCCCCC----cCCCCccccccCcCCCCCcCCcccccCCcc-cCCCCC
Q psy826 104 PCLGFPNVCFGNGKCKGNGTRKGNGQCVCNKEYTGELCN----ECNTGYFQSYKDEKTILCSKCHASCESGCS-TGGPKG 178 (329)
Q Consensus 104 ~C~~~~~~C~~~~~C~~~~~~~gs~~C~C~~G~~g~~C~----~C~~g~y~~~~~~~~~~C~~C~~~C~~~C~-~~~~~~ 178 (329)
+|....++|.++++|++ +.++|+|.|++||+|..|+ +|.. .+|... ++|. ..+++.
T Consensus 7 eC~~~~~~C~~~g~C~~---~~g~~~C~C~~Gy~G~~C~~~~~~C~~--------------~~C~~~--~~C~~~~g~~~ 67 (135)
T 2vj3_A 7 ECSLGANPCEHAGKCIN---TLGSFECQCLQGYTGPRCEIDVNECVS--------------NPCQND--ATCLDQIGEFQ 67 (135)
T ss_dssp TTTSSSCSSSTTCEEEE---CSSSEEEECCTTEESTTSCEECCTTTT--------------CCCCSS--CEEEECSSCEE
T ss_pred cccCCCCCCCCCCEeEC---CCCCEEEECCCCCcCCcccccCccCCC--------------CCCCCC--CEEeCCCCCce
Confidence 56555678999999998 7889999999999999884 2322 245544 5676 677899
Q ss_pred CccCCCCceecCCCCcc-cCCCCCCCCCCCCCceeecCCCCcccCCCcCCCCCCcCCcccccccCcccccccCCccc-cc
Q psy826 179 CTKCKSGWAADKDIGCY-DINECSDENICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGPDMCEACAEGYKLQQNICI-NT 256 (329)
Q Consensus 179 C~~C~~G~~~~~~~~C~-d~~eC~~~~~C~~~~~C~n~~gs~~C~~C~~~C~~C~g~~~~~C~~C~~Gy~~~~~~C~-~~ 256 (329)
| .|++||.|.. |. ++++|.. .+|..++.|+++.++|+|. |++||.+. .|. ++
T Consensus 68 C-~C~~G~~G~~---C~~~~~~C~~-~~C~~~g~C~~~~g~~~C~-------------------C~~G~~G~--~C~~~i 121 (135)
T 2vj3_A 68 C-ICMPGYEGVH---CEVNTDECAS-SPCLHNGRCLDKINEFQCE-------------------CPTGFTGH--LCQVDL 121 (135)
T ss_dssp E-ECCTTEESSS---SCEECCTTTT-CCSTTTCEEEECSSCEEEE-------------------CCTTEESS--SSCEEC
T ss_pred e-eCCCCCcCCc---ceecCCcccC-CCcCCCCEeECCCCCeEEE-------------------CCCCCcCC--ccCccC
Confidence 9 9999999753 64 7889986 6898889999999999999 99999875 674 67
Q ss_pred CcCCCCc
Q psy826 257 QAKSQNT 263 (329)
Q Consensus 257 ~~~~~~~ 263 (329)
+++...+
T Consensus 122 ~~C~~~~ 128 (135)
T 2vj3_A 122 HHILDAQ 128 (135)
T ss_dssp C------
T ss_pred ccccCCC
Confidence 7776543
|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* | Back alignment and structure |
|---|
| >1nl0_G Factor IX; immune system, antibody, GLA domain; HET: CGU; 2.20A {Homo sapiens} SCOP: g.32.1.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1j34_C Coagulation factor IX; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Bos taurus} SCOP: g.32.1.1 PDB: 1j35_C* 1cfh_A 1cfi_A* 1mgx_A 1iod_G* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1lqv_C Vitamin-K dependent protein C; GLA (gamma-carboxyglutamic acid) residues, phospholipid BIND groove, Ca ION binding, blood clotting; HET: CGU NAG NDG PTY; 1.60A {Homo sapiens} SCOP: g.32.1.1 PDB: 3jtc_C* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* | Back alignment and structure |
|---|
| >1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A | Back alignment and structure |
|---|
| >1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nl1_A Prothrombin; hydrolase; HET: CGU NAG; 1.90A {Bos taurus} SCOP: g.14.1.1 g.32.1.1 PDB: 2pf2_A* 2pf1_A* 1nl2_A* 2spt_A* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3urf_Z Tumor necrosis factor receptor superfamily member; cystein-rich domain, beta-sandwich, cytokine; HET: NAG; 2.70A {Homo sapiens} PDB: 4e4d_R | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3k51_B Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, cytokine, D bond, glycoprotein, membrane, secreted, signal-anchor, transmembrane, apoptosis; 2.45A {Homo sapiens} PDB: 3mi8_D 3mhd_D | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3p0y_A Epidermal growth factor receptor; beta-sandwich, antigens EGFR, immune system; HET: NAG FUL; 1.80A {Homo sapiens} PDB: 3b2u_A* 3c09_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ext_A Tumor necrosis factor receptor; binding protein, cytokine, signalling protein; 1.85A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1ft4_A* 1ncf_A 1tnr_R | Back alignment and structure |
|---|
| >1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B* | Back alignment and structure |
|---|
| >3qd6_R CD40L receptor, tumor necrosis factor receptor superfamily member; immune regulator, cytokine-cytokine receptor compl; HET: NAG; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} | Back alignment and structure |
|---|
| >1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3me4_A Tumor necrosis factor receptor superfamily member; RANK, rankl, rankl-RANK complex, tnfsf11, tnfrsf11A, TNF SUP signaling protein; 2.01A {Mus musculus} PDB: 3me2_R 3qbq_B 4giq_R* 3nzy_B | Back alignment and structure |
|---|
| >3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R | Back alignment and structure |
|---|
| >3k51_B Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, cytokine, D bond, glycoprotein, membrane, secreted, signal-anchor, transmembrane, apoptosis; 2.45A {Homo sapiens} PDB: 3mi8_D 3mhd_D | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 329 | ||||
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 1e-04 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 4e-04 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 5e-04 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 5e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 7e-04 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 0.002 |
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 36.7 bits (85), Expect = 1e-04
Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 4/43 (9%)
Query: 196 DINECSDENICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGPDM 238
DI+EC G CVNT G + C +CD G M
Sbjct: 2 DIDECRISPDLCGRGQCVNTPGDFEC-KCDE---GYESGFMMM 40
|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 329 | |||
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.05 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.98 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.94 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.93 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.9 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.83 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.83 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.82 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.67 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.65 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.65 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.61 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.6 | |
| d1iodg_ | 44 | Coagulation factor X {Cow (Bos taurus) [TaxId: 991 | 97.57 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.54 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.52 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.52 | |
| d1p0sl2 | 47 | Coagulation factor X {Human (Homo sapiens) [TaxId: | 97.46 | |
| d1n8yc4 | 120 | Protooncoprotein Her2 extracellular domain {Rat (R | 97.45 | |
| d1nqla4 | 134 | EGF receptor Cys-rich domains {Human (Homo sapiens | 97.36 | |
| d1m6ba4 | 101 | Receptor protein-tyrosine kinase Erbb-3 Cys-rich d | 97.33 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.32 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.31 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.28 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.18 | |
| d1nl1a2 | 65 | Prothrombin {Cow (Bos taurus) [TaxId: 9913]} | 97.17 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.14 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.1 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.08 | |
| d1s78a4 | 76 | Protooncoprotein Her2 extracellular domain {Human | 97.07 | |
| d1j34c_ | 46 | Coagulation factor IX (IXa) {Human (Homo sapiens) | 97.02 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.0 | |
| d1lqvc_ | 33 | Coagulation factor XIV (Protein C) {Human (Homo sa | 96.95 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 96.87 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.85 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 96.75 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 96.7 | |
| d2c4fl3 | 40 | Coagulation factor IX (IXa) {Pig (Sus scrofa) [Tax | 96.63 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.52 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.52 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.41 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 96.36 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.28 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.27 | |
| d1nqla4 | 134 | EGF receptor Cys-rich domains {Human (Homo sapiens | 96.24 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.19 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.17 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 96.14 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.14 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.04 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.03 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 95.54 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 95.47 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 95.45 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.42 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 95.32 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.31 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 95.08 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 95.07 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 95.06 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 95.01 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 94.97 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 94.85 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 94.84 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 94.53 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 94.49 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 94.26 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 94.21 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 94.18 | |
| d1n8yc4 | 120 | Protooncoprotein Her2 extracellular domain {Rat (R | 93.68 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 93.63 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 93.51 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.24 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 92.85 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 92.79 | |
| d3b2ua2 | 26 | EGF receptor Cys-rich domains {Human (Homo sapiens | 92.68 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 92.03 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 91.97 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 91.95 | |
| d1m6ba3 | 145 | Receptor protein-tyrosine kinase Erbb-3 Cys-rich d | 91.72 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.58 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 91.37 | |
| d2dtge6 | 155 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 91.21 | |
| d1s78a4 | 76 | Protooncoprotein Her2 extracellular domain {Human | 90.95 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 90.67 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 90.58 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 90.36 | |
| d1moxa3 | 149 | EGF receptor Cys-rich domains {Human (Homo sapiens | 89.99 | |
| d2dtge6 | 155 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 89.66 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 89.62 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 89.08 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 88.9 | |
| d1m6ba4 | 101 | Receptor protein-tyrosine kinase Erbb-3 Cys-rich d | 88.2 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 87.21 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 86.9 | |
| d1m6ba3 | 145 | Receptor protein-tyrosine kinase Erbb-3 Cys-rich d | 84.32 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 82.39 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 82.07 |
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.64 E-value=8.7e-09 Score=64.23 Aligned_cols=43 Identities=40% Similarity=0.889 Sum_probs=36.4
Q ss_pred CcccCCCCCCCCCCCCCceeecCCCCcccCCCcCCCCCCcCCcccccccCcccccccCCcccc
Q psy826 193 GCYDINECSDENICSGNQFCVNTEGSYRCMQCDPSCNGCHGDGPDMCEACAEGYKLQQNICIN 255 (329)
Q Consensus 193 ~C~d~~eC~~~~~C~~~~~C~n~~gs~~C~~C~~~C~~C~g~~~~~C~~C~~Gy~~~~~~C~~ 255 (329)
.|+|||||+.. .+..++.|+|++|+|.|. |++||.+++..|+|
T Consensus 1 sCvDidEC~~~-~~~~~~~C~Nt~Gsy~C~-------------------C~~Gy~~~g~~C~D 43 (43)
T d1emoa1 1 SAVDMDECKEP-DVCKHGQCINTDGSYRCE-------------------CPFGYILAGNECVD 43 (43)
T ss_dssp CCCCCCSSSST-TSCSSSCCCCCSSCCCCC-------------------CCTTEEESSSCEEE
T ss_pred CCcceeccCCc-CCCCCCEeECCCCCeEeE-------------------CCCCcccCCCcccC
Confidence 38999999875 333478899999999999 99999998888875
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iodg_ g.32.1.1 (G:) Coagulation factor X {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p0sl2 g.32.1.1 (L:3-49) Coagulation factor X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nl1a2 g.32.1.1 (A:1-65) Prothrombin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j34c_ g.32.1.1 (C:) Coagulation factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lqvc_ g.32.1.1 (C:) Coagulation factor XIV (Protein C) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl3 g.32.1.1 (L:5-44) Coagulation factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|