Psyllid ID: psy8369
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 242006054 | 287 | cAMP-dependent protein kinase catalytic | 0.926 | 0.264 | 0.631 | 6e-24 | |
| 321469590 | 146 | hypothetical protein DAPPUDRAFT_51329 [D | 0.926 | 0.520 | 0.618 | 1e-21 | |
| 195160731 | 713 | GL24922 [Drosophila persimilis] gi|19411 | 0.926 | 0.106 | 0.565 | 4e-20 | |
| 28574900 | 583 | cAMP-dependent protein kinase 3, isoform | 0.926 | 0.130 | 0.565 | 4e-20 | |
| 195129769 | 500 | GI11297 [Drosophila mojavensis] gi|19392 | 0.926 | 0.152 | 0.539 | 4e-20 | |
| 21429726 | 585 | AT10577p [Drosophila melanogaster] | 0.926 | 0.129 | 0.565 | 4e-20 | |
| 85238 | 502 | protein kinase catalytic chain homolog D | 0.926 | 0.151 | 0.565 | 4e-20 | |
| 24664872 | 500 | cAMP-dependent protein kinase 3, isoform | 0.926 | 0.152 | 0.565 | 4e-20 | |
| 195435840 | 545 | GK20594 [Drosophila willistoni] gi|19416 | 0.926 | 0.139 | 0.565 | 4e-20 | |
| 195495359 | 588 | GE19804 [Drosophila yakuba] gi|194181334 | 0.926 | 0.129 | 0.565 | 4e-20 |
| >gi|242006054|ref|XP_002423871.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] gi|212507117|gb|EEB11133.1| cAMP-dependent protein kinase catalytic subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 114 bits (285), Expect = 6e-24, Method: Compositional matrix adjust.
Identities = 48/76 (63%), Positives = 63/76 (82%)
Query: 7 RDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWK 66
R + ++NGA+DVKRHRWFK +DW +VYY++ KPPI+P V YDGDTRNF++YPE+DWK
Sbjct: 212 RTKRLGNMKNGAEDVKRHRWFKEIDWTEVYYKQLKPPILPHVKYDGDTRNFEDYPESDWK 271
Query: 67 AAPSVGETEQSLFDDF 82
+ PSVGE+E LF+DF
Sbjct: 272 SKPSVGESELKLFEDF 287
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321469590|gb|EFX80570.1| hypothetical protein DAPPUDRAFT_51329 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|195160731|ref|XP_002021227.1| GL24922 [Drosophila persimilis] gi|194118340|gb|EDW40383.1| GL24922 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|28574900|ref|NP_730083.2| cAMP-dependent protein kinase 3, isoform B [Drosophila melanogaster] gi|73620971|sp|P16912.2|KDC2_DROME RecName: Full=Protein kinase DC2 gi|28380514|gb|AAN11771.2| cAMP-dependent protein kinase 3, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195129769|ref|XP_002009327.1| GI11297 [Drosophila mojavensis] gi|193920936|gb|EDW19803.1| GI11297 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|21429726|gb|AAM50541.1| AT10577p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|85238|pir||F31751 protein kinase catalytic chain homolog DC2 - fruit fly (Drosophila sp.) gi|7816|emb|CAA34835.1| unnamed protein product [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|24664872|ref|NP_524097.2| cAMP-dependent protein kinase 3, isoform A [Drosophila melanogaster] gi|23093395|gb|AAF49568.2| cAMP-dependent protein kinase 3, isoform A [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195435840|ref|XP_002065887.1| GK20594 [Drosophila willistoni] gi|194161972|gb|EDW76873.1| GK20594 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195495359|ref|XP_002095233.1| GE19804 [Drosophila yakuba] gi|194181334|gb|EDW94945.1| GE19804 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| FB|FBgn0000489 | 583 | Pka-C3 "cAMP-dependent protein | 0.926 | 0.130 | 0.565 | 2.5e-22 | |
| UNIPROTKB|F1NJ64 | 302 | PRKX "Uncharacterized protein" | 0.926 | 0.251 | 0.526 | 4e-19 | |
| UNIPROTKB|F1PXN7 | 279 | PRKX "Uncharacterized protein" | 0.926 | 0.272 | 0.513 | 1.1e-18 | |
| UNIPROTKB|F1RZ05 | 315 | PRKX "Uncharacterized protein" | 0.829 | 0.215 | 0.558 | 2.8e-18 | |
| ZFIN|ZDB-GENE-090313-408 | 357 | prkx "protein kinase, X-linked | 0.926 | 0.212 | 0.486 | 3.7e-18 | |
| UNIPROTKB|P51817 | 358 | PRKX "cAMP-dependent protein k | 0.926 | 0.212 | 0.486 | 1.4e-17 | |
| UNIPROTKB|F1N591 | 303 | PRKX "Uncharacterized protein" | 0.926 | 0.250 | 0.473 | 4.1e-17 | |
| MGI|MGI:1309999 | 355 | Prkx "protein kinase, X-linked | 0.926 | 0.214 | 0.460 | 8.6e-17 | |
| RGD|1564076 | 358 | Prkx "protein kinase, X-linked | 0.926 | 0.212 | 0.460 | 1.5e-16 | |
| WB|WBGene00018569 | 398 | F47F2.1a.2 [Caenorhabditis ele | 0.829 | 0.170 | 0.420 | 2.8e-12 |
| FB|FBgn0000489 Pka-C3 "cAMP-dependent protein kinase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 267 (99.0 bits), Expect = 2.5e-22, P = 2.5e-22
Identities = 43/76 (56%), Positives = 59/76 (77%)
Query: 7 RDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWK 66
R + ++NGADDVKRHRWFK ++W DVY ++ KPPI+P+VH+DGDT+NFD+YPE DWK
Sbjct: 508 RTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWK 567
Query: 67 AAPSVGETEQSLFDDF 82
A +V + + F+DF
Sbjct: 568 PAKAVDQRDLQYFNDF 583
|
|
| UNIPROTKB|F1NJ64 PRKX "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXN7 PRKX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZ05 PRKX "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-408 prkx "protein kinase, X-linked" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51817 PRKX "cAMP-dependent protein kinase catalytic subunit PRKX" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N591 PRKX "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1309999 Prkx "protein kinase, X-linked" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1564076 Prkx "protein kinase, X-linked" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00018569 F47F2.1a.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 6e-23 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 1e-17 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 6e-17 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 3e-14 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 5e-13 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 3e-12 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 3e-10 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 4e-10 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 2e-09 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 2e-09 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 3e-09 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 5e-09 | |
| smart00133 | 64 | smart00133, S_TK_X, Extension to Ser/Thr-type prot | 6e-08 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 6e-08 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 6e-08 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 7e-08 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 1e-07 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 2e-07 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 2e-07 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 2e-07 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 2e-07 | |
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 4e-07 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 4e-07 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 7e-07 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 1e-06 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 1e-06 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 1e-06 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 2e-06 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 2e-06 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 3e-06 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 3e-06 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 3e-06 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 3e-06 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 5e-06 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 7e-06 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 8e-06 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 1e-05 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 1e-05 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 2e-05 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 2e-05 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 2e-05 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 4e-05 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 6e-05 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 8e-05 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 2e-04 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 3e-04 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 5e-04 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 6e-04 | |
| cd05602 | 325 | cd05602, STKc_SGK1, Catalytic domain of the Protei | 7e-04 | |
| cd05616 | 323 | cd05616, STKc_cPKC_beta, Catalytic domain of the P | 9e-04 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 9e-04 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 0.001 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 0.002 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 0.003 |
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
Score = 88.3 bits (219), Expect = 6e-23
Identities = 34/48 (70%), Positives = 40/48 (83%)
Query: 14 LRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYP 61
++NGADDVK HRWFK VDW DV R+ KPPIVP+V +DGDT NFD+YP
Sbjct: 244 MKNGADDVKNHRWFKSVDWDDVPQRKLKPPIVPKVSHDGDTSNFDDYP 291
|
Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyte/macrophage lineage differentiation, renal cell epithelial migration, and tubular morphogenesis in the developing kidney. Length = 291 |
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| KOG0694|consensus | 694 | 99.89 | ||
| KOG0695|consensus | 593 | 99.78 | ||
| KOG0696|consensus | 683 | 99.78 | ||
| KOG0690|consensus | 516 | 99.77 | ||
| KOG0616|consensus | 355 | 99.73 | ||
| KOG0598|consensus | 357 | 99.69 | ||
| KOG0986|consensus | 591 | 99.68 | ||
| KOG0605|consensus | 550 | 99.66 | ||
| KOG0614|consensus | 732 | 99.66 | ||
| KOG0612|consensus | 1317 | 99.5 | ||
| KOG0610|consensus | 459 | 99.46 | ||
| KOG0608|consensus | 1034 | 99.42 | ||
| KOG0603|consensus | 612 | 99.31 | ||
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.27 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.22 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.2 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.2 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.19 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.17 | |
| smart00133 | 64 | S_TK_X Extension to Ser/Thr-type protein kinases. | 99.16 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.14 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.13 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.13 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.1 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.08 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.06 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.0 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 98.97 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.97 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 98.95 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 98.91 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 98.9 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 98.85 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.85 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 98.84 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 98.84 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 98.81 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 98.79 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 98.75 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 98.74 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.74 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 98.7 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 98.68 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 98.66 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 98.63 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.6 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 98.59 | |
| KOG0592|consensus | 604 | 98.53 | ||
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 98.48 | |
| KOG0606|consensus | 1205 | 98.42 | ||
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 98.41 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 98.4 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 98.4 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.39 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 98.38 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 98.36 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.3 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 98.28 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 98.27 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.22 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.21 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.21 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 98.2 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 98.17 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.16 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 98.12 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 97.99 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 97.94 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 97.92 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 97.88 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 97.86 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 97.74 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 97.66 | |
| KOG0606|consensus | 1205 | 97.63 | ||
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 97.41 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 97.38 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 97.38 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 97.22 | |
| PF00433 | 48 | Pkinase_C: Protein kinase C terminal domain; Inter | 96.94 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 96.94 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 96.54 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 96.02 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.81 | |
| PTZ00284 | 467 | protein kinase; Provisional | 94.24 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 94.15 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 94.12 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 93.86 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 93.82 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 93.72 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 93.59 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 93.47 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 93.18 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 92.9 | |
| KOG0615|consensus | 475 | 92.73 | ||
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 92.32 | |
| KOG0585|consensus | 576 | 92.08 | ||
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 91.92 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 91.71 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 91.56 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 91.19 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 90.96 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 90.9 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 90.86 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 90.85 | |
| KOG0603|consensus | 612 | 90.03 | ||
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 89.98 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 89.66 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 89.61 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 89.42 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 89.3 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 89.1 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 89.08 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 88.79 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 88.47 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 88.3 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 88.21 | |
| KOG0671|consensus | 415 | 87.53 | ||
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 87.02 | |
| KOG0583|consensus | 370 | 86.69 | ||
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 86.59 | |
| KOG0599|consensus | 411 | 86.51 | ||
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 85.99 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 85.92 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 85.69 | |
| KOG0604|consensus | 400 | 85.58 | ||
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 85.55 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 85.37 | |
| KOG0593|consensus | 396 | 85.1 | ||
| KOG0575|consensus | 592 | 85.09 | ||
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 84.97 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 84.75 | |
| KOG0581|consensus | 364 | 84.75 | ||
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 84.52 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 84.45 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 84.32 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 83.76 | |
| KOG0665|consensus | 369 | 83.11 | ||
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 82.82 | |
| KOG0597|consensus | 808 | 82.71 | ||
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 81.93 | |
| KOG0582|consensus | 516 | 81.36 | ||
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 81.2 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 80.83 | |
| KOG0588|consensus | 786 | 80.62 | ||
| KOG0032|consensus | 382 | 80.56 | ||
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 80.34 |
| >KOG0694|consensus | Back alignment and domain information |
|---|
Probab=99.89 E-value=6.4e-24 Score=149.27 Aligned_cols=81 Identities=36% Similarity=0.649 Sum_probs=76.0
Q ss_pred CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369 2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ 76 (82)
Q Consensus 2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~ 76 (82)
||.++|++|||++.+++++|+.||||++|||+.|++|+++|||+|.++++.|.+||| +|+.+.+.+++. ++.++|
T Consensus 602 ll~k~p~kRLG~~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i~~~~D~snFd~eFt~e~p~Lt~~~~~~l~~~~q 681 (694)
T KOG0694|consen 602 LLRKNPEKRLGSGERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTIKGPEDVSNFDEEFTSEKPALTPSDPRPLTEEEQ 681 (694)
T ss_pred HhccCcccccCCCCCCchhhhhCCccccCCHHHHhhccCCCCCCcccCChhhhcccchhhhcCCCccCCCCccccchhhH
Confidence 789999999999989999999999999999999999999999999999999999999 999999998864 456789
Q ss_pred cccCCC
Q psy8369 77 SLFDDF 82 (82)
Q Consensus 77 ~~F~~F 82 (82)
..|.+|
T Consensus 682 ~~F~~F 687 (694)
T KOG0694|consen 682 EAFRDF 687 (694)
T ss_pred HHhcCc
Confidence 999987
|
|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >smart00133 S_TK_X Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0671|consensus | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 4dg3_E | 371 | Crystal Structure Of R336a Mutant Of Camp-dependent | 2e-10 | ||
| 2f7e_E | 351 | Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu | 4e-10 | ||
| 1ctp_E | 350 | Structure Of The Mammalian Catalytic Subunit Of Cam | 4e-10 | ||
| 3o7l_B | 350 | Crystal Structure Of Phospholamban (1-19):pka C-Sub | 5e-10 | ||
| 4dfy_A | 371 | Crystal Structure Of R194a Mutant Of Camp-Dependent | 1e-09 | ||
| 1xh9_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 1e-09 | ||
| 1rdq_E | 350 | Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of | 1e-09 | ||
| 2jdt_A | 351 | Structure Of Pka-Pkb Chimera Complexed With Isoquin | 1e-09 | ||
| 1smh_A | 350 | Protein Kinase A Variant Complex With Completely Or | 1e-09 | ||
| 4dfx_E | 350 | Crystal Structure Of Myristoylated K7c Catalytic Su | 1e-09 | ||
| 3qam_E | 350 | Crystal Structure Of Glu208ala Mutant Of Catalytic | 1e-09 | ||
| 2vo0_A | 351 | Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 | 1e-09 | ||
| 2uvy_A | 351 | Structure Of Pka-pkb Chimera Complexed With Methyl- | 1e-09 | ||
| 2gnf_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-09 | ||
| 2c1a_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 1e-09 | ||
| 3fhi_A | 350 | Crystal Structure Of A Complex Between The Catalyti | 1e-09 | ||
| 1q61_A | 350 | Pka Triple Mutant Model Of Pkb Length = 350 | 1e-09 | ||
| 1q24_A | 350 | Pka Double Mutant Model Of Pkb In Complex With Mgat | 1e-09 | ||
| 1j3h_A | 350 | Crystal Structure Of Apoenzyme Camp-Dependent Prote | 1e-09 | ||
| 2erz_E | 351 | Crystal Structure Of C-amp Dependent Kinase (pka) B | 1e-09 | ||
| 1syk_A | 350 | Crystal Structure Of E230q Mutant Of Camp-Dependent | 1e-09 | ||
| 1svh_A | 350 | Crystal Structure Of Protein Kinase A In Complex Wi | 1e-09 | ||
| 1fmo_E | 350 | Crystal Structure Of A Polyhistidine-Tagged Recombi | 1e-09 | ||
| 3qal_E | 350 | Crystal Structure Of Arg280ala Mutant Of Catalytic | 1e-09 | ||
| 1szm_A | 350 | Dual Binding Mode Of Bisindolylmaleimide 2 To Prote | 1e-09 | ||
| 3agl_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-09 | ||
| 1apm_E | 350 | 2.0 Angstrom Refined Crystal Structure Of The Catal | 1e-09 | ||
| 2jds_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 1e-09 | ||
| 1jbp_E | 350 | Crystal Structure Of The Catalytic Subunit Of Camp- | 1e-09 | ||
| 2gnj_A | 350 | Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 | 1e-09 | ||
| 1l3r_E | 350 | Crystal Structure Of A Transition State Mimic Of Th | 1e-09 | ||
| 3mvj_A | 371 | Human Cyclic Amp-Dependent Protein Kinase Pka Inhib | 1e-09 | ||
| 3l9m_A | 351 | Crystal Structure Of Pkab3 (Pka Triple Mutant V123a | 1e-09 | ||
| 3agm_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-09 | ||
| 1q8w_A | 350 | The Catalytic Subunit Of Camp-Dependent Protein Kin | 1e-09 | ||
| 3ama_A | 351 | Protein Kinase A Sixfold Mutant Model Of Aurora B W | 1e-09 | ||
| 2qcs_A | 350 | A Complex Structure Between The Catalytic And Regul | 1e-09 | ||
| 1bkx_A | 350 | A Binary Complex Of The Catalytic Subunit Of Camp-D | 1e-09 | ||
| 1stc_E | 350 | Camp-Dependent Protein Kinase, Alpha-Catalytic Subu | 1e-09 | ||
| 2gu8_A | 337 | Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel | 1e-09 | ||
| 4ae9_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-09 | ||
| 4ae6_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-09 | ||
| 1xh7_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 1e-09 | ||
| 3pvb_A | 345 | Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca | 1e-09 | ||
| 2gng_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-09 | ||
| 1cdk_A | 350 | Camp-Dependent Protein Kinase Catalytic Subunit (E. | 2e-09 | ||
| 2uzt_A | 336 | Pka Structures Of Akt, Indazole-Pyridine Inhibitors | 2e-09 | ||
| 3nx8_A | 351 | Human Camp Dependent Protein Kinase In Complex With | 4e-09 | ||
| 3dnd_A | 350 | Camp-Dependent Protein Kinase Pka Catalytic Subunit | 5e-09 | ||
| 1ydt_E | 350 | Structure Of Camp-Dependent Protein Kinase, Alpha-C | 5e-09 | ||
| 1cmk_E | 350 | Crystal Structures Of The Myristylated Catalytic Su | 5e-09 | ||
| 2qur_A | 350 | Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe | 4e-08 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 3e-07 | ||
| 3ocb_A | 341 | Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor | 1e-06 | ||
| 4gv1_A | 340 | Pkb Alpha In Complex With Azd5363 Length = 340 | 1e-06 | ||
| 3cqu_A | 342 | Crystal Structure Of Akt-1 Complexed With Substrate | 1e-06 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 1e-06 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 1e-06 | ||
| 1o6l_A | 337 | Crystal Structure Of An Activated Akt/protein Kinas | 1e-05 | ||
| 2jdo_A | 342 | Structure Of Pkb-Beta (Akt2) Complexed With Isoquin | 1e-05 | ||
| 4aw2_A | 437 | Crystal Structure Of Cdc42 Binding Protein Kinase A | 2e-05 | ||
| 1gzn_A | 335 | Structure Of Pkb Kinase Domain Length = 335 | 4e-05 | ||
| 1mrv_A | 339 | Crystal Structure Of An Inactive Akt2 Kinase Domain | 4e-05 | ||
| 1gzk_A | 315 | Molecular Mechanism For The Regulation Of Protein K | 4e-05 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 4e-05 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 4e-05 | ||
| 1o6k_A | 336 | Structure Of Activated Form Of Pkb Kinase Domain S4 | 4e-05 | ||
| 3e87_A | 335 | Crystal Structures Of The Kinase Domain Of Akt2 In | 4e-05 | ||
| 2v55_A | 406 | Mechanism Of Multi-site Phosphorylation From A Rock | 5e-05 | ||
| 3v8s_A | 410 | Human Rho-Associated Protein Kinase 1 (Rock 1) In C | 5e-05 | ||
| 2esm_A | 415 | Crystal Structure Of Rock 1 Bound To Fasudil Length | 5e-05 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 9e-05 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 3e-04 |
| >pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 | Back alignment and structure |
|
| >pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 | Back alignment and structure |
| >pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 | Back alignment and structure |
| >pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 | Back alignment and structure |
| >pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 | Back alignment and structure |
| >pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 | Back alignment and structure |
| >pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 | Back alignment and structure |
| >pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 | Back alignment and structure |
| >pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 | Back alignment and structure |
| >pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 | Back alignment and structure |
| >pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 | Back alignment and structure |
| >pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 | Back alignment and structure |
| >pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 | Back alignment and structure |
| >pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 | Back alignment and structure |
| >pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 | Back alignment and structure |
| >pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 | Back alignment and structure |
| >pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 | Back alignment and structure |
| >pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 | Back alignment and structure |
| >pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 | Back alignment and structure |
| >pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 | Back alignment and structure |
| >pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 | Back alignment and structure |
| >pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 | Back alignment and structure |
| >pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 | Back alignment and structure |
| >pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 | Back alignment and structure |
| >pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 | Back alignment and structure |
| >pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 | Back alignment and structure |
| >pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 | Back alignment and structure |
| >pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 | Back alignment and structure |
| >pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 | Back alignment and structure |
| >pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 | Back alignment and structure |
| >pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 | Back alignment and structure |
| >pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 | Back alignment and structure |
| >pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 | Back alignment and structure |
| >pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 | Back alignment and structure |
| >pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 | Back alignment and structure |
| >pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 | Back alignment and structure |
| >pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 | Back alignment and structure |
| >pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 | Back alignment and structure |
| >pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 | Back alignment and structure |
| >pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 | Back alignment and structure |
| >pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 | Back alignment and structure |
| >pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 | Back alignment and structure |
| >pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 | Back alignment and structure |
| >pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 | Back alignment and structure |
| >pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 | Back alignment and structure |
| >pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 | Back alignment and structure |
| >pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 | Back alignment and structure |
| >pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 | Back alignment and structure |
| >pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 | Back alignment and structure |
| >pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 | Back alignment and structure |
| >pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 | Back alignment and structure |
| >pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 | Back alignment and structure |
| >pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
| >pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 | Back alignment and structure |
| >pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 | Back alignment and structure |
| >pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 | Back alignment and structure |
| >pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 | Back alignment and structure |
| >pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 4e-25 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 9e-25 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 9e-21 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 1e-16 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 4e-15 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 1e-14 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 2e-14 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 2e-14 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 2e-14 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 3e-14 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 4e-14 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 6e-14 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 1e-13 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 2e-13 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 3e-13 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 4e-13 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 5e-13 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 5e-13 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 1e-12 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 4e-11 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 2e-10 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 7e-09 |
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
Score = 93.8 bits (234), Expect = 4e-25
Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
Query: 14 LRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEV-HYDGDTRNFDEYPETDWKAAPSVG 72
L+NG +DVK H WFK V W+ + R + P P + GDT FD+YPE D
Sbjct: 249 LQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEEDINYGVQGE 308
Query: 73 ETEQSLFDDF 82
+ LF DF
Sbjct: 309 DPYADLFRDF 318
|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.73 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.71 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.67 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.67 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.67 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.67 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.67 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.65 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.61 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.58 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.54 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.47 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.44 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.41 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.36 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.33 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.3 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.3 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.24 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 98.99 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 98.98 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 98.73 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 97.53 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 97.1 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 97.08 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 97.03 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 97.02 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 97.01 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 96.98 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 96.98 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 96.87 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 96.81 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 96.78 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 96.77 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 96.73 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 96.31 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 96.21 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 96.21 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 95.9 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 95.87 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 95.77 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 95.76 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 95.69 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 95.62 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 95.61 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 95.58 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 95.57 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 95.36 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 95.25 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 95.23 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 95.12 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 95.11 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 95.06 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 95.05 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.02 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 95.01 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 94.99 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 94.99 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 94.98 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 94.98 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 94.92 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 94.91 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 94.8 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 94.66 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 94.59 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 94.43 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 94.42 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 94.34 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 94.26 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 94.25 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 94.18 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 93.93 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 93.9 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 93.89 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 93.68 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 93.68 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 93.6 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 93.52 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 93.45 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 93.44 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 93.34 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 93.3 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 93.09 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 93.02 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.01 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 93.01 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 92.82 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 92.66 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 92.58 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 92.54 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 92.52 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 92.26 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 92.02 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 91.48 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 91.25 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 91.23 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 90.81 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 90.74 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 90.65 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 90.64 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 90.46 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 90.43 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 89.85 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 89.78 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 89.64 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 89.47 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 89.46 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 89.32 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 89.23 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 89.18 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 89.11 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 88.04 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 87.98 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 87.86 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 87.69 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 87.48 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 87.36 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 87.22 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 87.04 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 86.72 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 86.26 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 86.18 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 85.68 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 85.57 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 85.2 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 85.15 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 84.72 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 84.58 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 83.95 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 83.2 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 82.99 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 81.8 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 81.44 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 80.62 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 80.46 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 80.29 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 80.12 |
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
Probab=99.73 E-value=3.2e-18 Score=121.63 Aligned_cols=80 Identities=26% Similarity=0.522 Sum_probs=62.5
Q ss_pred CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC--CCCCCCCCCCCCCCccccccc
Q psy8369 2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD--EYPETDWKAAPSVGETEQSLF 79 (82)
Q Consensus 2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~--~~~~~~~~~~~~~~~~~~~~F 79 (82)
||++||.+|||+..+|+++|++||||++|||+.|..+++.|||+|.+....+.++|| .|.++... .......+++.|
T Consensus 428 lL~~dP~~Rl~~~~~ga~ei~~HpfF~~idW~~l~~~~~~pP~~P~~~~~~~~~~fD~~~fd~e~~~-~~~~~~~d~~~f 506 (689)
T 3v5w_A 428 LLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTK-GIKLLDSDQELY 506 (689)
T ss_dssp HTCSCGGGCTTCSSSTHHHHTTSGGGTTCCHHHHHTTCSCCSCCCCTTCSSTTBCCC---------C-CCCCCHHHHTTT
T ss_pred HccCCHhHCCCCCCCCHHHHhcCccccCCCHHHHHcCCCCcCccCCCCCCCcCCCCCCccCCccccC-CCCCCchHHHHH
Confidence 689999999998888999999999999999999999999999999988877777776 44443322 222445677888
Q ss_pred CCC
Q psy8369 80 DDF 82 (82)
Q Consensus 80 ~~F 82 (82)
.+|
T Consensus 507 ~~F 509 (689)
T 3v5w_A 507 RNF 509 (689)
T ss_dssp TTC
T ss_pred hCC
Confidence 887
|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 82 | ||||
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-19 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 2e-17 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 1e-14 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-14 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 4e-14 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 8e-10 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 1e-05 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 7e-05 |
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: cAMP-dependent PK, catalytic subunit species: Mouse (Mus musculus) [TaxId: 10090]
Score = 76.8 bits (188), Expect = 4e-19
Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
Query: 11 FLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWKAAPS 70
F L+NG +D+K H+WF DW +Y R+ + P +P+ GDT NFD+Y E + + + +
Sbjct: 281 FGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSIN 340
Query: 71 VGETEQSLFDDF 82
E F +F
Sbjct: 341 --EKCGKEFTEF 350
|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.62 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.61 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.6 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.5 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.43 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.22 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 98.51 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 97.82 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 97.69 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 97.15 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 96.93 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 96.41 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 96.25 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 96.05 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 95.8 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 95.74 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 95.69 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 95.64 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 95.5 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 95.47 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 95.45 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 95.39 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 95.3 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.19 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 95.17 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 94.6 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 93.98 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 93.59 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 92.94 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 91.26 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 88.88 |
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: cAMP-dependent PK, catalytic subunit species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.62 E-value=3.8e-16 Score=101.89 Aligned_cols=79 Identities=33% Similarity=0.709 Sum_probs=67.2
Q ss_pred CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCCCCCCCCcccccccCC
Q psy8369 2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWKAAPSVGETEQSLFDD 81 (82)
Q Consensus 2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~~~~~~~~~~~~~F~~ 81 (82)
+|++||.+|+++.+..+++|++||||+++||+.+..+++.|||+|......|++||+.+.++....+ ..+..+.+|..
T Consensus 272 ~L~~dP~kR~~~~r~t~~ell~Hp~f~~~~~~~~~~~~~~~p~~p~~~~~~d~s~~~~~~~~~~~~s--~~~~~~~e~~~ 349 (350)
T d1rdqe_ 272 LLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVS--INEKCGKEFTE 349 (350)
T ss_dssp HSCSCTTTCTTSSTTTTHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCCSTTCCTTSCCCCCCCCCCC--SSCCSTTTTTT
T ss_pred HhhhCHHhccccccccHHHHHcCccccCCCHHHHHhcCCCcCccCCCCCcchhhhcCCCCccccccC--cchhhhhhccC
Confidence 5889999999877778999999999999999999999999999999999999999998887776544 44455556655
Q ss_pred C
Q psy8369 82 F 82 (82)
Q Consensus 82 F 82 (82)
|
T Consensus 350 ~ 350 (350)
T d1rdqe_ 350 F 350 (350)
T ss_dssp C
T ss_pred C
Confidence 4
|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|