Psyllid ID: psy8281

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MFGVRCGFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
ccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccEEEEEcc
cccccccccccccccccccccccccccccEEEccccccccEEEEccccccccccccccccccccccccccEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccHHHHccc
mfgvrcgftgktcedtsdpcesgpcqnggscaasnltaqqfkclcppgfsgslcqhnlddcasspcghgicvdqtdgyrcycqpgysgeqcqyeynecesspclnggscsdhvgrfsctcghgytgqrcqikvdlcdpnpcshhhycvdkgntfacecpkgyqgpncdvpgiVFYLKY
mfgvrcgftgktcedtsdpcESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKgyqgpncdvpGIVFYLKY
MFGVRCGFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
******GF**********************CAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYL**
MFGVRCGFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
MFGVRCGFTGKT***************GGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
MFGVRCGFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGVRCGFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPGIVFYLKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
P10079 1064 Fibropellin-1 OS=Strongyl no N/A 0.876 0.146 0.481 2e-35
Q6V0I7 4981 Protocadherin Fat 4 OS=Ho yes N/A 0.853 0.030 0.372 2e-34
Q90Y54 1213 Protein jagged-1b OS=Dani no N/A 0.882 0.129 0.468 5e-34
P07207 2703 Neurogenic locus Notch pr no N/A 0.910 0.059 0.433 8e-34
P46530 2437 Neurogenic locus notch ho no N/A 0.915 0.066 0.455 3e-33
P0C6B8 3564 Sushi, von Willebrand fac no N/A 0.898 0.044 0.451 7e-33
P49013 570 Fibropellin-3 OS=Strongyl no N/A 0.898 0.280 0.432 1e-32
P21783 2524 Neurogenic locus notch pr N/A N/A 0.904 0.063 0.430 2e-32
O00548 723 Delta-like protein 1 OS=H no N/A 0.893 0.219 0.475 4e-32
P78504 1218 Protein jagged-1 OS=Homo no N/A 0.882 0.128 0.425 4e-32
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 94/160 (58%), Gaps = 4/160 (2%)

Query: 11  KTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHG- 69
            TCE   D C S PC NGG+C         F C C PG+ G+ C+ N D+CASSPC +G 
Sbjct: 589 STCETDRDECASAPCLNGGACMD---VVNGFVCTCLPGWEGTNCEINTDECASSPCMNGG 645

Query: 70  ICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRC 129
           +CVDQ + Y C+C PG++G  C  E +EC SSPCLNGG C D V  + C C  GYT  RC
Sbjct: 646 LCVDQVNSYVCFCLPGFTGIHCGTEIDECASSPCLNGGQCIDRVDSYECVCAAGYTAVRC 705

Query: 130 QIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDV 169
           QI +D C   PC +   CVD  N + C C  GY G NC+ 
Sbjct: 706 QINIDECASAPCQNGGVCVDGVNGYVCNCAPGYTGDNCET 745
Forms the apical lamina, a component of the extracellular matrix.
Strongylocentrotus purpuratus (taxid: 7668)
>sp|Q6V0I7|FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2 Back     alignment and function description
>sp|Q90Y54|JAG1B_DANRE Protein jagged-1b OS=Danio rerio GN=jag1b PE=2 SV=1 Back     alignment and function description
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|P0C6B8|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|P49013|FBP3_STRPU Fibropellin-3 OS=Strongylocentrotus purpuratus GN=EGF3 PE=1 SV=1 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|O00548|DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens GN=DLL1 PE=2 SV=2 Back     alignment and function description
>sp|P78504|JAG1_HUMAN Protein jagged-1 OS=Homo sapiens GN=JAG1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
189242345 680 PREDICTED: similar to CG31665 CG31665-PB 0.910 0.238 0.630 3e-57
242025630 363 hypothetical protein Phum_PHUM617470 [Pe 0.904 0.443 0.597 8e-53
194762320 1216 GF14011 [Drosophila ananassae] gi|190616 0.893 0.130 0.580 8e-51
195435297 1219 GK14567 [Drosophila willistoni] gi|19416 0.893 0.130 0.580 9e-51
195148816 1318 GL19662 [Drosophila persimilis] gi|19410 0.893 0.120 0.586 1e-50
442625258 1155 weary, isoform D [Drosophila melanogaste 0.893 0.137 0.574 2e-50
386768962 1154 weary, isoform C [Drosophila melanogaste 0.893 0.137 0.574 2e-50
195470577 1196 GE17758 [Drosophila yakuba] gi|194173684 0.893 0.132 0.574 2e-50
161076617 1157 weary, isoform B [Drosophila melanogaste 0.893 0.137 0.574 2e-50
194854288 1181 GG24813 [Drosophila erecta] gi|190660195 0.893 0.134 0.574 2e-50
>gi|189242345|ref|XP_967787.2| PREDICTED: similar to CG31665 CG31665-PB [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 3/165 (1%)

Query: 7   GFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPC 66
           G+TGKTCED ++ C S PCQNG +C  +     QFKC C  GFSG LCQH+ +DC SSPC
Sbjct: 333 GYTGKTCEDQTNACLSMPCQNGATCIGN---VTQFKCECLTGFSGPLCQHSHNDCESSPC 389

Query: 67  GHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTG 126
            HGICV+Q +GY+C+CQPG++G  C+YEYNEC+SSPC NGG+C+DHVG ++CTCG G+TG
Sbjct: 390 VHGICVNQEEGYKCFCQPGFTGTHCEYEYNECQSSPCTNGGTCTDHVGHYTCTCGRGFTG 449

Query: 127 QRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPG 171
           +RC IKVDLC PNPC    YCVD GN ++CECPKGY GP+C +P 
Sbjct: 450 RRCHIKVDLCQPNPCPEPRYCVDHGNNYSCECPKGYSGPDCLIPS 494

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242025630|ref|XP_002433227.1| hypothetical protein Phum_PHUM617470 [Pediculus humanus corporis] gi|212518768|gb|EEB20489.1| hypothetical protein Phum_PHUM617470 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|194762320|ref|XP_001963298.1| GF14011 [Drosophila ananassae] gi|190616995|gb|EDV32519.1| GF14011 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195435297|ref|XP_002065635.1| GK14567 [Drosophila willistoni] gi|194161720|gb|EDW76621.1| GK14567 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195148816|ref|XP_002015359.1| GL19662 [Drosophila persimilis] gi|194107312|gb|EDW29355.1| GL19662 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|442625258|ref|NP_722737.3| weary, isoform D [Drosophila melanogaster] gi|440213146|gb|AAF51334.4| weary, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386768962|ref|NP_001245842.1| weary, isoform C [Drosophila melanogaster] gi|383291281|gb|AFH03519.1| weary, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195470577|ref|XP_002087583.1| GE17758 [Drosophila yakuba] gi|194173684|gb|EDW87295.1| GE17758 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|161076617|ref|NP_995611.2| weary, isoform B [Drosophila melanogaster] gi|157400035|gb|AAS64628.2| weary, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194854288|ref|XP_001968328.1| GG24813 [Drosophila erecta] gi|190660195|gb|EDV57387.1| GG24813 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
FB|FBgn0051665 1157 wry "weary" [Drosophila melano 0.926 0.142 0.573 7.4e-58
UNIPROTKB|G3MYX7 1206 LOC786516 "Uncharacterized pro 0.898 0.132 0.436 4e-37
UNIPROTKB|F1N2V0 1281 LOC786516 "Uncharacterized pro 0.898 0.124 0.436 4.5e-37
ZFIN|ZDB-GENE-000329-5 2468 notch3 "notch homolog 3" [Dani 0.915 0.066 0.458 2.8e-42
UNIPROTKB|O00548 723 DLL1 "Delta-like protein 1" [H 0.893 0.219 0.475 6.6e-42
ZFIN|ZDB-GENE-990415-173 2437 notch1a "notch homolog 1a" [Da 0.915 0.066 0.455 1.5e-41
ZFIN|ZDB-GENE-011128-4 1213 jag1b "jagged 1b" [Danio rerio 0.910 0.133 0.455 2.1e-41
FB|FBgn0004647 2703 N "Notch" [Drosophila melanoga 0.904 0.059 0.436 2.2e-41
UNIPROTKB|G3X812 1994 NOTCH4 "Uncharacterized protei 0.904 0.080 0.460 3.9e-41
UNIPROTKB|I3LNT3 722 DLL1 "Delta-like protein" [Sus 0.921 0.227 0.449 5.1e-41
FB|FBgn0051665 wry "weary" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 604 (217.7 bits), Expect = 7.4e-58, P = 7.4e-58
 Identities = 97/169 (57%), Positives = 119/169 (70%)

Query:     7 GFTGKTCEDTSDPCESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPC 66
             G+ GK C+  SDPC    C NGGSC   N T   F+C C PGF+G LCQH+L++C SSPC
Sbjct:   770 GYAGKNCQYESDPCNPAECMNGGSCVG-NST--HFRCDCAPGFTGPLCQHSLNECESSPC 826

Query:    67 GHGICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTG 126
              HGICVDQ DG+RC+CQPG++GE C +EYNECES+PC NGG C DH+G + C C  G++G
Sbjct:   827 VHGICVDQEDGFRCFCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSG 886

Query:   127 QRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCD-VPGIVF 174
              RCQIKVD C   PC   H C+D GN F+CECP G  GP+C+ +P   F
Sbjct:   887 NRCQIKVDFCANKPCPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYF 935
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007219 "Notch signaling pathway" evidence=IMP
GO:0003015 "heart process" evidence=IMP
GO:0009986 "cell surface" evidence=IDA
GO:0005112 "Notch binding" evidence=IPI
UNIPROTKB|G3MYX7 LOC786516 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2V0 LOC786516 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000329-5 notch3 "notch homolog 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O00548 DLL1 "Delta-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-173 notch1a "notch homolog 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011128-4 jag1b "jagged 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004647 N "Notch" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3X812 NOTCH4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNT3 DLL1 "Delta-like protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 1e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.001
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information 
 Score = 39.9 bits (94), Expect = 1e-05
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 96  NECES-SPCLNGGSCSDHVGRFSCTCGHGYTGQRCQ 130
           +EC S +PC NGG+C + VG + C+C  GYTG+ C+
Sbjct: 3   DECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38

Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
KOG1219|consensus 4289 99.68
KOG1219|consensus 4289 99.63
KOG4289|consensus 2531 99.49
KOG1225|consensus 525 99.41
KOG4289|consensus 2531 99.41
KOG1214|consensus 1289 99.37
KOG1217|consensus 487 99.3
KOG4260|consensus350 99.3
KOG1217|consensus 487 99.17
KOG1214|consensus 1289 98.99
KOG1225|consensus 525 98.99
KOG1226|consensus 783 98.55
KOG1226|consensus 783 98.55
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.42
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.37
KOG0994|consensus 1758 98.32
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.25
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.22
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 98.18
KOG4260|consensus350 98.17
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.03
KOG0994|consensus 1758 98.02
smart0018135 EGF Epidermal growth factor-like domain. 97.84
cd0005336 EGF Epidermal growth factor domain, found in epide 97.84
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.76
cd0005336 EGF Epidermal growth factor domain, found in epide 97.58
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.53
smart0018135 EGF Epidermal growth factor-like domain. 97.5
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 97.49
KOG1836|consensus 1705 97.49
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.48
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.47
PF1266224 cEGF: Complement Clr-like EGF-like 97.21
KOG1836|consensus 1705 97.16
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.08
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.98
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.57
smart0005163 DSL delta serrate ligand. 96.3
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 96.26
smart0005163 DSL delta serrate ligand. 96.14
PHA03099139 epidermal growth factor-like protein (EGF-like pro 95.54
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 95.51
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 95.45
PHA02887126 EGF-like protein; Provisional 94.93
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 94.84
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.95
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 93.66
KOG3512|consensus 592 92.92
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 91.44
KOG1218|consensus316 91.35
KOG3516|consensus 1306 89.92
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 89.64
PHA02887126 EGF-like protein; Provisional 89.09
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 87.28
PHA03099139 epidermal growth factor-like protein (EGF-like pro 86.78
KOG3516|consensus 1306 85.96
KOG3514|consensus 1591 85.8
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 83.35
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 82.43
KOG3514|consensus 1591 82.25
>KOG1219|consensus Back     alignment and domain information 
Probab=99.68  E-value=1.9e-16  Score=130.81  Aligned_cols=118  Identities=37%  Similarity=1.010  Sum_probs=106.0

Q ss_pred             CCCCCCCCCCCCCCC-ceEeeCC-CCeeeeCCCCCcCCCccccCCCcCCCCCCCCCeEecCCCCeeeecCCCcccCCccc
Q psy8281          54 CQHNLDDCASSPCGH-GICVDQT-DGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQI  131 (178)
Q Consensus        54 C~~~~~~c~~~~c~~-~~c~~~~-~~~~C~c~~g~~g~~c~~~~~~c~~~~c~~~~~c~~~~~~~~C~C~~g~~g~~c~~  131 (178)
                      |....+.|...+|.| |.|.... ++|.|.|++-|.|++|+.++..|...||..++.|....+.+.|.|+.+|+|..|+.
T Consensus      3860 C~l~~d~C~~npCqhgG~C~~~~~ggy~CkCpsqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC~~gyTG~~Ce~ 3939 (4289)
T KOG1219|consen 3860 CSLLTDPCNDNPCQHGGTCISQPKGGYKCKCPSQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNCPNGYTGKRCEA 3939 (4289)
T ss_pred             ccccccccccCcccCCCEecCCCCCceEEeCcccccCcccccccccccCCCCCCCCEEEecCCCeeEeCCCCccCceeec
Confidence            443336788888987 6898654 78999999999999999999999999999999999999999999999999999997


Q ss_pred             c-CCCCCCCCCCCCCeeeeCCCceeeeCCCCCCCCCCCCCC
Q psy8281         132 K-VDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDVPG  171 (178)
Q Consensus       132 ~-~~~c~~~~c~~~~~c~~~~~~~~C~C~~g~~g~~C~~~~  171 (178)
                      + +++|..++|..++.|+|..|+|+|.|.+||.|..|....
T Consensus      3940 ~Gi~eCs~n~C~~gg~C~n~~gsf~CncT~g~~gr~c~~~~ 3980 (4289)
T KOG1219|consen 3940 RGISECSKNVCGTGGQCINIPGSFHCNCTPGILGRTCCAEK 3980 (4289)
T ss_pred             ccccccccccccCCceeeccCCceEeccChhHhcccCcccc
Confidence            7 899999999999999999999999999999999986443

>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 5e-21
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-20
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 2e-13
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 2e-08
1ezq_B134 Crystal Structure Of Human Coagulation Factor Xa Co 4e-07
3ens_A94 Crystal Structure Of Human Fxa In Complex With Meth 4e-07
1g2l_B94 Factor Xa Inhibitor Complex Length = 94 4e-07
1p0s_L138 Crystal Structure Of Blood Coagulation Factor Xa In 4e-07
1ioe_L96 Human Coagulation Factor Xa In Complex With M55532 4e-07
2h9e_L149 Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMP 5e-07
1nfu_B195 Crystal Structure Of Human Coagulation Factor Xa Co 5e-07
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 1e-06
1fax_L96 Coagulation Factor Xa Inhibitor Complex Length = 96 2e-06
1xka_L95 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 2e-06
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 4e-05
1w0y_L142 Tf7a_3771 Complex Length = 142 4e-05
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 4e-05
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 4e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 5e-05
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 8e-05
1dva_L101 Crystal Structure Of The Complex Between The Peptid 9e-05
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 2e-04
1qfk_L104 Structure Of Human Factor Viia And Its Implications 3e-04
2puq_L94 Crystal Structure Of Active Site Inhibited Coagulat 3e-04
1apo_A42 Three-Dimensional Structure Of The Apo Form Of The 4e-04
3f6u_L98 Crystal Structure Of Human Activated Protein C (Apc 4e-04
1ht5_A 551 The 2.75 Angstrom Resolution Model Of Ovine Cox-1 C 4e-04
1ebv_A 551 Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid 4e-04
3n8y_B 553 Structure Of Aspirin Acetylated Cyclooxygenase-1 In 4e-04
2oye_P 600 Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To 5e-04
1pth_A 576 The Structural Basis Of Aspirin Activity Inferred F 5e-04
1pge_A 576 Prostaglandin H2 Synthase-1 Complexed With P-(2'-Io 5e-04
1cqe_A 580 Prostaglandin H2 Synthase-1 Complex With Flurbiprof 5e-04
1x7a_L146 Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) 8e-04
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure 
Iteration: 1

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 70/117 (59%), Gaps = 3/117 (2%)
Query: 56  HNLDDCA--SSPCGH-GICVDQTDGYRCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDH 112
            ++D+C+  ++PC H G C++    + C C  GY+G +C+ + NEC S+PC N  +C D 
Sbjct: 3   QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQ 62
Query: 113 VGRFSCTCGHGYTGQRCQIKVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDV 169
           +G F C C  GY G  C++  D C  +PC H+  C+DK N F CECP G+ G  C V
Sbjct: 63  IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQV 119
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|1EZQ|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 134 Back     alignment and structure
>pdb|3ENS|A Chain A, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 94 Back     alignment and structure
>pdb|1G2L|B Chain B, Factor Xa Inhibitor Complex Length = 94 Back     alignment and structure
>pdb|1P0S|L Chain L, Crystal Structure Of Blood Coagulation Factor Xa In Complex With Ecotin M84r Length = 138 Back     alignment and structure
>pdb|1IOE|L Chain L, Human Coagulation Factor Xa In Complex With M55532 Length = 96 Back     alignment and structure
>pdb|2H9E|L Chain L, Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMPLEX Length = 149 Back     alignment and structure
>pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|1FAX|L Chain L, Coagulation Factor Xa Inhibitor Complex Length = 96 Back     alignment and structure
>pdb|1XKA|L Chain L, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 95 Back     alignment and structure
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|1QFK|L Chain L, Structure Of Human Factor Viia And Its Implications For The Triggering Of Blood Coagulation Length = 104 Back     alignment and structure
>pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 Back     alignment and structure
>pdb|1APO|A Chain A, Three-Dimensional Structure Of The Apo Form Of The N- Terminal Egf-Like Module Of Blood Coagulation Factor X As Determined By Nmr Spectroscopy And Simulated Folding Length = 42 Back     alignment and structure
>pdb|3F6U|L Chain L, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 98 Back     alignment and structure
>pdb|1HT5|A Chain A, The 2.75 Angstrom Resolution Model Of Ovine Cox-1 Complexed With Methyl Ester Flurbiprofen Length = 551 Back     alignment and structure
>pdb|1EBV|A Chain A, Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid Length = 551 Back     alignment and structure
>pdb|3N8Y|B Chain B, Structure Of Aspirin Acetylated Cyclooxygenase-1 In Complex With Diclofenac Length = 553 Back     alignment and structure
>pdb|2OYE|P Chain P, Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To Cyclooxygenase-1 Length = 600 Back     alignment and structure
>pdb|1PTH|A Chain A, The Structural Basis Of Aspirin Activity Inferred From The Crystal Structure Of Inactivated Prostaglandin H2 Synthase Length = 576 Back     alignment and structure
>pdb|1PGE|A Chain A, Prostaglandin H2 Synthase-1 Complexed With P-(2'-Iodo-5'-Thenoyl) Hydrotropic Acid (Iodosuprofen) Length = 576 Back     alignment and structure
>pdb|1CQE|A Chain A, Prostaglandin H2 Synthase-1 Complex With Flurbiprofen Length = 580 Back     alignment and structure
>pdb|1X7A|L Chain L, Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) Methyl]phenyl}-N-[4-(1h-Benzimidazol-1-Yl)-2- Fluorophenyl]- 3-(Trifluoromethyl)-1h-Pyrazole-5-Carboxamide Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-38
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 7e-36
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-28
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-33
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-12
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-30
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-30
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-19
2vh0_B134 Activated factor XA light chain; serine protease, 6e-28
2vh0_B134 Activated factor XA light chain; serine protease, 3e-25
2vh0_B134 Activated factor XA light chain; serine protease, 5e-23
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 9e-27
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-24
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-21
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 9e-24
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 8e-21
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-20
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-12
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-22
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-17
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-06
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-21
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-20
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-18
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-16
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-18
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-14
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-14
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-05
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-15
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-13
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-13
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 9e-14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 7e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-13
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-12
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-06
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-12
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 9e-11
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-10
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-06
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-05
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 8e-12
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-08
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 3e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-09
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-07
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 7e-11
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 5e-07
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 8e-05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 5e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 4e-06
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-05
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-07
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-07
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-07
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 5e-07
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-06
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 7e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-06
2pe4_A424 Hyaluronidase-1; hyaluronan, EGF-like domain, hydr 3e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 7e-05
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 8e-05
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 1e-04
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 1e-04
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 9e-04
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 1e-04
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 3e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 5e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 5e-04
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 7e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  126 bits (320), Expect = 3e-38
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 4/123 (3%)

Query: 20  CESGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCGHG-ICVDQTDGY 78
             + PC++ G C     T   F+C C  G++G  C+ ++++C S+PC +   C+DQ   +
Sbjct: 10  LGANPCEHAGKC---INTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEF 66

Query: 79  RCYCQPGYSGEQCQYEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDP 138
           +C C PGY G  C+   +EC SSPCL+ G C D +  F C C  G+TG  CQ+ +     
Sbjct: 67  QCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILD 126

Query: 139 NPC 141
              
Sbjct: 127 AQK 129
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>2pe4_A Hyaluronidase-1; hyaluronan, EGF-like domain, hydrolase; HET: NAG BMA MAN; 2.00A {Homo sapiens} Length = 424 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.89
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.89
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.89
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.85
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.84
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.82
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.78
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.74
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.73
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.7
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.68
2bou_A143 EGF-like module containing mucin-like hormone rece 99.63
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.63
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.62
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.61
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.6
2bou_A143 EGF-like module containing mucin-like hormone rece 99.6
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.59
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.58
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.57
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.57
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.56
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.55
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.55
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.53
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.51
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.47
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.37
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.32
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.28
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.28
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.27
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.24
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.22
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.21
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.21
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.2
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.2
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.2
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.19
2vh0_B134 Activated factor XA light chain; serine protease, 99.16
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.14
2vh0_B134 Activated factor XA light chain; serine protease, 99.13
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.12
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.09
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.09
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 99.08
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.07
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.03
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.02
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 99.01
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.98
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.96
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.93
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.89
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.88
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.85
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.79
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.77
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.73
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.71
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.71
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.69
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.69
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.57
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.51
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.51
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.47
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.46
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.45
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.45
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.43
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.35
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.3
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.29
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.29
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.27
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.25
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.24
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.15
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.14
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.08
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.0
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.83
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.76
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.76
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 97.56
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.55
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.54
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.48
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.34
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.33
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.31
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.17
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.15
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 96.96
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.87
1ob1_C99 Major merozoite surface protein; immune system, im 96.86
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.84
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.69
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 96.69
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.66
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.6
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.59
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.58
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.58
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.34
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.29
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 96.29
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 96.25
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.13
1szb_A170 Mannose binding lectin-associated serine protease- 96.07
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 95.88
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 95.83
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.81
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.69
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.68
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.64
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.59
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 95.43
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 95.41
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 95.4
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 95.36
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 95.33
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 95.32
2y38_A403 Laminin subunit alpha-5; structural protein, cell 95.28
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.16
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 95.09
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.09
1ob1_C99 Major merozoite surface protein; immune system, im 95.02
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 94.92
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 94.89
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 94.64
2i9a_A145 Urokinase-type plasminogen activator; growth facto 94.61
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 94.39
2wph_E59 Coagulation factor IXA light chain; serine proteas 93.76
1nzi_A159 Complement C1S component; calcium, innate immunity 93.71
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 93.7
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 93.59
1szb_A170 Mannose binding lectin-associated serine protease- 93.46
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 93.39
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 93.32
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 89.41
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 87.94
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 86.58
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.89  E-value=1.2e-22  Score=128.49  Aligned_cols=120  Identities=38%  Similarity=1.035  Sum_probs=96.2

Q ss_pred             CCCCCC--CCCCCCCCeeccCCCCCCceeeeCCCCCCCCCCCCCCCCCCCCCCC-CceEeeCCCCeeeeCCCCCcCCCcc
Q psy8281          16 TSDPCE--SGPCQNGGSCAASNLTAQQFKCLCPPGFSGSLCQHNLDDCASSPCG-HGICVDQTDGYRCYCQPGYSGEQCQ   92 (178)
Q Consensus        16 ~~~~c~--~~~C~~~~~C~~~~~~~~~~~C~C~~g~~g~~C~~~~~~c~~~~c~-~~~c~~~~~~~~C~c~~g~~g~~c~   92 (178)
                      ++++|.  ..+|.++++|++   ..++|+|.|++||+|..|+.++++|...+|. +++|++..++|.|.|.+||.|..|+
T Consensus         4 dideC~~~~~~C~~~g~C~~---~~g~~~C~C~~Gy~G~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~   80 (135)
T 2vj3_A            4 DVDECSLGANPCEHAGKCIN---TLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCE   80 (135)
T ss_dssp             CCCTTTSSSCSSSTTCEEEE---CSSSEEEECCTTEESTTSCEECCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSC
T ss_pred             ccccccCCCCCCCCCCEeEC---CCCCEEEECCCCCcCCcccccCccCCCCCCCCCCEEeCCCCCceeeCCCCCcCCcce
Confidence            357787  678988899987   5678899999999999887677888877776 4788888888889999998888887


Q ss_pred             ccCCCcCCCCCCCCCeEecCCCCeeeecCCCcccCCccccCCCCCC
Q psy8281          93 YEYNECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKVDLCDP  138 (178)
Q Consensus        93 ~~~~~c~~~~c~~~~~c~~~~~~~~C~C~~g~~g~~c~~~~~~c~~  138 (178)
                      .++++|...+|.+++.|++..+.++|.|++||+|..|+.++++|..
T Consensus        81 ~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~i~~C~~  126 (135)
T 2vj3_A           81 VNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILD  126 (135)
T ss_dssp             EECCTTTTCCSTTTCEEEECSSCEEEECCTTEESSSSCEECC----
T ss_pred             ecCCcccCCCcCCCCEeECCCCCeEEECCCCCcCCccCccCccccC
Confidence            6778887778888888888888888888888888888777777753
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 5e-09
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-09
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-06
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 9e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-06
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 8e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.001
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 8e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-05
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.001
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-07
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.002
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-06
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 5e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 6e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 2e-06
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 4e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 2e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.002
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 6e-06
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 7e-06
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 1e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 2e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.002
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 3e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 3e-04
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 3e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 6e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.001
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor X, N-terminal module
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.8 bits (114), Expect = 5e-09
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 96  NECESSPCLNGGSCSDHVGRFSCTCGHGYTGQRCQIKV 133
           ++CE+SPC N G C D +G ++CTC  G+ G+ C++  
Sbjct: 1   DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFT 38
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.27
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 99.19
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 99.16
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.16
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 99.06
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 99.06
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.02
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.98
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.95
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.92
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.92
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.88
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.86
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.84
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.82
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.81
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.79
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.75
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.74
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.73
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.69
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.69
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.65
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.51
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.5
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.44
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.32
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.2
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.16
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.16
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.04
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.98
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.91
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.89
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.81
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1nt0a345 Mannose-binding protein associated serine protease 97.77
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1szba245 Mannose-binding protein associated serine protease 97.72
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.63
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.57
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.57
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.51
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.46
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.09
d1nt0a345 Mannose-binding protein associated serine protease 96.97
d1szba245 Mannose-binding protein associated serine protease 96.9
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.86
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.85
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 96.8
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.74
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.71
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.52
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.22
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 96.12
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.08
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.07
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.99
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 95.95
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.92
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 95.58
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 95.46
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.27
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 95.06
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 94.76
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 94.49
d1ijqa250 Low density lipoprotein (LDL) receptor, different 93.42
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 93.17
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.13
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 90.71
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 88.62
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 82.74
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.27  E-value=4.3e-12  Score=60.21  Aligned_cols=38  Identities=39%  Similarity=1.011  Sum_probs=35.9

Q ss_pred             cCCCCCCCCCCCCCeeeeCCCceeeeCCCCCCCCCCCC
Q psy8281         132 KVDLCDPNPCSHHHYCVDKGNTFACECPKGYQGPNCDV  169 (178)
Q Consensus       132 ~~~~c~~~~c~~~~~c~~~~~~~~C~C~~g~~g~~C~~  169 (178)
                      |+++|.+++|.+++.|++..++|+|.|++||+|+.||+
T Consensus         2 d~d~C~~~PC~ngg~C~~~~~~y~C~C~~g~~G~~Cei   39 (39)
T d1edmb_           2 DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL   39 (39)
T ss_dssp             CCCTTTTCCCCTTCEEEEETTEEEEECCTTCCSTTSCC
T ss_pred             ccccCCCCCCCCCcEEEcCCCCEEEECCCCCCCCCCCC
Confidence            67899999999999999999999999999999999985
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure