Psyllid ID: psy8270

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------
MSEDGPLGVKPVFAAEQASPLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKMAEMEEEKHEKEILKKQISVERSGGGL
cccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEcccccccEEEEEEcccccEEEEEEEccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccccccccEEEEcccccEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccEEEcHHHHHHHcccccccccccEEEEEcccccHHHHHHHHHHHHHHcccEEccccEEEEEEEcccccEEEEEEEEcccccEEEEEEcEEEEcccccHHHHccccccccccEEEEccccEEEEccccccccEEEEEcccccccEEEEEEccccEEEEcccccccccccccccHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccccccEEEEEEEEcccccEEcccHHHHHHHccccccHHHHHHHHHHHHcccccEEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccc
cccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHcccEEEEEEcHHccccccccccEEEccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccHHHHHHccEEEEcccccEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEccHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccccEEEEEEEEEcccccEEEEEEEEEEEcccccHHHHHHccccccccEEEEcccEEEEEcccccccccEEEccccccccEEEEEEccccEEEEcccccccccccccccHHHHHHHHHHHHHHcccccEEEcccHHHHHHcccccccccccccccHHEEEHHHHccccccEEcHHHHHHHHHHccccccHHHHHHHHHcccccccccEEHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHccccccEccccccc
msedgplgvkpvfaaeqasplrakrplppredqikslqsgeefdvliigggatgsgcaLDAVTRGLKTALVElddfasgtssrstklIHGGVRYLQKAIMNLDIEQYRMVKEALHERsirrgdvlsawsgirplvsdpnkagdtqsiarnhivhvspsnlvtiaggkwtTYRAMASESIDALIEGkfnkagaeypnLLLGIIFNLVtiaggkwtTYRAMASESIDALIEAVpelkpkyrdcqtdglliegahgwtpTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLtgkrwpiigkkihpefpyidaEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELkwskeeqeipyywvgikaydfvagsktvkSSYYLSKKNALELFPMIRGDKLCGAIVyydgqqddARMCLAIALTATrhgatvanHVRVTnlikddkgkvrgahlrdeltgkewDLKAKSVInatgpftdsirrmddgqvqkicvpssgvhivlpgyyspdqmglldpstsdgrvifflpwlkhtiagttdlpcdvthhpkpteDEIMFILQEKQLKEASDFLANEMGQMVNrasrdkipinLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLknfgetisgEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKMAEMEEEKHEKEILKKQISVERSGGGL
msedgplgvkpvfaaeqasplrakrplppREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELddfasgtssrstklihggVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARnhivhvspsnlvtiagGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLtgkrwpiigkkihpefpyiDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTAtrhgatvanhvrvtnlikddkgkvrgahlrdeltgkewdlkaksvinatgpftdsirRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNrasrdkipinltKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKMAEMEEEKHekeilkkqisversgggl
MSEDGPLGVKPVFAAEQASPLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFakmaemeeekhekeilkkQISVERSGGGL
*****************************************EFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLV**********SIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSK*****AQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQL*****FL**************KIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRF*****************************
**********************************KSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPN************IVHVSPSNLVTIAGGKWTTYRAMASESIDA***********EYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDD******CVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRAS**********************MDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKM*****************SVERSGG**
MSEDGPLGVKPVFAAEQASPLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKMA**********ILKKQIS********
*******GVK*****EQASPLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKMAEMEEEKHEKEILKKQISV*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDGPLGVKPVFAAEQASPLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAIMNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESIDALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMYIRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMGQMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSRFAKxxxxxxxxxxxxxxxxxxxxxRSGGGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query737 2.2.26 [Sep-21-2011]
Q64521 727 Glycerol-3-phosphate dehy yes N/A 0.366 0.371 0.553 2e-81
P43304 727 Glycerol-3-phosphate dehy yes N/A 0.366 0.371 0.557 3e-81
P35571 727 Glycerol-3-phosphate dehy yes N/A 0.293 0.297 0.644 2e-80
P90795 722 Probable glycerol-3-phosp yes N/A 0.278 0.283 0.669 4e-80
A6QLU1 727 Glycerol-3-phosphate dehy yes N/A 0.366 0.371 0.538 5e-80
A7DZP8 727 Glycerol-3-phosphate dehy N/A N/A 0.366 0.371 0.535 1e-77
Q4R755 727 Glycerol-3-phosphate dehy N/A N/A 0.366 0.371 0.545 1e-74
Q8SR40 614 Probable glycerol-3-phosp yes N/A 0.278 0.333 0.480 3e-56
Q9SS48 629 Glycerol-3-phosphate dehy yes N/A 0.341 0.400 0.455 1e-53
O14400 649 Glycerol-3-phosphate dehy yes N/A 0.347 0.394 0.418 3e-53
>sp|Q64521|GPDM_MOUSE Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus GN=Gpd2 PE=1 SV=2 Back     alignment and function desciption
 Score =  304 bits (778), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 194/280 (69%), Gaps = 10/280 (3%)

Query: 378 IEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLC 437
           + IM    KW     ++PYYWVGIK YD VAGS+ +KSSY LSK  ALE FPM++ DKL 
Sbjct: 158 LPIMLPLYKW----WQLPYYWVGIKMYDLVAGSQCLKSSYVLSKSRALEHFPMLQKDKLV 213

Query: 438 GAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDD-----KGKVRGAHLRDE 492
           GAIVYYDGQ +DARM LAIALTA R+GA  AN++ V +L+K       K +V GA  +D 
Sbjct: 214 GAIVYYDGQHNDARMNLAIALTAARYGAATANYMEVVSLLKKTDPETGKERVSGARCKDV 273

Query: 493 LTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDP 552
           LTG+E+D++AK VINA+GPFTDS+R+MDD  V  IC PS+GVHIV+PGYYSP+ MGLLDP
Sbjct: 274 LTGQEFDVRAKCVINASGPFTDSVRKMDDKNVVPICQPSAGVHIVMPGYYSPENMGLLDP 333

Query: 553 STSDGRVIFFLPWLKHTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFLANEMG 612
           +TSDGRVIFFLPW K TIAGTTD P DVTHHP P+E++I FIL E +   +SD      G
Sbjct: 334 ATSDGRVIFFLPWEKMTIAGTTDTPTDVTHHPIPSEEDINFILNEVRNYLSSDVEVRR-G 392

Query: 613 QMVNRASRDKIPINLTKEEINQYIKRFQIMDKERKGYVSI 652
            ++   S  +  +   K    Q I R  ++D    G ++I
Sbjct: 393 DVLAAWSGIRPLVTDPKSADTQSISRNHVVDISDSGLITI 432

Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: .EC: 5EC: .EC: 3
>sp|P43304|GPDM_HUMAN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens GN=GPD2 PE=1 SV=3 Back     alignment and function description
>sp|P35571|GPDM_RAT Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Gpd2 PE=1 SV=1 Back     alignment and function description
>sp|P90795|GPDM_CAEEL Probable glycerol-3-phosphate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=T25G3.4 PE=3 SV=2 Back     alignment and function description
>sp|A6QLU1|GPDM_BOVIN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Bos taurus GN=GPD2 PE=2 SV=1 Back     alignment and function description
>sp|A7DZP8|GPDM_MESAU Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=GPD2 PE=1 SV=1 Back     alignment and function description
>sp|Q4R755|GPDM_MACFA Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=GPD2 PE=2 SV=1 Back     alignment and function description
>sp|Q8SR40|GPDH_ENCCU Probable glycerol-3-phosphate dehydrogenase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0870 PE=3 SV=1 Back     alignment and function description
>sp|Q9SS48|SDP6_ARATH Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial OS=Arabidopsis thaliana GN=SDP6 PE=1 SV=1 Back     alignment and function description
>sp|O14400|GPDM_SCHPO Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gut2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query737
193580091720 PREDICTED: glycerol-3-phosphate dehydrog 0.351 0.359 0.658 3e-98
328709680689 PREDICTED: glycerol-3-phosphate dehydrog 0.351 0.375 0.658 5e-98
322795617720 hypothetical protein SINV_01752 [Solenop 0.351 0.359 0.663 9e-98
156540304719 PREDICTED: glycerol-3-phosphate dehydrog 0.278 0.285 0.789 1e-96
345493147682 PREDICTED: glycerol-3-phosphate dehydrog 0.278 0.300 0.789 2e-96
383851502745 PREDICTED: glycerol-3-phosphate dehydrog 0.345 0.342 0.650 5e-96
91083661726 PREDICTED: similar to GA20935-PA isoform 0.351 0.356 0.652 2e-95
270007868760 hypothetical protein TcasGA2_TC014609 [T 0.351 0.340 0.652 3e-95
380020472753 PREDICTED: glycerol-3-phosphate dehydrog 0.351 0.343 0.637 4e-95
290561573721 glycerol-3-phosphate dehydrogenase isofo 0.294 0.300 0.721 3e-94
>gi|193580091|ref|XP_001944658.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 1 [Acyrthosiphon pisum] gi|328709673|ref|XP_003244033.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] gi|328709675|ref|XP_003244034.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 3 [Acyrthosiphon pisum] gi|328709677|ref|XP_003244035.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  365 bits (938), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 179/272 (65%), Positives = 211/272 (77%), Gaps = 13/272 (4%)

Query: 332 ARRLRLAFLNVQAAQEALPMIIEIMAEELKWSKE---EQEAAQKALPMI---IEIMAEEL 385
           +R  +L    V+  Q+A   I+ +  E+ K  KE   E+    K  P +   I IM    
Sbjct: 105 SRSTKLIHGGVRYLQKA---ILNLDLEQYKMVKEALHERATMLKTAPHLTHAIPIMLPVY 161

Query: 386 KWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDG 445
           +W K    +PYYWVGIKAYD VAGSKTVKSSYYL+K  ALE+FPM++ DKL GAIVY+DG
Sbjct: 162 EWWK----VPYYWVGIKAYDLVAGSKTVKSSYYLTKTEALEIFPMLKKDKLVGAIVYHDG 217

Query: 446 QQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSV 505
           QQDDARMCLA+ALTATR+GATVANHV+  ++IKDDKGK+ GAHLRDELTGKEWD+KAK V
Sbjct: 218 QQDDARMCLALALTATRYGATVANHVKAVHIIKDDKGKICGAHLRDELTGKEWDVKAKCV 277

Query: 506 INATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPW 565
           INA GPFTDS+R+MDD  V++IC PS GVHIVLPGYYSP+QMGLLDP TSDGRVIFFLPW
Sbjct: 278 INAAGPFTDSVRKMDDSNVKEICTPSKGVHIVLPGYYSPEQMGLLDPETSDGRVIFFLPW 337

Query: 566 LKHTIAGTTDLPCDVTHHPKPTEDEIMFILQE 597
            KHT++GTTD PC VT++P PTEDEI FIL E
Sbjct: 338 QKHTLSGTTDSPCAVTYNPTPTEDEISFILNE 369

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328709680|ref|XP_003244036.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 5 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322795617|gb|EFZ18296.1| hypothetical protein SINV_01752 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|156540304|ref|XP_001599125.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345493147|ref|XP_003427011.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383851502|ref|XP_003701271.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91083661|ref|XP_975782.1| PREDICTED: similar to GA20935-PA isoform 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007868|gb|EFA04316.1| hypothetical protein TcasGA2_TC014609 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380020472|ref|XP_003694107.1| PREDICTED: glycerol-3-phosphate dehydrogenase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|290561573|ref|NP_001166822.1| glycerol-3-phosphate dehydrogenase isoform 2 [Bombyx mori] gi|259129669|gb|ACV95334.1| glycerol-3-phosphate dehydrogenase [Bombyx mori] gi|259129671|gb|ACV95335.1| glycerol-3-phosphate dehydrogenase [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query737
FB|FBgn0022160 724 Gpo-1 "Glycerophosphate oxidas 0.344 0.350 0.617 7.2e-176
ZFIN|ZDB-GENE-030131-4869 729 gpd2 "glycerol-3-phosphate deh 0.348 0.352 0.566 6.4e-134
WB|WBGene00012031 722 T25G3.4 [Caenorhabditis elegan 0.351 0.358 0.555 3.4e-111
UNIPROTKB|A6QLU1 727 GPD2 "Glycerol-3-phosphate deh 0.424 0.430 0.496 1.4e-112
UNIPROTKB|P43304 727 GPD2 "Glycerol-3-phosphate deh 0.424 0.430 0.512 2.9e-114
MGI|MGI:99778 727 Gpd2 "glycerol phosphate dehyd 0.424 0.430 0.506 3.4e-113
UNIPROTKB|E2RAZ8 722 GPD2 "Uncharacterized protein" 0.415 0.423 0.463 1.1e-99
UNIPROTKB|F1RPU0 729 MGPD "Uncharacterized protein" 0.424 0.429 0.503 7.9e-112
RGD|2726 727 Gpd2 "glycerol-3-phosphate deh 0.366 0.371 0.553 7.9e-112
UNIPROTKB|F1M9W2 727 Gpd2 "Glycerol-3-phosphate deh 0.366 0.371 0.553 5.9e-101
FB|FBgn0022160 Gpo-1 "Glycerophosphate oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 843 (301.8 bits), Expect = 7.2e-176, Sum P(3) = 7.2e-176
 Identities = 166/269 (61%), Positives = 199/269 (73%)

Query:   333 RRLRLAFLNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQ 392
             R L+ A L +   Q    M+ E +AE     +         LP+++ +      W     
Sbjct:   114 RYLQKAILGLDLEQYR--MVKEALAERATMLESAPHLTHP-LPIMLPVYT----W----W 162

Query:   393 EIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARM 452
             ++PYYWVGIKAYD VAG + VKSSYYLSKK+ALELFPM++ DKLCGAIVYYDGQQDDARM
Sbjct:   163 QVPYYWVGIKAYDLVAGDRNVKSSYYLSKKDALELFPMLKKDKLCGAIVYYDGQQDDARM 222

Query:   453 CLAIALTATRHGATVANHVRVTNLIKDDKGKVR----GAHLRDELTGKEWDLKAKSVINA 508
             CLA+ALTA RHGATV NHV V  L+K D G  +    GA ++D ++GKE+ +KAK ++NA
Sbjct:   223 CLAVALTAARHGATVCNHVEVKELLKKDDGTGKQVLCGAKVKDHISGKEFTVKAKCIVNA 282

Query:   509 TGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKH 568
              GPFTDSIR+MD+  V+ IC PSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPW + 
Sbjct:   283 AGPFTDSIRKMDNPTVKSICCPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWQRQ 342

Query:   569 TIAGTTDLPCDVTHHPKPTEDEIMFILQE 597
             TIAGTTDLPC++TH+P PTEDEI FIL E
Sbjct:   343 TIAGTTDLPCEITHNPTPTEDEIQFILNE 371
GO:0005743 "mitochondrial inner membrane" evidence=IDA
GO:0005739 "mitochondrion" evidence=IC;ISS;IDA
GO:0007629 "flight behavior" evidence=IMP
GO:0006127 "glycerophosphate shuttle" evidence=IMP
GO:0004368 "glycerol-3-phosphate dehydrogenase activity" evidence=ISS;IMP
GO:0006071 "glycerol metabolic process" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0009331 "glycerol-3-phosphate dehydrogenase complex" evidence=IEA
GO:0006072 "glycerol-3-phosphate metabolic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-030131-4869 gpd2 "glycerol-3-phosphate dehydrogenase 2 (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00012031 T25G3.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLU1 GPD2 "Glycerol-3-phosphate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P43304 GPD2 "Glycerol-3-phosphate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99778 Gpd2 "glycerol phosphate dehydrogenase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAZ8 GPD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPU0 MGPD "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|2726 Gpd2 "glycerol-3-phosphate dehydrogenase 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9W2 Gpd2 "Glycerol-3-phosphate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.5.3LOW CONFIDENCE prediction!
3rd Layer1.1.50.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query737
PLN02464 627 PLN02464, PLN02464, glycerol-3-phosphate dehydroge 1e-87
PLN02464627 PLN02464, PLN02464, glycerol-3-phosphate dehydroge 6e-61
COG0578532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 1e-56
PLN02464627 PLN02464, PLN02464, glycerol-3-phosphate dehydroge 6e-40
COG0578532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 2e-30
COG0578532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 2e-30
PRK12266508 PRK12266, glpD, glycerol-3-phosphate dehydrogenase 2e-26
PRK13369502 PRK13369, PRK13369, glycerol-3-phosphate dehydroge 2e-23
PRK12266508 PRK12266, glpD, glycerol-3-phosphate dehydrogenase 6e-18
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-14
TIGR03377 516 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate d 1e-13
PRK11101546 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogen 2e-12
PRK13369502 PRK13369, PRK13369, glycerol-3-phosphate dehydroge 4e-12
PRK13369502 PRK13369, PRK13369, glycerol-3-phosphate dehydroge 5e-11
PRK12266508 PRK12266, glpD, glycerol-3-phosphate dehydrogenase 8e-11
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-10
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 3e-10
PRK11101 546 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogen 4e-10
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 8e-10
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-09
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 1e-09
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 2e-09
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 2e-06
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 4e-06
TIGR03377516 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate d 5e-06
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 5e-06
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 1e-05
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydroge 2e-05
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 2e-05
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 3e-05
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 3e-05
TIGR03377516 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate d 9e-05
PRK11101546 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogen 2e-04
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 3e-04
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 3e-04
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 3e-04
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 3e-04
COG3075421 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehy 4e-04
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate d 0.001
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 0.002
PRK07843557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrog 0.002
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 0.003
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 0.004
>gnl|CDD|215257 PLN02464, PLN02464, glycerol-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  287 bits (737), Expect = 1e-87
 Identities = 117/220 (53%), Positives = 150/220 (68%), Gaps = 10/220 (4%)

Query: 393 EIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMI---RGDK-LCGAIVYYDGQQD 448
           E+PYYW G+KAYD VAG + +  S Y S K +LELFP +     D  L G +VYYDGQ +
Sbjct: 171 EVPYYWAGLKAYDLVAGPRLLHLSRYYSAKESLELFPTLAKKGKDGSLKGTVVYYDGQMN 230

Query: 449 DARMCLAIALTATRHGATVANHVRVTNLIKDDK-GKVRGAHLRDELTGKEWDLKAKSVIN 507
           D+R+ +A+A TA   GA V N+  V +LIKD+  G++ GA +RD LTGKE+D+ AK V+N
Sbjct: 231 DSRLNVALACTAALAGAAVLNYAEVVSLIKDESTGRIVGARVRDNLTGKEFDVYAKVVVN 290

Query: 508 ATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLK 567
           A GPF D +R+M DG+ + +  PSSGVHIVLP YYSP+ MGL+ P T DGRV+F LPWL 
Sbjct: 291 AAGPFCDEVRKMADGKAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLG 350

Query: 568 HTIAGTTDLPCDVTHHPKPTEDEIMFILQEKQLKEASDFL 607
            T+AGTTD    +T  P+P EDEI FI     L   SD+L
Sbjct: 351 RTVAGTTDSKTPITMLPEPHEDEIQFI-----LDAISDYL 385

Length = 627
>gnl|CDD|215257 PLN02464, PLN02464, glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215257 PLN02464, PLN02464, glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237027 PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237365 PRK13369, PRK13369, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237027 PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|234191 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>gnl|CDD|236847 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237365 PRK13369, PRK13369, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237365 PRK13369, PRK13369, glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237027 PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|236847 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234191 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234191 TIGR03377, glycerol3P_GlpA, glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>gnl|CDD|236847 PRK11101, glpA, sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|225617 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213807 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|236111 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 737
KOG0042|consensus680 100.0
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 100.0
PLN02464 627 glycerol-3-phosphate dehydrogenase 100.0
KOG0042|consensus680 100.0
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.97
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.97
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.97
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.92
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.91
PRK11728393 hydroxyglutarate oxidase; Provisional 99.91
COG0579429 Predicted dehydrogenase [General function predicti 99.9
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.9
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.88
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.88
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.86
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.86
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.85
PLN02464627 glycerol-3-phosphate dehydrogenase 99.85
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.84
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.84
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.84
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.83
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.82
KOG2844|consensus 856 99.81
PRK05257494 malate:quinone oxidoreductase; Validated 99.79
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.78
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.78
KOG2853|consensus509 99.78
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 99.74
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.73
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.69
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.67
KOG2820|consensus399 99.65
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.63
KOG2665|consensus453 99.63
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.61
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.6
KOG0027|consensus151 99.57
KOG0028|consensus172 99.49
KOG4254|consensus561 99.44
PRK07121492 hypothetical protein; Validated 99.38
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.35
KOG0030|consensus152 99.34
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.31
PTZ00183158 centrin; Provisional 99.31
PTZ00184149 calmodulin; Provisional 99.28
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.27
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.27
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.27
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.26
PRK12842574 putative succinate dehydrogenase; Reviewed 99.25
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.25
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.24
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.22
KOG2852|consensus380 99.22
PRK12839572 hypothetical protein; Provisional 99.21
PRK06185407 hypothetical protein; Provisional 99.21
KOG0031|consensus171 99.21
PRK08274466 tricarballylate dehydrogenase; Validated 99.2
KOG3923|consensus342 99.18
KOG0027|consensus151 99.17
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.15
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.14
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.14
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.14
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.12
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.12
PRK07804 541 L-aspartate oxidase; Provisional 99.11
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.11
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.09
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.09
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.08
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.08
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.08
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.07
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.06
PRK08071510 L-aspartate oxidase; Provisional 99.04
PLN02815 594 L-aspartate oxidase 99.04
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.03
PRK06175433 L-aspartate oxidase; Provisional 99.02
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.02
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.02
KOG0036|consensus 463 99.02
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.02
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.0
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.99
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.99
KOG0028|consensus172 98.99
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.99
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.98
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.98
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.98
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.97
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.97
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.97
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.95
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.95
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.94
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.94
PRK07512513 L-aspartate oxidase; Provisional 98.94
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.93
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.93
PRK09077 536 L-aspartate oxidase; Provisional 98.93
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.93
PLN02697529 lycopene epsilon cyclase 98.93
PRK07395 553 L-aspartate oxidase; Provisional 98.92
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.91
PRK10157428 putative oxidoreductase FixC; Provisional 98.9
KOG0037|consensus221 98.9
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.9
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.9
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.89
PRK08275 554 putative oxidoreductase; Provisional 98.89
PRK07208479 hypothetical protein; Provisional 98.88
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.87
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.87
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.87
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.86
PRK08244 493 hypothetical protein; Provisional 98.86
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.86
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.85
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.85
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.85
PRK13977576 myosin-cross-reactive antigen; Provisional 98.84
PRK06184 502 hypothetical protein; Provisional 98.84
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.83
PRK10015429 oxidoreductase; Provisional 98.83
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.81
PRK06126 545 hypothetical protein; Provisional 98.79
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.78
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.77
COG2081408 Predicted flavoproteins [General function predicti 98.77
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.77
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.75
PRK06847375 hypothetical protein; Provisional 98.74
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.74
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.73
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.72
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.72
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.71
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.71
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.7
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.7
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.69
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.69
PRK06834 488 hypothetical protein; Provisional 98.69
PRK07233434 hypothetical protein; Provisional 98.68
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.68
PLN02661357 Putative thiazole synthesis 98.68
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.67
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.64
PRK08401466 L-aspartate oxidase; Provisional 98.64
KOG0037|consensus221 98.63
PRK08163396 salicylate hydroxylase; Provisional 98.63
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.63
KOG0031|consensus171 98.62
PTZ00184149 calmodulin; Provisional 98.62
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.62
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.61
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.6
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.6
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.59
PTZ00183158 centrin; Provisional 98.59
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.59
KOG0030|consensus152 98.59
PRK08013400 oxidoreductase; Provisional 98.59
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.58
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.57
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.57
PRK07190487 hypothetical protein; Provisional 98.56
PRK09126392 hypothetical protein; Provisional 98.56
cd0005267 EH Eps15 homology domain; found in proteins implic 98.55
PLN02612567 phytoene desaturase 98.55
PLN02463447 lycopene beta cyclase 98.55
KOG0041|consensus244 98.54
PRK07045388 putative monooxygenase; Reviewed 98.54
PLN02985514 squalene monooxygenase 98.54
PRK11445351 putative oxidoreductase; Provisional 98.53
PLN02964 644 phosphatidylserine decarboxylase 98.53
PRK07588391 hypothetical protein; Provisional 98.53
PRK02106560 choline dehydrogenase; Validated 98.53
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.52
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.51
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.49
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.49
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.47
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.46
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.43
KOG0034|consensus187 98.43
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.43
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.41
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.4
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.39
PF1465866 EF-hand_9: EF-hand domain 98.38
PLN02487569 zeta-carotene desaturase 98.37
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.36
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.36
KOG1298|consensus509 98.35
KOG0034|consensus187 98.35
KOG2404|consensus477 98.35
PRK07538413 hypothetical protein; Provisional 98.33
PRK06996398 hypothetical protein; Provisional 98.33
KOG0044|consensus193 98.32
PRK08294 634 phenol 2-monooxygenase; Provisional 98.31
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.26
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.26
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.25
COG2303542 BetA Choline dehydrogenase and related flavoprotei 98.25
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.24
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.23
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.22
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.2
KOG2415|consensus 621 98.19
PRK06753373 hypothetical protein; Provisional 98.17
PRK05868372 hypothetical protein; Validated 98.17
KOG0036|consensus 463 98.16
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.11
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.09
KOG0044|consensus193 98.09
PRK06475400 salicylate hydroxylase; Provisional 98.08
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.08
PLN02785587 Protein HOTHEAD 98.07
KOG1335|consensus506 97.97
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.96
COG3573552 Predicted oxidoreductase [General function predict 97.94
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.92
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.87
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.85
KOG0038|consensus189 97.85
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 97.84
KOG0029|consensus501 97.78
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.76
KOG0040|consensus2399 97.75
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.72
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.71
PLN02268435 probable polyamine oxidase 97.69
PLN02576496 protoporphyrinogen oxidase 97.68
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.65
PRK07236386 hypothetical protein; Provisional 97.65
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.63
PLN02964 644 phosphatidylserine decarboxylase 97.61
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.61
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.58
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.57
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.56
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.54
PRK06370463 mercuric reductase; Validated 97.54
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.51
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.5
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.49
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.48
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.48
KOG4223|consensus325 97.46
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.46
COG3349485 Uncharacterized conserved protein [Function unknow 97.46
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.44
PRK14694468 putative mercuric reductase; Provisional 97.43
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.42
PRK06116450 glutathione reductase; Validated 97.42
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.41
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.4
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.39
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.38
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.37
PLN02676487 polyamine oxidase 97.36
TIGR02053463 MerA mercuric reductase. This model represents the 97.36
PRK12416463 protoporphyrinogen oxidase; Provisional 97.35
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.34
KOG2614|consensus420 97.34
PTZ00367567 squalene epoxidase; Provisional 97.31
PTZ00058561 glutathione reductase; Provisional 97.31
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.31
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.3
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.3
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.29
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.28
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.26
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.25
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.23
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.21
PLN02568539 polyamine oxidase 97.21
PRK10262321 thioredoxin reductase; Provisional 97.19
KOG4223|consensus 325 97.18
PRK13748561 putative mercuric reductase; Provisional 97.16
KOG0046|consensus 627 97.15
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.13
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.13
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.12
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.07
KOG0377|consensus631 97.06
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.04
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.04
PLN02328808 lysine-specific histone demethylase 1 homolog 97.03
PLN02507499 glutathione reductase 97.02
PTZ00153659 lipoamide dehydrogenase; Provisional 96.99
PRK12831464 putative oxidoreductase; Provisional 96.99
PRK14727479 putative mercuric reductase; Provisional 96.96
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.94
KOG0377|consensus631 96.93
PTZ00052499 thioredoxin reductase; Provisional 96.93
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.93
PLN02546558 glutathione reductase 96.93
PRK09897534 hypothetical protein; Provisional 96.92
PLN02529738 lysine-specific histone demethylase 1 96.87
PRK12779944 putative bifunctional glutamate synthase subunit b 96.83
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.8
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 96.76
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.75
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.73
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 96.73
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.72
KOG1399|consensus448 96.71
KOG2643|consensus489 96.68
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.67
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.66
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.66
PRK098531019 putative selenate reductase subunit YgfK; Provisio 96.65
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.63
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.62
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.61
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.59
KOG4716|consensus503 96.59
KOG1276|consensus491 96.55
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.53
PRK12814652 putative NADPH-dependent glutamate synthase small 96.51
PLN03000881 amine oxidase 96.44
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 96.44
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.4
KOG0038|consensus189 96.39
PLN02852491 ferredoxin-NADP+ reductase 96.38
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 96.37
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.36
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.28
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.26
PRK07846451 mycothione reductase; Reviewed 96.25
PRK05976472 dihydrolipoamide dehydrogenase; Validated 96.22
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.21
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.17
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.16
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 96.13
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.1
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.06
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.05
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.04
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.04
PLN02976 1713 amine oxidase 96.02
PRK07845466 flavoprotein disulfide reductase; Reviewed 95.99
KOG0685|consensus498 95.99
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.97
TIGR02053463 MerA mercuric reductase. This model represents the 95.95
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 95.95
PRK065671028 putative bifunctional glutamate synthase subunit b 95.94
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 95.92
PRK06370463 mercuric reductase; Validated 95.89
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.86
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 95.78
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 95.71
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.68
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 95.67
PRK14989 847 nitrite reductase subunit NirD; Provisional 95.67
PRK13984604 putative oxidoreductase; Provisional 95.62
KOG2960|consensus328 95.43
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 95.3
PRK06116450 glutathione reductase; Validated 95.27
KOG2311|consensus679 95.21
PTZ00188506 adrenodoxin reductase; Provisional 95.17
KOG0169|consensus 746 95.12
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 95.0
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 94.98
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 94.86
KOG0405|consensus478 94.66
KOG4065|consensus144 94.58
KOG3855|consensus481 94.55
KOG1238|consensus623 94.35
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 94.35
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 94.32
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 94.27
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 94.26
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.16
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 94.07
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 93.91
PRK09564444 coenzyme A disulfide reductase; Reviewed 93.9
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 93.89
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 93.71
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.69
KOG0399|consensus2142 93.61
KOG4251|consensus 362 93.47
PRK13512438 coenzyme A disulfide reductase; Provisional 93.45
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.43
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.34
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.28
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 93.2
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 93.16
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.14
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 93.11
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 93.1
KOG2562|consensus493 92.98
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 92.95
KOG4251|consensus 362 92.87
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.78
KOG1955|consensus 737 92.77
KOG0751|consensus 694 92.54
KOG2643|consensus 489 92.33
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 92.32
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 92.04
cd0005267 EH Eps15 homology domain; found in proteins implic 91.88
COG4716587 Myosin-crossreactive antigen [Function unknown] 91.76
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 91.7
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 91.64
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 91.48
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.41
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 91.34
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.3
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 91.17
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.05
KOG1439|consensus440 90.94
KOG4405|consensus547 90.83
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.66
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.28
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.27
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.22
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.16
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.12
KOG1800|consensus468 90.09
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 89.8
KOG0041|consensus244 89.79
cd0503088 calgranulins Calgranulins: S-100 domain found in p 89.68
PRK06249313 2-dehydropantoate 2-reductase; Provisional 89.65
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.46
KOG0035|consensus890 89.39
COG4529474 Uncharacterized protein conserved in bacteria [Fun 89.29
KOG2562|consensus493 89.08
PRK15116268 sulfur acceptor protein CsdL; Provisional 89.01
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 89.0
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.93
PRK12921305 2-dehydropantoate 2-reductase; Provisional 88.91
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 88.82
PRK08229341 2-dehydropantoate 2-reductase; Provisional 88.66
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 88.55
PRK12309391 transaldolase/EF-hand domain-containing protein; P 88.49
KOG3555|consensus434 88.38
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 88.26
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.24
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.24
PRK07846451 mycothione reductase; Reviewed 88.12
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 88.07
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 87.91
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.89
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.84
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 87.8
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 87.77
KOG4578|consensus421 87.74
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 87.74
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 87.7
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 87.66
cd01483143 E1_enzyme_family Superfamily of activating enzymes 87.62
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 87.48
PRK06153393 hypothetical protein; Provisional 87.44
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 87.18
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 87.17
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 87.13
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 87.11
KOG1029|consensus 1118 86.88
PRK13512438 coenzyme A disulfide reductase; Provisional 86.85
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 86.69
PRK06718202 precorrin-2 dehydrogenase; Reviewed 86.53
PRK06292460 dihydrolipoamide dehydrogenase; Validated 86.43
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 86.25
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 86.21
PRK06719157 precorrin-2 dehydrogenase; Validated 86.2
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 86.07
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 85.81
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 85.71
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 85.66
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 85.65
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.64
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 85.63
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 85.55
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.43
PRK04148134 hypothetical protein; Provisional 85.32
PRK08328231 hypothetical protein; Provisional 85.31
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 85.29
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 85.26
PRK06327475 dihydrolipoamide dehydrogenase; Validated 85.21
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.06
PRK12770352 putative glutamate synthase subunit beta; Provisio 84.74
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 84.74
PRK12831464 putative oxidoreductase; Provisional 84.69
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 84.59
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 84.57
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 84.55
PRK10262321 thioredoxin reductase; Provisional 84.49
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 84.28
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 84.2
PRK13748561 putative mercuric reductase; Provisional 84.12
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 84.11
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 84.06
KOG2304|consensus298 84.02
>KOG0042|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.2e-53  Score=459.96  Aligned_cols=437  Identities=64%  Similarity=1.015  Sum_probs=380.2

Q ss_pred             ccccCCCCCCchHHHhhhccCCcccEEEECCChhHHHHHHHHHhcCCeEEEEeecCCCCCCCcCcccceechhHHHHHHh
Q psy8270          20 PLRAKRPLPPREDQIKSLQSGEEFDVLIIGGGATGSGCALDAVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKAI   99 (737)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~~~dvvIiG~G~~G~~~A~~La~~G~~V~vle~~~~~~g~s~~~~~~~~~~~~~~~~~~   99 (737)
                      ..+.++++|+|++.+.++....+|||+|||||++|.+||+.++.||+||++||+++|++|+||+|++++|+|+||+++++
T Consensus        45 ~~~~~~~~PsRe~~l~~l~~~~~fDVLIIGGGAtGaGcALDA~TRGLktaLVE~~DF~SGTSSkSTKLiHGGVRYLekAi  124 (680)
T KOG0042|consen   45 EGPSKASLPSREDLLEALKSTHEFDVLIIGGGATGAGCALDAATRGLKTALVEAGDFASGTSSKSTKLIHGGVRYLEKAI  124 (680)
T ss_pred             CCCCCCCCCCHHHHHHHhhcCCcccEEEECCCccCcceeehhhcccceeEEEecccccCCccccchhhhcccHHHHHHHH
Confidence            34567888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCHHHHHHHHHHhhhcCCCcCceeecccCccccccCCCCCCCccccccceeeeecCCCeeEeeCCcchhhHhhHHHHH
Q psy8270         100 MNLDIEQYRMVKEALHERSIRRGDVLSAWSGIRPLVSDPNKAGDTQSIARNHIVHVSPSNLVTIAGGKWTTYRAMASESI  179 (737)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  179 (737)
                      ++++.++++++++.+.|+.                                        .++                  
T Consensus       125 ~~lD~~qyrlV~eaL~ER~----------------------------------------~ll------------------  146 (680)
T KOG0042|consen  125 SNLDYEQYRLVKEALNERA----------------------------------------NLL------------------  146 (680)
T ss_pred             HhcCHHHHHHHHHHHHHHH----------------------------------------HHh------------------
Confidence            9999999999999997655                                        111                  


Q ss_pred             HHHHhhhccccCCCCcccccchhhceeeecCCccchhhhhhhhhHHHHHhhccccCCCCCCCccccccccCCCCCChhhH
Q psy8270         180 DALIEGKFNKAGAEYPNLLLGIIFNLVTIAGGKWTTYRAMASESIDALIEAVPELKPKYRDCQTDGLLIEGAHGWTPTMY  259 (737)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  259 (737)
                                                                                                      
T Consensus       147 --------------------------------------------------------------------------------  146 (680)
T KOG0042|consen  147 --------------------------------------------------------------------------------  146 (680)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHhhhcCCchhHHHHHHHhhcccHHHHHHHHHhhCCCCCcccccCCCCCcchHHHHHHHHHHhhhchhhHHHHHhhhhh
Q psy8270         260 IRLVQDFGLECETAQHLSNSYGDRAFAVAKLAQLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDMVARRLRLAF  339 (737)
Q Consensus       260 ~~~~~~~~~~~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~  339 (737)
                                 +.+.||.+                            +                                
T Consensus       147 -----------e~APhLs~----------------------------~--------------------------------  155 (680)
T KOG0042|consen  147 -----------EIAPHLSQ----------------------------P--------------------------------  155 (680)
T ss_pred             -----------hcCccccC----------------------------C--------------------------------
Confidence                       22222222                            1                                


Q ss_pred             hchHHHHhhHHHHHHHHHHhhcccHHHHHHHHhhhhHHHHHHHHhhcccccccccchhhhhHHHHHhhhccCCCCcceee
Q psy8270         340 LNVQAAQEALPMIIEIMAEELKWSKEEQEAAQKALPMIIEIMAEELKWSKEEQEIPYYWVGIKAYDFVAGSKTVKSSYYL  419 (737)
Q Consensus       340 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  419 (737)
                               ++    +|-....|                        |     .+||||+|+++|+++++.+...+++++
T Consensus       156 ---------lP----ImlPvy~w------------------------w-----QvpYyw~G~K~YD~vAG~k~Lk~S~~l  193 (680)
T KOG0042|consen  156 ---------LP----IMLPVYKW------------------------W-----QVPYYWVGLKIYDLVAGSKNLKSSYFL  193 (680)
T ss_pred             ---------cc----eeeehhhh------------------------h-----hhhheeecceeeeeeccccccccceee
Confidence                     00    22223445                        7     899999999999999999999999999


Q ss_pred             CHhhHHHHCCCCCcccceeEEEecceeEChHHHHHHHHHHHHHCCcEEecCceEEEEEEcCCCcEEEEEEeecccCeeEE
Q psy8270         420 SKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWD  499 (737)
Q Consensus       420 ~~~~~~~~~p~~~~~~~~g~~~~~~g~Vdp~~~v~al~~~A~~~Gve~~~nt~V~~L~~d~~~~V~gV~~~~~~tg~~~~  499 (737)
                      +++++.+.||.|..+.++|+++|+||+.|..+|+.+++.+|.++|+.+.++.+|.++..+++|++.|++++|..||+.+.
T Consensus       194 Sk~~alE~fPmL~~~~L~Ga~VYyDGQ~nDaRmnl~vAlTA~r~GA~v~Nh~ev~~Llkd~~~kv~Ga~~rD~iTG~e~~  273 (680)
T KOG0042|consen  194 SKKEALEIFPMLRKDNLKGAMVYYDGQHNDARMNLAVALTAARNGATVLNHVEVVSLLKDKDGKVIGARARDHITGKEYE  273 (680)
T ss_pred             cHHHHHHhCccccccCceeEEEEecCCCchHHHHHHHHHHHHhcchhhhhHHHHHHHhhCCCCceeeeEEEEeecCcEEE
Confidence            99999999999999999999999999999999999999999999999999999999999878899999999999999999


Q ss_pred             EEcCEEEecCCCChhhhhhhcCCCccccccccceEEEEecCCCCCCCceeeecCCCCCcEEEEeecCCeEeeecCCCCCC
Q psy8270         500 LKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPCD  579 (737)
Q Consensus       500 I~Ad~VV~a~Gaws~~L~~~lG~~lp~~i~p~KG~~lvv~~~~~~~~~~i~~~~~~Dgr~iy~~P~~g~~ivG~Tde~~~  579 (737)
                      |+|+.||||||++++.+.+|-....+..+.|.-|.|++++..+-+....++-|.+.|||++|+.||.|.+++|+|+.|..
T Consensus       274 I~Ak~VVNATGpfsDsIr~Mdd~~~~~i~~pSsGvHIVlP~yY~P~~mGlldP~TsDgRViFflPWqg~TIaGTTD~pt~  353 (680)
T KOG0042|consen  274 IRAKVVVNATGPFSDSIRKMDDEDAKPICVPSSGVHIVLPGYYCPENMGLLDPKTSDGRVIFFLPWQGKTIAGTTDIPTS  353 (680)
T ss_pred             EEEEEEEeCCCCccHHHHhhcccccCceeccCCceeEEcccccCCcccccccCCCCCCcEEEEeccCCceeeccCCCCCC
Confidence            99999999999999999999888888889999999999999888888889999999999999999999999999999987


Q ss_pred             CCCCCCCCHHHHHHHHHHh---------------------------ccc-------------------------------
Q psy8270         580 VTHHPKPTEDEIMFILQEK---------------------------QLK-------------------------------  601 (737)
Q Consensus       580 ~~~d~~pteeeI~~Lls~~---------------------------D~d-------------------------------  601 (737)
                      .+..+.|++++++++++++                           |++                               
T Consensus       354 v~~~P~PtE~dIqfIL~ev~~yl~~~~~VrR~DVlsaWsGiRPLv~DP~~~~~t~sl~R~H~v~~~~~gLiTIaGGKWTT  433 (680)
T KOG0042|consen  354 VTHSPTPTEDDIQFILKEVQHYLSFDVEVRREDVLSAWSGIRPLVRDPKKVKDTQSLVRNHFVFVSPSGLITIAGGKWTT  433 (680)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhhCCCcccchhhhHHHhhCCcccccCCCccccchhhhhhceEEecCCCeEEEecCcchh
Confidence            7889999999999999981                           000                               


Q ss_pred             --------------------------------------------------------------------------------
Q psy8270         602 --------------------------------------------------------------------------------  601 (737)
Q Consensus       602 --------------------------------------------------------------------------------  601 (737)
                                                                                                      
T Consensus       434 yR~MAEeTVd~aI~~~~lk~~~~~cvT~~l~l~Ga~~wt~~~~~~LvQdyg~e~~vA~hLs~tYG~rA~~Va~~~k~tgk  513 (680)
T KOG0042|consen  434 YRHMAEETVDAAIKAGDLKPARKPCVTKKLKLEGAEGWTPNMYIRLVQDYGMESDVAQHLSQTYGDRAFRVAKMAKSTGK  513 (680)
T ss_pred             HHHHHHHHHHHHHHhCCCCCCCCcccccceEEeccCCCcHHHHHHHHHHhCCcHHHHHHHHHhhcchHHHHHHHHHhcCC
Confidence                                                                                            


Q ss_pred             ------------------------------------------------hhhHHHHHHHHHHhhhhccccccCCCCHHHHH
Q psy8270         602 ------------------------------------------------EASDFLANEMGQMVNRASRDKIPINLTKEEIN  633 (737)
Q Consensus       602 ------------------------------------------------~f~eFL~~~~~~~~~~~~~~~i~~~ls~ee~~  633 (737)
                                                                      .-+.|+...|.......+...++..++++++.
T Consensus       514 k~Pivg~rl~~~fpyleAEv~y~v~~e~a~~~~Dv~arr~r~~~~q~~~ar~fl~~~mg~~~~~~~~~~~~i~~~~~~~~  593 (680)
T KOG0042|consen  514 KWPIVGKRLHPEFPYLEAEVRYGVVREYACTPVDVIARRLREKKKQIEYARTFLNSEMGLSKESTSQMSIPIKLTPEDFL  593 (680)
T ss_pred             cCccccccccCCCCchHHHHHhhhhHhhhccHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhccccccccccCHHHHH
Confidence                                                            00001111111111122334456677889999


Q ss_pred             HHHHHHhhhcCCCCceeeHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCCCCceeHHHHHHHHHhhcCCCCCHHH
Q psy8270         634 QYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQVELDEYLQMMSAIKSGHVAYSR  707 (737)
Q Consensus       634 ~l~~~F~~fD~d~~G~Is~~eL~~~L~~lg~~~s~~ev~~i~~~~D~d~dG~I~feEF~~ll~~~~~G~is~~e  707 (737)
                      .++..|..+|.|+.|+++..++.+.|++.+.+++++.+++++.+.|.+.+|.+...||.+++..+..|..+-..
T Consensus       594 ~~~~rf~~lD~~k~~~~~i~~v~~vlk~~~~~~d~~~~~~~l~ea~~~~~g~v~l~e~~q~~s~~~~g~~~~~R  667 (680)
T KOG0042|consen  594 RRKTRFAFLDADKKAYQAIADVLKVLKSENVGWDEDRLHEELQEADENLNGFVELREFLQLMSAIKNGCTEGSR  667 (680)
T ss_pred             HHHHHHHhhcchHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhhcceeeHHHHHHHHHHHhcCChHHHH
Confidence            99999999999999999999999999999989999999999999999999999999999999999988886643

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query737
3da1_A 561 X-Ray Structure Of The Glycerol-3-Phosphate Dehydro 1e-24
2rgo_A 607 Structure Of Alpha-Glycerophosphate Oxidase From St 5e-17
2rgh_A571 Structure Of Alpha-Glycerophosphate Oxidase From St 4e-16
2qcu_A501 Crystal Structure Of Glycerol-3-Phosphate Dehydroge 6e-11
2r4j_A501 Crystal Structure Of Escherichia Coli Semet Substit 2e-10
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 1e-08
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 1e-08
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 1e-08
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 1e-08
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 1e-08
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 1e-08
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 1e-08
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 1e-08
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 1e-08
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 1e-08
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 1e-08
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 2e-08
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 2e-08
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 3e-08
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 3e-08
2ygg_B150 Complex Of Cambr And Cam Length = 150 3e-08
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 3e-08
1up5_B148 Chicken Calmodulin Length = 148 3e-08
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 3e-08
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 3e-08
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-08
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 4e-08
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 4e-08
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 4e-08
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 4e-08
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 4e-08
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 4e-08
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 4e-08
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-08
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 4e-08
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 4e-08
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 5e-08
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 5e-08
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 5e-08
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 6e-08
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 6e-08
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 6e-08
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 9e-08
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-07
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-07
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 1e-07
2kz2_A94 Calmodulin, C-Terminal Domain, F92e Mutant Length = 1e-07
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 2e-07
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 2e-07
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 2e-07
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-07
2rob_A70 Solution Structure Of Calcium Bound Soybean Calmodu 3e-07
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 3e-07
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 4e-07
1m46_A148 Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A 4e-07
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 5e-07
2kn2_A92 Solution Structure Of The C-Terminal Domain Of Soyb 6e-07
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 7e-07
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 7e-07
2ro9_A69 Solution Structure Of Calcium Bound Soybean Calmodu 8e-07
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 9e-07
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 9e-07
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 1e-06
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 1e-06
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-06
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 1e-06
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 1e-06
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 2e-06
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 2e-06
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-06
1oqp_A77 Structure Of The Ca2+C-Terminal Domain Of Caltracti 2e-06
1m39_A89 Solution Structure Of The C-Terminal Fragment (F86- 2e-06
2fce_A70 Solution Structure Of C-Lobe Myosin Light Chain Fro 3e-06
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 3e-06
1fi5_A81 Nmr Structure Of The C Terminal Domain Of Cardiac T 3e-06
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 5e-06
2kdh_A72 The Solution Structure Of Human Cardiac Troponin C 5e-06
3ctn_A76 Structure Of Calcium-Saturated Cardiac Troponin C, 5e-06
2ksz_A76 The Solution Structure Of The Magnesium Bound Soybe 6e-06
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 7e-06
2roa_A79 Solution Structure Of Calcium Bound Soybean Calmodu 7e-06
2lmt_A148 Nmr Structure Of Androcam Length = 148 7e-06
4ds7_A147 Crystal Structure Of Yeast Calmodulin Bound To The 7e-06
1ih0_A71 Structure Of The C-Domain Of Human Cardiac Troponin 9e-06
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 9e-06
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 1e-05
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 1e-05
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 1e-05
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 1e-05
2a4j_A79 Solution Structure Of The C-Terminal Domain (T94-Y1 1e-05
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 1e-05
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 1e-05
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 1e-05
2obh_A143 Centrin-Xpc Peptide Length = 143 1e-05
2bl0_C142 Physarum Polycephalum Myosin Ii Regulatory Domain L 1e-05
2gv5_A161 Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 1e-05
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 1e-05
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 1e-05
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 1e-05
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 2e-05
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 2e-05
1jc2_A76 Complex Of The C-Domain Of Troponin C With Residues 2e-05
2jtz_A161 Solution Structure And Chemical Shift Assignments O 2e-05
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 2e-05
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 2e-05
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 2e-05
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 2e-05
2jnf_A158 Solution Structure Of Fly Troponin C, Isoform F1 Le 3e-05
1ozs_A73 C-Domain Of Human Cardiac Troponin C In Complex Wit 3e-05
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 4e-05
2k7b_A76 Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 4e-05
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 4e-05
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 4e-05
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 5e-05
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 5e-05
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 6e-05
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 6e-05
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 6e-05
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 6e-05
3ox6_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 6e-05
2k2a_A70 Solution Structure Of The Apo C Terminal Domain Of 7e-05
1ggw_A140 Cdc4p From Schizosaccharomyces Pombe Length = 140 7e-05
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 8e-05
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 9e-05
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 9e-05
3fwb_A161 Sac3:sus1:cdc31 Complex Length = 161 9e-05
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 1e-04
2kxw_A73 Structure Of The C-Domain Fragment Of Apo Calmoduli 1e-04
2b1u_A71 Solution Structure Of Calmodulin-Like Skin Protein 1e-04
4gjg_A89 Crystal Structure Of The Amino-terminal Domain Of H 1e-04
3pm8_A197 Cad Domain Of Pff0520w, Calcium Dependent Protein K 2e-04
1r2u_A89 Nmr Structure Of The N Domain Of Trout Cardiac Trop 2e-04
4gjf_A89 Crystal Structure Of The Amino-terminal Domain Of H 3e-04
2bl0_B145 Physarum Polycephalum Myosin Ii Regulatory Domain L 3e-04
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 4e-04
2lv7_A100 Solution Structure Of Ca2+-Bound Cabp7 N-Terminal D 4e-04
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-04
2ec6_C156 Placopecten Striated Muscle Myosin Ii Length = 156 4e-04
3tz1_A74 Crystal Structure Of The Ca2+-saturated C-terminal 5e-04
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-04
1mxl_C89 Structure Of Cardiac Troponin C-troponin I Complex 6e-04
2jxl_A89 Solution Structure Of Cardiac N-Domain Troponin C M 6e-04
3pn7_C156 Visualizing New Hinges And A Potential Major Source 8e-04
2os8_C157 Rigor-Like Structures Of Muscle Myosins Reveal Key 8e-04
2kgb_C89 Nmr Solution Of The Regulatory Domain Cardiac F77w- 8e-04
>pdb|3DA1|A Chain A, X-Ray Structure Of The Glycerol-3-Phosphate Dehydrogenase From Bacillus Halodurans Complexed With Fad. Northeast Structural Genomics Consortium Target Bhr167 Length = 561 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 105/198 (53%), Gaps = 2/198 (1%)
Query: 399 VGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIAL 458
           +G+K YD++A  +  +  Y L++K  LE  P++R + L G  +Y + + DDAR+ L I  
Sbjct: 119 LGLKVYDYLADVRKDERRYXLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARLTLEIXK 178
Query: 459 TATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPFTDSIRR 518
            A   GA   N+ +V + I D +GKV G   +D LT     + AK V+NA GP+ D++R 
Sbjct: 179 EAVARGAVALNYXKVESFIYD-QGKVVGVVAKDRLTDTTHTIYAKKVVNAAGPWVDTLRE 237
Query: 519 MDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAGTTDLPC 578
            D  +  K    S GVH+V+     P +  +   + SDGR IF +P    T  GTTD   
Sbjct: 238 KDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFDTESDGRXIFAIPREGKTYIGTTDTFY 297
Query: 579 DV-THHPKPTEDEIMFIL 595
           D     P+ T ++  +IL
Sbjct: 298 DKDIASPRXTVEDRDYIL 315
>pdb|2RGO|A Chain A, Structure Of Alpha-Glycerophosphate Oxidase From Streptococcus Sp.: A Template For The Mitochondrial Alpha- Glycerophosphate Dehydrogenase Length = 607 Back     alignment and structure
>pdb|2RGH|A Chain A, Structure Of Alpha-Glycerophosphate Oxidase From Streptococcus Sp.: A Template For The Mitochondrial Alpha- Glycerophosphate Dehydrogenase Length = 571 Back     alignment and structure
>pdb|2QCU|A Chain A, Crystal Structure Of Glycerol-3-Phosphate Dehydrogenase From Escherichia Coli Length = 501 Back     alignment and structure
>pdb|2R4J|A Chain A, Crystal Structure Of Escherichia Coli Semet Substituted Glycerol-3-Phosphate Dehydrogenase In Complex With Dhap Length = 501 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|2KZ2|A Chain A, Calmodulin, C-Terminal Domain, F92e Mutant Length = 94 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|2ROB|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 C-Terminal Domain Length = 70 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|1M46|A Chain A, Crystal Structure Of Mlc1p Bound To Iq4 Of Myo2p, A Class V Myosin Length = 148 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2KN2|A Chain A, Solution Structure Of The C-Terminal Domain Of Soybean Calmodulin Isoform 4 Fused With The Calmodulin-Binding Domain Of Ntmkp1 Length = 92 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|1OQP|A Chain A, Structure Of The Ca2+C-Terminal Domain Of Caltractin In Complex With The Cdc31p-Binding Domain From Kar1p Length = 77 Back     alignment and structure
>pdb|1M39|A Chain A, Solution Structure Of The C-Terminal Fragment (F86-I165) Of The Human Centrin 2 In Calcium Saturated Form Length = 89 Back     alignment and structure
>pdb|2FCE|A Chain A, Solution Structure Of C-Lobe Myosin Light Chain From Saccharomices Cerevisiae Length = 70 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|1FI5|A Chain A, Nmr Structure Of The C Terminal Domain Of Cardiac Troponin C Bound To The N Terminal Domain Of Cardiac Troponin I. Length = 81 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|2KDH|A Chain A, The Solution Structure Of Human Cardiac Troponin C In Complex With The Green Tea Polyphenol; (-)- Epigallocatechin-3-Gallate Length = 72 Back     alignment and structure
>pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 Back     alignment and structure
>pdb|2KSZ|A Chain A, The Solution Structure Of The Magnesium Bound Soybean Calmod Isoform 4 N-Domain Length = 76 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 Back     alignment and structure
>pdb|1IH0|A Chain A, Structure Of The C-Domain Of Human Cardiac Troponin C In Complex With Ca2+ Sensitizer Emd 57033 Length = 71 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|2A4J|A Chain A, Solution Structure Of The C-Terminal Domain (T94-Y172) Of The Human Centrin 2 In Complex With A 17 Residues Peptide (P1-Xpc) From Xeroderma Pigmentosum Group C Protein Length = 79 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|2BL0|C Chain C, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 142 Back     alignment and structure
>pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1JC2|A Chain A, Complex Of The C-Domain Of Troponin C With Residues 1-40 Of Troponin I Length = 76 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JNF|A Chain A, Solution Structure Of Fly Troponin C, Isoform F1 Length = 158 Back     alignment and structure
>pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|2K7B|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 N-Domain Length = 76 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|2K2A|A Chain A, Solution Structure Of The Apo C Terminal Domain Of Lethoceru C Isoform F1 Length = 70 Back     alignment and structure
>pdb|1GGW|A Chain A, Cdc4p From Schizosaccharomyces Pombe Length = 140 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|2KXW|A Chain A, Structure Of The C-Domain Fragment Of Apo Calmodulin Bound To The Iq Motif Of Nav1.2 Length = 73 Back     alignment and structure
>pdb|2B1U|A Chain A, Solution Structure Of Calmodulin-Like Skin Protein C Terminal Domain Length = 71 Back     alignment and structure
>pdb|4GJG|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant D2n/v28i/l29q/g30d (niqd) In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 Back     alignment and structure
>pdb|1R2U|A Chain A, Nmr Structure Of The N Domain Of Trout Cardiac Troponin C At 30 C Length = 89 Back     alignment and structure
>pdb|4GJF|A Chain A, Crystal Structure Of The Amino-terminal Domain Of Human Cardiac Troponin C Mutant L29q In Complex With Cadmium Length = 89 Back     alignment and structure
>pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|2LV7|A Chain A, Solution Structure Of Ca2+-Bound Cabp7 N-Terminal Doman Length = 100 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|2EC6|C Chain C, Placopecten Striated Muscle Myosin Ii Length = 156 Back     alignment and structure
>pdb|3TZ1|A Chain A, Crystal Structure Of The Ca2+-saturated C-terminal Domain Of Akazara Scallop Troponin C In Complex With A Troponin I Fragment Length = 74 Back     alignment and structure
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|1MXL|C Chain C, Structure Of Cardiac Troponin C-troponin I Complex Length = 89 Back     alignment and structure
>pdb|2JXL|A Chain A, Solution Structure Of Cardiac N-Domain Troponin C Mutant F77w-V82a Length = 89 Back     alignment and structure
>pdb|3PN7|C Chain C, Visualizing New Hinges And A Potential Major Source Of Compliance In The Lever Arm Of Myosin Length = 156 Back     alignment and structure
>pdb|2OS8|C Chain C, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 157 Back     alignment and structure
>pdb|2KGB|C Chain C, Nmr Solution Of The Regulatory Domain Cardiac F77w-Troponin C In Complex With The Cardiac Troponin I 144-163 Switch Peptide Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query737
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 3e-97
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 3e-64
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 3e-41
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 2e-92
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 8e-66
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 4e-41
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 9e-81
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 5e-58
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 5e-40
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-20
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-17
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 7e-17
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-08
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 1e-16
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 7e-16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 3e-13
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-15
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-13
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-15
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-15
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-14
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-15
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-11
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-15
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-15
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-07
1avs_A90 Troponin C; muscle contraction, calcium-activated, 3e-15
2hps_A186 Coelenterazine-binding protein with bound coelent; 8e-15
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-14
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-14
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 9e-14
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-14
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-13
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-14
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 7e-13
3fwb_A161 Cell division control protein 31; gene gating, com 3e-14
3fwb_A161 Cell division control protein 31; gene gating, com 3e-14
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-14
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 5e-13
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-14
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 1e-07
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 4e-14
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-14
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-14
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-09
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 5e-14
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 5e-14
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 5e-14
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 6e-14
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-10
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 7e-14
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 8e-14
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-13
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-13
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-09
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 1e-13
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-09
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-13
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-08
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-13
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-10
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-13
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-09
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-13
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 5e-10
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 2e-13
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-13
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-13
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 4e-13
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 4e-13
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 4e-08
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 5e-13
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 9e-09
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 5e-13
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-12
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 6e-13
1y1x_A191 Leishmania major homolog of programmed cell death 7e-13
1y1x_A191 Leishmania major homolog of programmed cell death 6e-11
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 8e-13
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 4e-08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 1e-12
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-11
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 2e-12
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 2e-10
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-12
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 5e-08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-12
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 1e-08
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 3e-12
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 5e-10
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 6e-12
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-09
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 7e-12
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 7e-12
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 9e-11
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-09
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 8e-12
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 3e-11
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 4e-11
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-11
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 4e-11
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 6e-11
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 5e-07
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 7e-11
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 8e-11
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 1e-08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 9e-11
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 3e-08
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 9e-11
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-10
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-08
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 7e-08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-10
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-09
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-10
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 2e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 9e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 6e-06
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 1e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 8e-09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 8e-07
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 2e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-09
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 4e-05
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 3e-09
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 3e-09
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-09
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 8e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 4e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 5e-09
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 5e-09
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-09
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 8e-09
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 4e-06
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 7e-09
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 2e-05
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 8e-09
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-05
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 9e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-08
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-05
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 2e-08
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-08
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-08
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-08
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-06
3dme_A369 Conserved exported protein; structural genomics, P 5e-08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 5e-08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 7e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 8e-08
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 6e-05
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 8e-08
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 9e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 8e-08
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-08
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 6e-06
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-07
1qjt_A99 EH1, epidermal growth factor receptor substrate su 3e-07
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 5e-07
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 5e-07
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 9e-07
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 1e-06
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 1e-04
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 1e-06
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-06
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-06
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 3e-06
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 1e-04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 3e-06
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 6e-06
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 4e-06
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 7e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 6e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 3e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 6e-06
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 1e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 2e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-05
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 6e-05
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 1e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 7e-05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 8e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 1e-04
3a4u_B143 Multiple coagulation factor deficiency protein 2; 1e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-04
3atr_A453 Conserved archaeal protein; saturating double bond 2e-04
3atr_A453 Conserved archaeal protein; saturating double bond 6e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-04
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 2e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 5e-04
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 5e-04
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 7e-04
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 7e-04
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Length = 561 Back     alignment and structure
 Score =  311 bits (798), Expect = 3e-97
 Identities = 69/206 (33%), Positives = 106/206 (51%), Gaps = 2/206 (0%)

Query: 393 EIPYYWVGIKAYDFVAGSKTVKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARM 452
                 +G+K YD++A  +  +  Y L++K  LE  P++R + L G  +Y + + DDAR+
Sbjct: 113 GKFSTSLGLKVYDYLADVRKDERRYMLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARL 172

Query: 453 CLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELTGKEWDLKAKSVINATGPF 512
            L I   A   GA   N+++V + I D  GKV G   +D LT     + AK V+NA GP+
Sbjct: 173 TLEIMKEAVARGAVALNYMKVESFIYDQ-GKVVGVVAKDRLTDTTHTIYAKKVVNAAGPW 231

Query: 513 TDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAG 572
            D++R  D  +  K    S GVH+V+     P +  +   + SDGR+IF +P    T  G
Sbjct: 232 VDTLREKDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFDTESDGRMIFAIPREGKTYIG 291

Query: 573 TTDLPCD-VTHHPKPTEDEIMFILQE 597
           TTD   D     P+ T ++  +IL  
Sbjct: 292 TTDTFYDKDIASPRMTVEDRDYILAA 317
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Length = 561 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Length = 561 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Length = 571 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Length = 571 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Length = 571 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Length = 501 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Length = 501 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Length = 501 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query737
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.97
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.97
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.94
3dme_A369 Conserved exported protein; structural genomics, P 99.9
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.89
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.88
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.88
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.85
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.84
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.83
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.83
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.81
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.8
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.8
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.78
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.78
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.76
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.76
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.74
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.71
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.69
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.63
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.61
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.6
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.6
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.59
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.58
3fwb_A161 Cell division control protein 31; gene gating, com 99.57
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.56
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.55
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.54
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.53
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.52
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.51
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.51
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.51
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.49
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.48
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.47
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.47
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.46
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.45
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.45
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.44
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.44
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.43
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.43
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.43
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.42
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.41
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.39
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.39
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.39
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.39
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.38
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.38
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.38
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.38
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.37
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.37
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.37
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.36
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.36
1y1x_A191 Leishmania major homolog of programmed cell death 99.36
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.34
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.34
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.33
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.33
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.32
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.32
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.31
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.3
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.3
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.29
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.29
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.28
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.27
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.27
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.26
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.26
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.25
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.24
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.23
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.23
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.23
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.22
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.22
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.22
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.22
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.21
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.21
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.21
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.21
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.2
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.2
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.19
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.19
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.19
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.18
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.18
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.18
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.18
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.18
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.17
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.17
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.17
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.17
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.16
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.16
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.16
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.16
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.16
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.16
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.16
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.16
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.16
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.15
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.15
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.15
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.15
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.15
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.15
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.15
1y1x_A191 Leishmania major homolog of programmed cell death 99.15
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.14
3atr_A453 Conserved archaeal protein; saturating double bond 99.14
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.14
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.14
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.13
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.13
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.13
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.13
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.13
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.13
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.12
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.12
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.11
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.11
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.1
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.1
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.09
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.09
3fwb_A161 Cell division control protein 31; gene gating, com 99.09
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.09
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.08
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.08
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.07
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.07
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.07
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.07
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.06
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.06
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 99.06
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.06
1c07_A95 Protein (epidermal growth factor receptor pathway 99.06
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.05
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.05
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.04
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.04
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.02
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.02
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.02
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.02
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.01
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.01
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.01
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.01
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.0
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.0
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.0
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.99
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.99
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.99
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.99
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.99
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.98
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.98
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.98
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.97
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.97
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.97
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.97
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.97
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.96
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.96
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.96
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.96
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.96
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.95
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.95
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.95
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.95
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.95
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.95
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.94
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.94
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.94
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.94
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.93
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.93
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.92
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.92
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.92
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.92
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.92
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.91
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.91
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.9
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.9
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.89
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.89
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.88
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.88
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.87
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.87
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.87
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.87
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.87
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.87
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.86
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.86
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.86
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.86
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.86
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.85
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.85
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.85
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.85
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.84
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.84
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.84
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.83
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.81
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.81
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.81
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.81
3li6_A66 Calcium-binding protein; calcium signaling protein 98.81
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.8
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.8
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.8
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.8
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.8
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.79
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.79
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.78
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.78
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.76
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.76
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.76
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.76
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.76
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.75
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.75
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.75
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.75
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.75
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.75
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.75
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.74
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.72
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.72
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.71
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.7
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.7
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.7
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.69
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.69
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.68
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.68
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.67
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.67
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.67
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.66
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.65
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.65
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.65
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.65
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.64
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.64
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.64
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.64
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.63
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.62
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.62
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.61
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.61
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.61
2cul_A232 Glucose-inhibited division protein A-related PROT 98.6
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.6
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.59
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.59
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.58
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.57
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.57
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.57
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.56
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.56
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.56
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.55
2bry_A497 NEDD9 interacting protein with calponin homology a 98.55
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.55
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.54
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.54
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.53
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.53
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.53
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.52
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.51
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.51
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.51
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.51
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.51
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.5
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.49
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.48
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.47
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.46
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.46
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.46
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.45
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.45
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.43
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.43
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.42
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.42
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.4
4dna_A463 Probable glutathione reductase; structural genomic 98.4
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.39
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.38
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.38
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.37
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.36
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.35
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.35
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.34
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.34
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.33
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.33
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.33
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.31
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.31
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.3
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.28
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.27
1vg0_A650 RAB proteins geranylgeranyltransferase component A 98.27
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.26
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.26
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.24
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.24
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.22
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.18
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.09
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.08
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.07
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.07
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.04
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.03
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.03
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.02
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.01
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.01
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.96
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.94
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.94
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.93
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.88
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.86
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.85
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.82
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.82
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.81
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.8
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.79
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.78
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.77
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.77
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.73
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.71
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.69
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.68
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.68
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.68
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.68
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.67
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.65
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.62
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.59
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.57
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.53
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.52
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.52
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.51
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.5
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.5
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.49
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.48
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.47
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.43
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.42
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.4
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.4
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.39
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.38
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.38
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.37
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.37
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.36
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.33
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.33
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.33
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.32
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.31
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.31
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.3
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.29
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.28
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.28
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.26
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.25
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.25
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.24
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.24
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.24
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.23
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.23
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.22
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.22
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.22
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.2
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.19
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.17
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.14
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.12
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.11
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.1
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.09
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.09
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.08
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.03
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.02
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.01
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.96
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.95
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.93
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.92
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.9
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.89
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.85
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.85
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 96.83
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.83
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.79
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.78
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.73
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.73
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.71
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 96.7
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.69
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.68
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 96.68
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 96.68
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 96.67
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.67
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 96.67
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.67
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 96.66
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.66
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.66
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.62
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.62
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.61
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 96.61
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.6
1avs_A90 Troponin C; muscle contraction, calcium-activated, 96.6
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.6
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 96.58
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.57
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.57
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.57
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.54
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 96.52
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.51
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 96.5
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.49
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.48
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.45
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.44
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.44
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.44
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 96.42
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.4
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.38
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
Probab=99.97  E-value=2.1e-30  Score=299.17  Aligned_cols=185  Identities=34%  Similarity=0.484  Sum_probs=156.6

Q ss_pred             CCcceeeCHhhHHHHCCCCCcccceeEEEecceeEChHHHHHHHHHHHHHCCcEEecCceEEEEEEcCCCcEEEEEEeec
Q psy8270         413 VKSSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDE  492 (737)
Q Consensus       413 ~~~~~~l~~~~~~~~~p~~~~~~~~g~~~~~~g~Vdp~~~v~al~~~A~~~Gve~~~nt~V~~L~~d~~~~V~gV~~~~~  492 (737)
                      ....++++++++.+.+|.++.+.+.+++.++++++|+.+++.+++..+.++|++++++++|+++..+ ++++++|++.+.
T Consensus       133 ~~~~~~l~~~~~~~~~P~l~~~~~~gg~~~~dg~vd~~~l~~~L~~~a~~~G~~i~~~~~V~~l~~~-~g~v~gV~~~d~  211 (561)
T 3da1_A          133 DERRYMLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARLTLEIMKEAVARGAVALNYMKVESFIYD-QGKVVGVVAKDR  211 (561)
T ss_dssp             ---CEEECHHHHHHHCTTSCCTTCCEEEEEEEEECCHHHHHHHHHHHHHHTTCEEEESEEEEEEEEE-TTEEEEEEEEET
T ss_pred             CCCcEEECHHHHHHhCccCChhhceeEEEecCceEcHHHHHHHHHHHHHHcCCEEEcCCEEEEEEEc-CCeEEEEEEEEc
Confidence            4467889999999999999877789999999999999999999999999999999999999999998 789999999886


Q ss_pred             ccCeeEEEEcCEEEecCCCChhhhhhhcCCCccccccccceEEEEecCCCCCCCceeeecCCCCCcEEEEeecCCeEeee
Q psy8270         493 LTGKEWDLKAKSVINATGPFTDSIRRMDDGQVQKICVPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWLKHTIAG  572 (737)
Q Consensus       493 ~tg~~~~I~Ad~VV~a~Gaws~~L~~~lG~~lp~~i~p~KG~~lvv~~~~~~~~~~i~~~~~~Dgr~iy~~P~~g~~ivG  572 (737)
                      .+|+...+.|+.||||+|+|++.+.+++|...+..+.|.||++++++....+....++++.+.|++++|++|++|++++|
T Consensus       212 ~tg~~~~i~A~~VV~AaG~~s~~l~~~~g~~~~~~v~p~kG~~lvl~~~~~~~~~~~~~~~~~dgr~v~~iP~~g~~~iG  291 (561)
T 3da1_A          212 LTDTTHTIYAKKVVNAAGPWVDTLREKDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFDTESDGRMIFAIPREGKTYIG  291 (561)
T ss_dssp             TTCCEEEEEEEEEEECCGGGHHHHHHTTTCCCSSEEEEEEEEEEEEEGGGSCCSSEEEECCSSSCCCEEEEEETTEEEEC
T ss_pred             CCCceEEEECCEEEECCCcchHHHHHhcCCCCCceEEeccEEEEEECCccCCCceEEEeccCCCCcEEEEEecCCCEEEc
Confidence            66766689999999999999999999988764445899999999998654444555555443689989999998899999


Q ss_pred             cCCCCC-CCCCCCCCCHHHHHHHHHHh
Q psy8270         573 TTDLPC-DVTHHPKPTEDEIMFILQEK  598 (737)
Q Consensus       573 ~Tde~~-~~~~d~~pteeeI~~Lls~~  598 (737)
                      +|+++. ..+.+..++.++++++++.+
T Consensus       292 tT~~~~~~~~~~~~~t~~~i~~ll~~~  318 (561)
T 3da1_A          292 TTDTFYDKDIASPRMTVEDRDYILAAA  318 (561)
T ss_dssp             CCCEEECSCTTCCCCCHHHHHHHHHHH
T ss_pred             CCCCccCCCcCCCCCCHHHHHHHHHHH
Confidence            999754 23467889999999998874
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 737
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 8e-15
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 8e-14
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-13
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 3e-13
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-13
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-12
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 8e-12
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 9e-12
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-11
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 2e-11
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-11
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-11
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 8e-11
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-10
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-10
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 1e-10
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-10
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 7e-10
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 8e-08
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-10
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-09
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 3e-09
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-09
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-09
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 3e-09
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 1e-08
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-08
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 1e-08
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-08
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-08
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 3e-08
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 3e-08
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 5e-08
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-08
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 8e-08
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 1e-07
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 3e-07
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 4e-07
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 4e-07
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 1e-04
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 6e-07
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 6e-07
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 6e-07
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 8e-07
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 1e-06
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 1e-06
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 1e-06
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 0.001
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 1e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-06
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 8e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 2e-06
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-06
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-06
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 4e-06
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.002
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 4e-06
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 4e-06
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 3e-04
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 4e-06
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 4e-06
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 6e-06
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 1e-05
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-05
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-05
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 3e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 3e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 8e-04
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 4e-05
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 4e-05
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 4e-05
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 4e-05
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 5e-05
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 0.001
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 5e-05
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 5e-05
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 6e-05
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-05
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 7e-05
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 7e-05
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 7e-04
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 1e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-04
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-04
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-04
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 2e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 6e-04
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-04
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-04
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-04
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 8e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.001
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 0.001
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.001
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 0.001
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 0.002
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 0.002
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 0.002
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.003
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 0.003
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 0.003
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 0.004
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 67.7 bits (165), Expect = 8e-15
 Identities = 23/71 (32%), Positives = 47/71 (66%)

Query: 626 NLTKEEINQYIKRFQIMDKERKGYVSINDIRRGLKNFGETISGEELHEILREIDSNMNGQ 685
           NLT+E+I ++ + F + DK+  G +S +++   +++ G + S  E+++++ EID + N Q
Sbjct: 3   NLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQ 62

Query: 686 VELDEYLQMMS 696
           +E  E+L +MS
Sbjct: 63  IEFSEFLALMS 73
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query737
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.9
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.87
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.85
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.66
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.6
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.57
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.55
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.5
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.47
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.46
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.45
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.41
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.4
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.4
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.39
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.38
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.38
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.37
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.36
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.36
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.35
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.34
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.34
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.34
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.34
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.32
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.31
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.3
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.3
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.3
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.26
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.24
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.22
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.22
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.2
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.19
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.18
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.18
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.17
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.16
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.16
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.16
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.15
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.15
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.12
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.12
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.11
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.11
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.09
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.09
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.07
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.06
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.05
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.05
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.04
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.02
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.02
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.01
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.0
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.99
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.99
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.99
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.98
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.97
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.97
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.96
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.95
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.94
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.94
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.93
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.91
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.89
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.88
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.87
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.87
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.86
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.85
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.84
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.84
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.83
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.83
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.83
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.81
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.81
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.8
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.79
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.78
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.77
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.75
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.74
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.74
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.74
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.73
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.7
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.7
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.68
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.67
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.66
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.65
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.65
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.64
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.63
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.59
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.57
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.56
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.55
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.53
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.52
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.5
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.5
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.49
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.48
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.47
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.46
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.46
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.46
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.45
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.45
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.39
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.39
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.37
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.34
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.31
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.31
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.3
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.29
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.26
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.24
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.22
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.21
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.2
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.2
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.2
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.16
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.16
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.15
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.14
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.13
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.13
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.11
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.1
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.1
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.07
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.06
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.06
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.05
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.04
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.04
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.03
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.99
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.98
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.97
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.95
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.93
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.92
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.9
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.89
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.87
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.87
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.86
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.86
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.85
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.83
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.8
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.8
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.8
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.79
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.79
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.75
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.74
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.74
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.72
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.68
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.65
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.65
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.64
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.62
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.62
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.6
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 97.54
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 97.51
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 97.49
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.48
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.47
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.41
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.38
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 97.37
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.36
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.34
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.3
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 97.18
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 97.15
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 97.14
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 97.05
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.62
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.61
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.59
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 96.56
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.52
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.41
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 96.38
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.36
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.26
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.06
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.04
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.03
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.98
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 95.89
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 95.87
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.74
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.7
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.54
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.43
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.37
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 95.32
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 95.31
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.31
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.14
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.13
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.08
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 95.07
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 95.03
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 94.83
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.8
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.77
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 94.67
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.54
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.33
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.3
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 94.11
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.06
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.96
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.86
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.79
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.54
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.49
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.46
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.89
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.82
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.39
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.99
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.98
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.96
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.9
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.84
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.77
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.57
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 91.51
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.51
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 91.5
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.21
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.03
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 90.82
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.65
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 90.37
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 90.32
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.28
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 90.22
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 90.19
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.15
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 89.97
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.92
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.79
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.56
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.53
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.5
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 89.31
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 89.15
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.11
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 88.87
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 88.73
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.43
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.4
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 88.34
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.2
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 88.18
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.01
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.85
d1id1a_153 Rck domain from putative potassium channel Kch {Es 87.69
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.57
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.52
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 87.45
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 87.21
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.09
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 86.69
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.63
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.56
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 86.4
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 86.05
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 86.0
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 85.48
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 85.35
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 85.3
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.8
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 84.46
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 84.39
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 84.32
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 83.55
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.27
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.17
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 82.93
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 82.69
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 81.74
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 81.41
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 81.01
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 80.73
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 80.3
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 80.23
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 80.21
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 80.17
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glycine oxidase ThiO
species: Bacillus sp. [TaxId: 1409]

Probab=99.90  E-value=1.8e-23  Score=214.70  Aligned_cols=103  Identities=22%  Similarity=0.236  Sum_probs=87.6

Q ss_pred             cceeeCHhhHHHHCCCCCcccceeEEEecceeEChHHHHHHHHHHHHHCCcEEecCceEEEEEEcCCCcEEEEEEeeccc
Q psy8270         415 SSYYLSKKNALELFPMIRGDKLCGAIVYYDGQQDDARMCLAIALTATRHGATVANHVRVTNLIKDDKGKVRGAHLRDELT  494 (737)
Q Consensus       415 ~~~~l~~~~~~~~~p~~~~~~~~g~~~~~~g~Vdp~~~v~al~~~A~~~Gve~~~nt~V~~L~~d~~~~V~gV~~~~~~t  494 (737)
                      ..+.++.+++.+.+|.+..+...+.+.+.++++||..++.+|++.++++|++|+++++|++|..+  +++++|++.    
T Consensus       116 ~~~~~~~~~~~~~~p~~~~~~~g~~~~~~~g~i~~~~~~~~l~~~~~~~Gv~i~~~~~V~~i~~~--~~~~~V~t~----  189 (276)
T d1ryia1         116 SVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERD--GEALFIKTP----  189 (276)
T ss_dssp             TEEEEEHHHHHHHCTTSCTTCCEEEEETTCCBCCHHHHHHHHHHHHHHTTCEEETTCCCCEEECS--SSSEEEEET----
T ss_pred             cccccccccccccCcccccceeEEEEeccceeeecccchhHHHHHHHHcCCEEecceEEEeEEee--cceEEEecC----
Confidence            45779999999999998766555556677889999999999999999999999999999999875  556777642    


Q ss_pred             CeeEEEEcCEEEecCCCChhhhhhhcCCCcc
Q psy8270         495 GKEWDLKAKSVINATGPFTDSIRRMDDGQVQ  525 (737)
Q Consensus       495 g~~~~I~Ad~VV~a~Gaws~~L~~~lG~~lp  525 (737)
                       ++ +|.|+.||+|||+|+..|++++|++.+
T Consensus       190 -~g-~i~a~~vV~AaG~~s~~l~~~~G~~~~  218 (276)
T d1ryia1         190 -SG-DVWANHVVVASGVWSGMFFKQLGLNNA  218 (276)
T ss_dssp             -TE-EEEEEEEEECCGGGTHHHHHHTTCCCC
T ss_pred             -Ce-EEEcCEEEECCCccHHHHHhhcCCCcc
Confidence             22 699999999999999999999998754
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure