Psyllid ID: psy8293
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 124 | ||||||
| 328698580 | 680 | PREDICTED: stAR-related lipid transfer p | 0.943 | 0.172 | 0.570 | 4e-32 | |
| 328791808 | 1914 | PREDICTED: hypothetical protein LOC41070 | 0.927 | 0.060 | 0.589 | 1e-30 | |
| 380028736 | 1650 | PREDICTED: uncharacterized protein LOC10 | 0.927 | 0.069 | 0.589 | 2e-30 | |
| 322802782 | 922 | hypothetical protein SINV_12530 [Solenop | 0.895 | 0.120 | 0.586 | 2e-30 | |
| 332018321 | 936 | StAR-related lipid transfer protein 13 [ | 0.895 | 0.118 | 0.586 | 3e-30 | |
| 350422451 | 1897 | PREDICTED: hypothetical protein LOC10074 | 0.927 | 0.060 | 0.589 | 4e-30 | |
| 340709648 | 1897 | PREDICTED: hypothetical protein LOC10065 | 0.927 | 0.060 | 0.589 | 5e-30 | |
| 383861875 | 1836 | PREDICTED: uncharacterized protein LOC10 | 0.927 | 0.062 | 0.581 | 7e-30 | |
| 345487951 | 1787 | PREDICTED: hypothetical protein LOC10012 | 0.895 | 0.062 | 0.578 | 1e-29 | |
| 242020420 | 969 | Rho-type GTPase activating protein, puta | 0.927 | 0.118 | 0.572 | 2e-28 |
| >gi|328698580|ref|XP_003240675.1| PREDICTED: stAR-related lipid transfer protein 13-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 141 bits (356), Expect = 4e-32, Method: Composition-based stats.
Identities = 69/121 (57%), Positives = 95/121 (78%), Gaps = 4/121 (3%)
Query: 3 KKTKFHHFKNNNSVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTR 62
+KTK K+ +VFGVPL+ N+QK G ALP F+ S+F WL +NA D +G+FRKPGVK+R
Sbjct: 185 RKTKMPDPKDK-TVFGVPLIANVQKYGSALPPFVQSAFRWLEDNALDHVGLFRKPGVKSR 243
Query: 63 IQKLREMADEVDFKLDEVDSQQAYDVADLVKQYFRELPEVLLTNKSSETFMSIFQ--PIY 120
IQ+L+++A E + + + ++ QAYDVAD+VKQYFRELPE LLTNK SE+F++IFQ P+Y
Sbjct: 244 IQRLKQLA-EAEPEDVKFENHQAYDVADMVKQYFRELPEALLTNKLSESFIAIFQHVPVY 302
Query: 121 M 121
+
Sbjct: 303 L 303
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328791808|ref|XP_394183.4| PREDICTED: hypothetical protein LOC410706 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380028736|ref|XP_003698045.1| PREDICTED: uncharacterized protein LOC100869198 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|322802782|gb|EFZ22994.1| hypothetical protein SINV_12530 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332018321|gb|EGI58926.1| StAR-related lipid transfer protein 13 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350422451|ref|XP_003493168.1| PREDICTED: hypothetical protein LOC100745795 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340709648|ref|XP_003393415.1| PREDICTED: hypothetical protein LOC100652305 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383861875|ref|XP_003706410.1| PREDICTED: uncharacterized protein LOC100883858 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345487951|ref|XP_001606903.2| PREDICTED: hypothetical protein LOC100123284 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242020420|ref|XP_002430653.1| Rho-type GTPase activating protein, putative [Pediculus humanus corporis] gi|212515825|gb|EEB17915.1| Rho-type GTPase activating protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 124 | ||||||
| UNIPROTKB|D6RGY9 | 467 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.218 | 0.563 | 3e-25 | |
| FB|FBgn0086901 | 2351 | cv-c "crossveinless c" [Drosop | 0.822 | 0.043 | 0.590 | 8.9e-25 | |
| MGI|MGI:1354949 | 1092 | Dlc1 "deleted in liver cancer | 0.822 | 0.093 | 0.543 | 2.2e-24 | |
| UNIPROTKB|I3LDA3 | 814 | I3LDA3 "Uncharacterized protei | 0.822 | 0.125 | 0.553 | 2.8e-24 | |
| UNIPROTKB|E9PDZ8 | 1125 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.090 | 0.563 | 3e-24 | |
| RGD|68416 | 1091 | Dlc1 "deleted in liver cancer | 0.822 | 0.093 | 0.543 | 3.7e-24 | |
| UNIPROTKB|A7E300 | 1112 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.091 | 0.553 | 3.8e-24 | |
| UNIPROTKB|F1MIZ8 | 1112 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.091 | 0.553 | 3.8e-24 | |
| UNIPROTKB|Q96QB1 | 1528 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.066 | 0.563 | 4.7e-24 | |
| UNIPROTKB|B9VTT2 | 1091 | DLC1 "Rho GTPase-activating pr | 0.822 | 0.093 | 0.553 | 4.7e-24 |
| UNIPROTKB|D6RGY9 DLC1 "Rho GTPase-activating protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 290 (107.1 bits), Expect = 3.0e-25, P = 3.0e-25
Identities = 58/103 (56%), Positives = 76/103 (73%)
Query: 15 SVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADEVD 74
SVFGVPL VN+Q+TG LP+ I + +L N+ DQ+G+FRK GVK+RIQ LR+M +E
Sbjct: 13 SVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQM-NEGA 71
Query: 75 FKLDEVDSQQAYDVADLVKQYFRELPEVLLTNKSSETFMSIFQ 117
+ Q AYDVAD++KQYFR+LPE L+TNK SETF+ I+Q
Sbjct: 72 IDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQ 114
|
|
| FB|FBgn0086901 cv-c "crossveinless c" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1354949 Dlc1 "deleted in liver cancer 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDA3 I3LDA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PDZ8 DLC1 "Rho GTPase-activating protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|68416 Dlc1 "deleted in liver cancer 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7E300 DLC1 "Rho GTPase-activating protein 7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MIZ8 DLC1 "Rho GTPase-activating protein 7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96QB1 DLC1 "Rho GTPase-activating protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9VTT2 DLC1 "Rho GTPase-activating protein 7" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 124 | |||
| cd04375 | 220 | cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase- | 7e-51 | |
| pfam00620 | 152 | pfam00620, RhoGAP, RhoGAP domain | 5e-21 | |
| smart00324 | 174 | smart00324, RhoGAP, GTPase-activator protein for R | 1e-18 | |
| cd00159 | 169 | cd00159, RhoGAP, RhoGAP: GTPase-activator protein | 2e-16 | |
| cd04398 | 192 | cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPas | 2e-12 | |
| cd04394 | 202 | cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGA | 5e-11 | |
| cd04376 | 206 | cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (G | 5e-11 | |
| cd04385 | 184 | cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase- | 2e-10 | |
| cd04381 | 182 | cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTP | 1e-09 | |
| cd04400 | 190 | cd04400, RhoGAP_fBEM3, RhoGAP_fBEM3: RhoGAP (GTPas | 1e-09 | |
| cd04384 | 195 | cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPas | 1e-09 | |
| cd04391 | 216 | cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP | 2e-09 | |
| cd04397 | 213 | cd04397, RhoGAP_fLRG1, RhoGAP_fLRG1: RhoGAP (GTPas | 3e-08 | |
| cd04377 | 186 | cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGA | 4e-08 | |
| cd04387 | 196 | cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-ac | 3e-07 | |
| cd04393 | 189 | cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP | 4e-07 | |
| cd04386 | 203 | cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTP | 6e-07 | |
| cd04404 | 195 | cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGA | 1e-06 | |
| cd04392 | 208 | cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP | 2e-06 | |
| cd04378 | 203 | cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: Rho | 6e-06 | |
| cd04383 | 188 | cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPas | 1e-05 | |
| cd04408 | 200 | cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase- | 3e-05 | |
| cd04402 | 192 | cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP | 3e-05 | |
| cd04395 | 196 | cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP | 7e-05 | |
| cd04409 | 211 | cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPas | 9e-05 | |
| cd04396 | 225 | cd04396, RhoGAP_fSAC7_BAG7, RhoGAP_fSAC7_BAG7: Rho | 1e-04 | |
| cd04406 | 186 | cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: Rho | 2e-04 | |
| cd04407 | 186 | cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: Rho | 2e-04 | |
| cd04390 | 199 | cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24 | 2e-04 | |
| cd04403 | 187 | cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_ | 3e-04 | |
| cd04374 | 203 | cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activato | 6e-04 | |
| cd04389 | 187 | cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase- | 0.001 | |
| cd04379 | 207 | cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase- | 0.004 |
| >gnl|CDD|239840 cd04375, RhoGAP_DLC1, RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins | Back alignment and domain information |
|---|
Score = 160 bits (406), Expect = 7e-51
Identities = 66/103 (64%), Positives = 79/103 (76%), Gaps = 1/103 (0%)
Query: 15 SVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADEVD 74
+VFGVPLLVN+Q+TG LP+ I + WL NNA DQ+G+FRK GVK+RIQKLR M E
Sbjct: 3 NVFGVPLLVNLQRTGQPLPRSIQQAMRWLRNNALDQVGLFRKSGVKSRIQKLRSM-IESS 61
Query: 75 FKLDEVDSQQAYDVADLVKQYFRELPEVLLTNKSSETFMSIFQ 117
D QQAYDVAD++KQYFR+LPE LLTNK SETF++IFQ
Sbjct: 62 TDNVNYDGQQAYDVADMLKQYFRDLPEPLLTNKLSETFIAIFQ 104
|
DLC1 shows in vitro GAP activity towards RhoA and CDC42. Beside its C-terminal GAP domain, DLC1 also contains a SAM (sterile alpha motif) and a START (StAR-related lipid transfer action) domain. DLC1 has tumor suppressor activity in cell culture. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude. Length = 220 |
| >gnl|CDD|216027 pfam00620, RhoGAP, RhoGAP domain | Back alignment and domain information |
|---|
| >gnl|CDD|214618 smart00324, RhoGAP, GTPase-activator protein for Rho-like GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|238090 cd00159, RhoGAP, RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|239863 cd04398, RhoGAP_fRGD1, RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239859 cd04394, RhoGAP-ARHGAP11A, RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239841 cd04376, RhoGAP_ARHGAP6, RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239850 cd04385, RhoGAP_ARAP, RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs | Back alignment and domain information |
|---|
| >gnl|CDD|239846 cd04381, RhoGap_RalBP1, RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin | Back alignment and domain information |
|---|
| >gnl|CDD|239865 cd04400, RhoGAP_fBEM3, RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239849 cd04384, RhoGAP_CdGAP, RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA | Back alignment and domain information |
|---|
| >gnl|CDD|239856 cd04391, RhoGAP_ARHGAP18, RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239862 cd04397, RhoGAP_fLRG1, RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239842 cd04377, RhoGAP_myosin_IX, RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|239852 cd04387, RhoGAP_Bcr, RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239858 cd04393, RhoGAP_FAM13A1a, RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239851 cd04386, RhoGAP_nadrin, RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239869 cd04404, RhoGAP-p50rhoGAP, RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) | Back alignment and domain information |
|---|
| >gnl|CDD|239857 cd04392, RhoGAP_ARHGAP19, RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239843 cd04378, RhoGAP_GMIP_PARG1, RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >gnl|CDD|239848 cd04383, RhoGAP_srGAP, RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs | Back alignment and domain information |
|---|
| >gnl|CDD|239873 cd04408, RhoGAP_GMIP, RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) | Back alignment and domain information |
|---|
| >gnl|CDD|239867 cd04402, RhoGAP_ARHGAP20, RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239860 cd04395, RhoGAP_ARHGAP21, RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239874 cd04409, RhoGAP_PARG1, RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >gnl|CDD|239861 cd04396, RhoGAP_fSAC7_BAG7, RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239871 cd04406, RhoGAP_myosin_IXA, RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA | Back alignment and domain information |
|---|
| >gnl|CDD|239872 cd04407, RhoGAP_myosin_IXB, RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB | Back alignment and domain information |
|---|
| >gnl|CDD|239855 cd04390, RhoGAP_ARHGAP22_24_25, RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239868 cd04403, RhoGAP_ARHGAP27_15_12_9, RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains | Back alignment and domain information |
|---|
| >gnl|CDD|239839 cd04374, RhoGAP_Graf, RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239854 cd04389, RhoGAP_KIAA1688, RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239844 cd04379, RhoGAP_SYD1, RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| cd04375 | 220 | RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator | 99.98 | |
| cd04408 | 200 | RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator | 99.97 | |
| cd04383 | 188 | RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato | 99.97 | |
| cd04378 | 203 | RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas | 99.97 | |
| cd04409 | 211 | RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato | 99.97 | |
| cd04372 | 194 | RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- | 99.97 | |
| cd04407 | 186 | RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas | 99.97 | |
| cd04387 | 196 | RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr | 99.97 | |
| cd04384 | 195 | RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato | 99.97 | |
| cd04381 | 182 | RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa | 99.97 | |
| cd04406 | 186 | RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas | 99.97 | |
| cd04403 | 187 | RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G | 99.97 | |
| cd04379 | 207 | RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator | 99.97 | |
| cd04390 | 199 | RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas | 99.96 | |
| cd04397 | 213 | RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato | 99.96 | |
| cd04396 | 225 | RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas | 99.96 | |
| cd04402 | 192 | RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac | 99.96 | |
| cd04386 | 203 | RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa | 99.96 | |
| cd04391 | 216 | RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac | 99.96 | |
| cd04393 | 189 | RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac | 99.96 | |
| cd04377 | 186 | RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- | 99.96 | |
| cd04373 | 185 | RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator | 99.96 | |
| cd04398 | 192 | RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato | 99.96 | |
| cd04404 | 195 | RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- | 99.96 | |
| cd04400 | 190 | RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato | 99.95 | |
| KOG2200|consensus | 674 | 99.95 | ||
| cd04394 | 202 | RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- | 99.95 | |
| cd04389 | 187 | RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator | 99.95 | |
| cd04395 | 196 | RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac | 99.95 | |
| cd04399 | 212 | RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activato | 99.95 | |
| cd04382 | 193 | RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- | 99.95 | |
| cd04388 | 200 | RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr | 99.94 | |
| cd04385 | 184 | RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator | 99.94 | |
| cd04376 | 206 | RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti | 99.94 | |
| cd04392 | 208 | RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac | 99.92 | |
| cd04380 | 220 | RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato | 99.91 | |
| cd04374 | 203 | RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein | 99.9 | |
| KOG4269|consensus | 1112 | 99.89 | ||
| smart00324 | 174 | RhoGAP GTPase-activator protein for Rho-like GTPas | 99.88 | |
| KOG2710|consensus | 412 | 99.87 | ||
| KOG1450|consensus | 650 | 99.86 | ||
| PF00620 | 151 | RhoGAP: RhoGAP domain; InterPro: IPR000198 Members | 99.86 | |
| cd00159 | 169 | RhoGAP RhoGAP: GTPase-activator protein (GAP) for | 99.85 | |
| KOG4407|consensus | 1973 | 99.82 | ||
| KOG4270|consensus | 577 | 99.79 | ||
| KOG4406|consensus | 467 | 99.78 | ||
| KOG1453|consensus | 918 | 99.78 | ||
| KOG3564|consensus | 604 | 99.77 | ||
| KOG1452|consensus | 442 | 99.71 | ||
| KOG1117|consensus | 1186 | 99.6 | ||
| KOG4271|consensus | 1100 | 99.53 | ||
| KOG1451|consensus | 812 | 99.52 | ||
| cd04401 | 198 | RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activato | 99.18 | |
| cd04405 | 235 | RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPas | 99.15 | |
| KOG4724|consensus | 741 | 99.15 | ||
| KOG3565|consensus | 640 | 98.36 | ||
| KOG4370|consensus | 514 | 98.3 | ||
| PF08101 | 420 | DUF1708: Domain of unknown function (DUF1708); Int | 97.73 | |
| KOG4724|consensus | 741 | 97.71 | ||
| KOG1453|consensus | 918 | 86.81 |
| >cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins | Back alignment and domain information |
|---|
Probab=99.98 E-value=8.6e-32 Score=191.80 Aligned_cols=105 Identities=62% Similarity=0.981 Sum_probs=97.7
Q ss_pred CcccccchHHHHhhhCCCCcHHHHHHHHHHHhcCCCccCeeecCCChHHHHHHHHHHhcCCCCCCCCCCCCHHHHHHHHH
Q psy8293 14 NSVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADEVDFKLDEVDSQQAYDVADLVK 93 (124)
Q Consensus 14 ~~vFG~~L~~~~~~~~~~vP~~l~~~~~~l~~~gl~~eGifR~~g~~~~i~~l~~~~~~~~~~~~~~~~~~~~~va~~lK 93 (124)
+++||+||+.++++.|..||.+|..|++||+.+|+++|||||++|+..++++|++.+|.+....+ ++..++|+||++||
T Consensus 2 ~~vFGvpL~~~~~r~g~~IP~~i~~~i~~L~~~gl~~eGIFR~sG~~~~i~~L~~~~d~~~~~~~-~~~~~~~~va~lLK 80 (220)
T cd04375 2 KNVFGVPLLVNLQRTGQPLPRSIQQAMRWLRNNALDQVGLFRKSGVKSRIQKLRSMIESSTDNVN-YDGQQAYDVADMLK 80 (220)
T ss_pred CCEecCcHHHHHhhcCCCCChHHHHHHHHHHHhCCCccceeecCCcHHHHHHHHHHHhcCCCccC-cccccHHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999998755555 67789999999999
Q ss_pred HHHhhCCCCCCChHHHHHHHHHhccc
Q psy8293 94 QYFRELPEVLLTNKSSETFMSIFQPI 119 (124)
Q Consensus 94 ~flr~Lp~PLl~~~~~~~~~~~~~~~ 119 (124)
.|||+||+||+|.++|+.|+++++..
T Consensus 81 ~flReLPePLlt~~l~~~fi~~~~~~ 106 (220)
T cd04375 81 QYFRDLPEPLLTNKLSETFIAIFQYV 106 (220)
T ss_pred HHHHhCCCccCCHHHHHHHHHHHhcC
Confidence 99999999999999999999987644
|
DLC1 shows in vitro GAP activity towards RhoA and CDC42. Beside its C-terminal GAP domain, DLC1 also contains a SAM (sterile alpha motif) and a START (StAR-related lipid transfer action) domain. DLC1 has tumor suppressor activity in cell culture. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude. |
| >cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) | Back alignment and domain information |
|---|
| >cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs | Back alignment and domain information |
|---|
| >cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins | Back alignment and domain information |
|---|
| >cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB | Back alignment and domain information |
|---|
| >cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins | Back alignment and domain information |
|---|
| >cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA | Back alignment and domain information |
|---|
| >cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin | Back alignment and domain information |
|---|
| >cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA | Back alignment and domain information |
|---|
| >cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains | Back alignment and domain information |
|---|
| >cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins | Back alignment and domain information |
|---|
| >cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins | Back alignment and domain information |
|---|
| >cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins | Back alignment and domain information |
|---|
| >cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins | Back alignment and domain information |
|---|
| >cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins | Back alignment and domain information |
|---|
| >cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins | Back alignment and domain information |
|---|
| >cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins | Back alignment and domain information |
|---|
| >cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins | Back alignment and domain information |
|---|
| >cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins | Back alignment and domain information |
|---|
| >cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins | Back alignment and domain information |
|---|
| >cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) | Back alignment and domain information |
|---|
| >cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins | Back alignment and domain information |
|---|
| >KOG2200|consensus | Back alignment and domain information |
|---|
| >cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins | Back alignment and domain information |
|---|
| >cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain | Back alignment and domain information |
|---|
| >cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins | Back alignment and domain information |
|---|
| >cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins | Back alignment and domain information |
|---|
| >cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins | Back alignment and domain information |
|---|
| >cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) | Back alignment and domain information |
|---|
| >cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs | Back alignment and domain information |
|---|
| >cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins | Back alignment and domain information |
|---|
| >cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins | Back alignment and domain information |
|---|
| >cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins | Back alignment and domain information |
|---|
| >cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins | Back alignment and domain information |
|---|
| >KOG4269|consensus | Back alignment and domain information |
|---|
| >smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases | Back alignment and domain information |
|---|
| >KOG2710|consensus | Back alignment and domain information |
|---|
| >KOG1450|consensus | Back alignment and domain information |
|---|
| >PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation | Back alignment and domain information |
|---|
| >cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >KOG4270|consensus | Back alignment and domain information |
|---|
| >KOG4406|consensus | Back alignment and domain information |
|---|
| >KOG1453|consensus | Back alignment and domain information |
|---|
| >KOG3564|consensus | Back alignment and domain information |
|---|
| >KOG1452|consensus | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG4271|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >cd04401 RhoGAP_fMSB1 RhoGAP_fMSB1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal MSB1-like proteins | Back alignment and domain information |
|---|
| >cd04405 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of BRCC3-like proteins | Back alignment and domain information |
|---|
| >KOG4724|consensus | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >KOG4370|consensus | Back alignment and domain information |
|---|
| >PF08101 DUF1708: Domain of unknown function (DUF1708); InterPro: IPR012965 This is a fungal domain of unknown function, though the yeast protein MSB1(P21339 from SWISSPROT) which contains this domain is thought to play a role in bud formation [] | Back alignment and domain information |
|---|
| >KOG4724|consensus | Back alignment and domain information |
|---|
| >KOG1453|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 124 | ||||
| 3kuq_A | 228 | Crystal Structure Of The Dlc1 Rhogap Domain Length | 1e-28 | ||
| 3iug_A | 229 | Crystal Structure Of The Rhogap Domain Of Rics Leng | 7e-07 | ||
| 3eap_A | 271 | Crystal Structure Of The Rhogap Domain Of Arhgap11a | 2e-06 | ||
| 3byi_A | 214 | Crystal Structure Of Human Rho Gtpase Activating Pr | 1e-04 |
| >pdb|3KUQ|A Chain A, Crystal Structure Of The Dlc1 Rhogap Domain Length = 228 | Back alignment and structure |
|
| >pdb|3IUG|A Chain A, Crystal Structure Of The Rhogap Domain Of Rics Length = 229 | Back alignment and structure |
| >pdb|3EAP|A Chain A, Crystal Structure Of The Rhogap Domain Of Arhgap11a Length = 271 | Back alignment and structure |
| >pdb|3BYI|A Chain A, Crystal Structure Of Human Rho Gtpase Activating Protein 15 (arhgap15) Length = 214 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 124 | |||
| 3kuq_A | 228 | RHO GTPase-activating protein 7; structural genomi | 8e-33 | |
| 3eap_A | 271 | RHO GTPase-activating protein 11A; GAP, structural | 3e-21 | |
| 2osa_A | 202 | N-chimaerin; RHO-GAP, GTPase activation, structura | 5e-19 | |
| 3byi_A | 214 | RHO GTPase activating protein 15; BM046, arhgap15, | 5e-19 | |
| 1tx4_A | 198 | P50-rhogap; complex (GTPase activation/proto-oncog | 1e-18 | |
| 3msx_B | 201 | RHO GTPase-activating protein 20; protein-proten c | 4e-18 | |
| 1ow3_A | 242 | RHO-GTPase-activating protein 1; complex, GTPase, | 1e-17 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 3e-17 | |
| 3iug_A | 229 | RHO/CDC42/RAC GTPase-activating protein RICS; stru | 6e-17 | |
| 2ee4_A | 209 | RHO GTPase activating protein 5 variant; all alpha | 1e-16 | |
| 3fk2_A | 246 | Glucocorticoid receptor DNA-binding factor 1; stru | 3e-16 | |
| 1f7c_A | 231 | Rhogap protein; GTPase activating protein, RHO GTP | 7e-16 | |
| 1pbw_A | 216 | Rhogap domain, phosphatidylinositol 3-kinase; phos | 1e-13 | |
| 3qis_A | 366 | Inositol polyphosphate 5-phosphatase OCRL-1; DENT | 2e-13 | |
| 2ovj_A | 201 | Mgcracgap, RAC GTPase-activating protein 1; signal | 3e-13 | |
| 2xs6_A | 214 | Phosphatidylinositol 3-kinase regulatory subunit; | 1e-09 |
| >3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
Score = 113 bits (285), Expect = 8e-33
Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (0%)
Query: 13 NNSVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADE 72
SVFGVPL VN+Q+TG LP+ I + +L N+ DQ+G+FRK GVK+RIQ LR+M +
Sbjct: 17 QGSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEG 76
Query: 73 VDFKLDEVDSQQAYDVADLVKQYFRELPEVLLTNKSSETFMSIFQ 117
+ Q AYDVAD++KQYFR+LPE L+TNK SETF+ I+Q
Sbjct: 77 -AIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQ 120
|
| >3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Length = 198 | Back alignment and structure |
|---|
| >3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Length = 242 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 | Back alignment and structure |
|---|
| >3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Length = 209 | Back alignment and structure |
|---|
| >3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Length = 231 | Back alignment and structure |
|---|
| >1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Length = 216 | Back alignment and structure |
|---|
| >3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Length = 366 | Back alignment and structure |
|---|
| >2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| 3kuq_A | 228 | RHO GTPase-activating protein 7; structural genomi | 99.97 | |
| 2osa_A | 202 | N-chimaerin; RHO-GAP, GTPase activation, structura | 99.97 | |
| 3byi_A | 214 | RHO GTPase activating protein 15; BM046, arhgap15, | 99.97 | |
| 3msx_B | 201 | RHO GTPase-activating protein 20; protein-proten c | 99.97 | |
| 3iug_A | 229 | RHO/CDC42/RAC GTPase-activating protein RICS; stru | 99.97 | |
| 1tx4_A | 198 | P50-rhogap; complex (GTPase activation/proto-oncog | 99.96 | |
| 1ow3_A | 242 | RHO-GTPase-activating protein 1; complex, GTPase, | 99.96 | |
| 1pbw_A | 216 | Rhogap domain, phosphatidylinositol 3-kinase; phos | 99.96 | |
| 2ee4_A | 209 | RHO GTPase activating protein 5 variant; all alpha | 99.96 | |
| 3fk2_A | 246 | Glucocorticoid receptor DNA-binding factor 1; stru | 99.95 | |
| 2ovj_A | 201 | Mgcracgap, RAC GTPase-activating protein 1; signal | 99.95 | |
| 2xs6_A | 214 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.95 | |
| 3eap_A | 271 | RHO GTPase-activating protein 11A; GAP, structural | 99.94 | |
| 1f7c_A | 231 | Rhogap protein; GTPase activating protein, RHO GTP | 99.94 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.94 | |
| 3qis_A | 366 | Inositol polyphosphate 5-phosphatase OCRL-1; DENT | 99.93 |
| >3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=5.1e-32 Score=192.88 Aligned_cols=111 Identities=51% Similarity=0.811 Sum_probs=101.1
Q ss_pred CCCCCCCCcccccchHHHHhhhCCCCcHHHHHHHHHHHhcCCCccCeeecCCChHHHHHHHHHHhcCCCCCCCCCCCCHH
Q psy8293 7 FHHFKNNNSVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADEVDFKLDEVDSQQAY 86 (124)
Q Consensus 7 ~~~~~~~~~vFG~~L~~~~~~~~~~vP~~l~~~~~~l~~~gl~~eGifR~~g~~~~i~~l~~~~~~~~~~~~~~~~~~~~ 86 (124)
.++.++ +++||++|++++++++..||.+|..|+++|+++|+++|||||++|+..++++|++.+|.+...++ ++..|+|
T Consensus 12 ~~~~~~-~~vFGv~L~~~~~~~~~~vP~~v~~~i~~l~~~gl~~eGIfR~sG~~~~i~~L~~~~d~~~~~~~-~~~~~~~ 89 (228)
T 3kuq_A 12 ENLYFQ-GSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVN-YEGQSAY 89 (228)
T ss_dssp --CBCT-TSSTTCCHHHHHHHHSSSSCHHHHHHHHHHHHHCTTSTTTTTSCCCHHHHHHHHHHHTBSSSCCC-CTTCCHH
T ss_pred CCCCCC-CCEECCchHHHHHHcCCCCCHHHHHHHHHHHHhCCCcCCeeecCCCHHHHHHHHHHHhcCCCcCC-cccCCHH
Confidence 344455 89999999999999999999999999999999999999999999999999999999998766777 7788999
Q ss_pred HHHHHHHHHHhhCCCCCCChHHHHHHHHHhccc
Q psy8293 87 DVADLVKQYFRELPEVLLTNKSSETFMSIFQPI 119 (124)
Q Consensus 87 ~va~~lK~flr~Lp~PLl~~~~~~~~~~~~~~~ 119 (124)
+||++||.|||+||+||+|.++|+.|+++++..
T Consensus 90 ~va~lLK~fLReLPePLl~~~l~~~~~~~~~~~ 122 (228)
T 3kuq_A 90 DVADMLKQYFRDLPEPLMTNKLSETFLQIYQYV 122 (228)
T ss_dssp HHHHHHHHHHHHSSSCTTCSSHHHHHHHHHHHS
T ss_pred HHHHHHHHHHHhCCCCCCCHHHHHHHHHHHhcC
Confidence 999999999999999999999999999987643
|
| >2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* | Back alignment and structure |
|---|
| >1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* | Back alignment and structure |
|---|
| >1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A | Back alignment and structure |
|---|
| >3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} | Back alignment and structure |
|---|
| >2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3eap_A RHO GTPase-activating protein 11A; GAP, structural genomics consortium, GTPase activation, phosphoprotein, polymorphism hydrolase activator, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 124 | ||||
| d1xa6a1 | 196 | a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal d | 2e-19 | |
| d1tx4a_ | 196 | a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapi | 2e-15 | |
| d1pbwa_ | 184 | a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Hu | 4e-11 | |
| d1f7ca_ | 191 | a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxI | 1e-10 |
| >d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GTPase activation domain, GAP superfamily: GTPase activation domain, GAP family: BCR-homology GTPase activation domain (BH-domain) domain: Beta-chimaerin, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 77.1 bits (189), Expect = 2e-19
Identities = 16/111 (14%), Positives = 36/111 (32%), Gaps = 2/111 (1%)
Query: 16 VFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREM--ADEV 73
V+ L ++ P + + G++R G I+ ++ D
Sbjct: 2 VYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGE 61
Query: 74 DFKLDEVDSQQAYDVADLVKQYFRELPEVLLTNKSSETFMSIFQPIYMYHK 124
+ + +K YFR+LP ++T + F+ + +
Sbjct: 62 KADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADER 112
|
| >d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Length = 191 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 124 | |||
| d1xa6a1 | 196 | Beta-chimaerin, C-terminal domain {Human (Homo sap | 99.97 | |
| d1tx4a_ | 196 | p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 | 99.95 | |
| d1pbwa_ | 184 | p85 alpha subunit RhoGAP domain {Human (Homo sapie | 99.92 | |
| d1f7ca_ | 191 | Graf {Chicken (Gallus gallus) [TaxId: 9031]} | 99.89 | |
| d2plia1 | 84 | Uncharacterized protein NMB0537 {Neisseria meningi | 84.64 | |
| d2r2za1 | 84 | Putative hemolysin EF0700 {Enterococcus faecalis [ | 81.83 |
| >d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GTPase activation domain, GAP superfamily: GTPase activation domain, GAP family: BCR-homology GTPase activation domain (BH-domain) domain: Beta-chimaerin, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=1.5e-30 Score=179.37 Aligned_cols=104 Identities=17% Similarity=0.239 Sum_probs=94.2
Q ss_pred cccccchHHHHhhhCCCCcHHHHHHHHHHHhcCCCccCeeecCCChHHHHHHHHHHhcCCCCCC--CCCCCCHHHHHHHH
Q psy8293 15 SVFGVPLLVNIQKTGYALPKFIISSFEWLINNASDQIGIFRKPGVKTRIQKLREMADEVDFKLD--EVDSQQAYDVADLV 92 (124)
Q Consensus 15 ~vFG~~L~~~~~~~~~~vP~~l~~~~~~l~~~gl~~eGifR~~g~~~~i~~l~~~~~~~~~~~~--~~~~~~~~~va~~l 92 (124)
++||+||++++++++..||.+|..|++||+++|+++|||||++|+..+++++++.+|++....+ .....|+|++|++|
T Consensus 1 kiFg~~L~~~~~~~~~~iP~iv~~~i~~l~~~gl~~eGiFR~~g~~~~v~~l~~~~~~~~~~~~~~~~~~~d~~~va~~l 80 (196)
T d1xa6a1 1 KVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGAL 80 (196)
T ss_dssp CCTTSCHHHHHHHHTCSSCHHHHHHHHHHHHSCSSSTTTTTSCCCHHHHHHHHHHHSSTTTTSCCCSSSSCCTHHHHHHH
T ss_pred CccCCCHHHHHHhcCCCCChHHHHHHHHHHHhCCCCCCeeeeCCCHHHHHHHHHHHhcCCCccccccccccchhHHHHHH
Confidence 5899999999999999999999999999999999999999999999999999999998655444 12345899999999
Q ss_pred HHHHhhCCCCCCChHHHHHHHHHhcc
Q psy8293 93 KQYFRELPEVLLTNKSSETFMSIFQP 118 (124)
Q Consensus 93 K~flr~Lp~PLl~~~~~~~~~~~~~~ 118 (124)
|.|||+||+||+|.++|+.+.++.+.
T Consensus 81 K~fLr~Lp~pli~~~~~~~~~~~~~~ 106 (196)
T d1xa6a1 81 KLYFRDLPIPVITYDTYSKFIDAAKI 106 (196)
T ss_dssp HHHHHHCSSCTTCSTTHHHHHTTTTC
T ss_pred HHHHHhCCCccCCHHHHHHHHHHHhc
Confidence 99999999999999999999887754
|
| >d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|