Psyllid ID: psy8492

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MVENFPEHKREVKRRDISRTREKIKPKIVQQQEKENTDTLVKENKCQPNEPKNYAREVKRSEMVTASHSDPSPRNEMVKETRASVTSLKSKIQQLKEENRKRKRKDIKKIATSFHNKRNLQYLDERPKITHSNGKNDQNYRKQRKEQSLPTEQSNVTLNNERKYCEDNIKVDNNLERKTKYCLEANEQKPEEAEEIAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEEDRIRENQTSREPTSTVYDKVCLGRESNPQSSACKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKKDDE
ccccccccHHHHHccHHHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccEEEEEEccEEEEEEEcccEEEEEccccHHHHHHHHHHHcccccccccccccEEEccHHHHHHHHHHHHHHHHcccEEEEEccccEEEEEcccccHHHHcHHHHHHHHHccccccccccHHHHHHHHHHcHHHccccccccccccccccccccccccHHHHHHcccccccHHHHcccccEEEEEEccHHHHHcccHHHHHHHccccccccccc
ccccccHHHHHHHHccHHHHHHHccHHHHHHHHHHccccHHHcccccccccccHHHHHcccccEEccccccccccHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcHHccccccccccEEccHHHHcHHcccHHHHHHHccccccEEcccccccHHHHHHHHHHHcHHHHHHHHHHccccccccccccccEEEEccccccccEcEEEccEEEEcEEEEccHcHHHHHHHHHHcccHccHEEHHHHcHHEEEEHHcccEEEEEcccccccEEEEEEHccccHEEccccccEEEEccHHHHHHHHHHHHcccEEEEEEEEEccccEEEEccccHHEEEccccHHHHHHHHccccccccEEEccEEcccccccccccccccccHHcccccccccccccHHHHccHHHHHcccEEEccccccEEEEcccHHHHHcccHHHHHHHccccccccccc
mvenfpehkreVKRRDISRTREKIKPKIVQQQEKENTDTLVKenkcqpnepknyarevkrsemvtashsdpsprnemvKETRASVTSLKSKIQQLKEENRKRKRKDIKKIATSFHNkrnlqylderpkithsngkndqnyrkqrkeqslpteqsnvtlnnerkycednikvdnnleRKTKYCLEANEQKPEEAEEIAIEQLEVAKDIYAMKMVenfpehkredyevdgyisrepisqpqyqniyinkRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYgaflshpitpcvlnltpqeinTLSNRQTCLQYYGLefefkntgkcvkvthvpkclfvKVHKEedrirenqtsreptstvydkvclgresnpqssackhvfprkhhvlrspmypnvclskftrryyydkniihktagkRYVYRFVCDLqtllgyspeeLHAMvdlkpdkkdde
mvenfpehkrevkrrdisrtrekikpkivqqqekentdtlvkenkcqpnepknyarevkrsemvtashsdpsprnemvKETRAsvtslkskiqqlkeenrkrkrkdikkiatsfhnkrnlqylderpkithsngkndqnyrkqrkeqslpteqsnvtlnnerkycednikvdnnlerKTKYCLEaneqkpeeaEEIAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLfvkvhkeedrirenqtsreptstvyDKVCLGRESNPQSSACKHVfprkhhvlrspmypnvCLSKFTRRYYYDKNIihktagkryVYRFVCDLQTLlgyspeelhamvdlkpdkkdde
MVENFPEHKREVKRRDISRTREKIKPKIVQQQEKENTDTLVKENKCQPNEPKNYAREVKRSEMVTASHSDPSPRNEMVKETRASVTSLKSKIQQLKEENrkrkrkdikkiATSFHNKRNLQYLDERPKITHSNGKNDQNYRKQRKEQSLPTEQSNVTLNNERKYCEDNIKVDNNLERKTKYCleaneqkpeeaeeiaieqlevaKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEEDRIRENQTSREPTSTVYDKVCLGRESNPQSSACKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKKDDE
*******************************************************************************************************************************************************************YCEDNIKVD******TKYCL************IAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVH*******************YDKVCL**********CKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEEL**************
*****************************************************************************************************************************************************************************************************************************************************************************NITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEEDRIRENQTSREPTSTVYDKVC******PQSSACKHVFPRKHHVLRSPMYPNVCLS**************KTAGKRYVYRFVCDLQTLLGYSPEELH*************
*************RRDISRTREKIKPKIVQQQEKENTDTLVKENKCQPNEPKNYAREVKR*****************************SKIQQL*********KDIKKIATSFHNKRNLQYLDERPKITHSNGK******************SNVTLNNERKYCEDNIKVDNNLERKTKYCLEANEQKPEEAEEIAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEE***************VYDKVCLGRESNPQSSACKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKKDDE
**************RDISRTREKIKPKIVQQQEKENTDTLVKENKCQPNEPKNYAREVKR*************************TSLKSKIQQLKEENRKRKRKDIKKIATSFHNKRNLQYLDERPKITHSNGKNDQ*YRKQRKEQS*****S*VTLNNERKYCEDNIKVDNNLERKTKYCLEANEQKPEEAEEIAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEEDRIRENQTSREPTSTVYDKVCLGRESNPQSSACKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVD*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVENFPEHKREVKRRDISRTREKIKPKIVQQQEKENTDTLVKENKCQPNEPKNYAREVKRSEMVTASHSDPSPRNEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIKKIATSFHNKRNLQYLDERPKITHSNGKNDQNYRKQRKEQSLPTEQSNVTLNNERKYCEDNIKVDNNLERKTKYCLEANEQKPEEAEEIAIEQLEVAKDIYAMKMVENFPEHKREDYEVDGYISREPISQPQYQNIYINKRLVTNTILHDTINKLLVKSFYLNITKESNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYGAFLSHPITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEEDRIRENQTSREPTSTVYDKVCLGRESNPQSSACKHVFPRKHHVLRSPMYPNVCLSKFTRRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKKDDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query489 2.2.26 [Sep-21-2011]
P41156441 Protein C-ets-1 OS=Rattus yes N/A 0.112 0.124 0.771 1e-19
P13474441 Transforming protein p54/ yes N/A 0.112 0.124 0.771 1e-19
P14921441 Protein C-ets-1 OS=Homo s no N/A 0.112 0.124 0.771 1e-19
P15062485 Transforming protein p68/ no N/A 0.112 0.113 0.771 2e-19
P27577440 Protein C-ets-1 OS=Mus mu no N/A 0.112 0.125 0.771 2e-19
P18755438 Protein c-ets-1-A OS=Xeno N/A N/A 0.112 0.125 0.771 3e-19
P18756268 Protein c-ets-1-B (Fragme N/A N/A 0.112 0.205 0.771 3e-19
P15036469 Protein C-ets-2 OS=Homo s no N/A 0.098 0.102 0.770 6e-18
A1A4L6470 Protein C-ets-2 OS=Bos ta no N/A 0.118 0.123 0.666 6e-18
P15037468 Protein C-ets-2 OS=Mus mu no N/A 0.098 0.102 0.770 7e-18
>sp|P41156|ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus GN=Ets1 PE=2 SV=1 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%), Gaps = 2/57 (3%)

Query: 430 PNVCLSKFTR--RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPD 484
           P +   K +R  RYYYDKNIIHKTAGKRYVYRFVCDLQ+LLGY+PEELHAM+D+KPD
Sbjct: 382 PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD 438
Transcription factor.
Rattus norvegicus (taxid: 10116)
>sp|P13474|ETS1A_CHICK Transforming protein p54/c-ets-1 OS=Gallus gallus GN=ETS1 PE=2 SV=1 Back     alignment and function description
>sp|P14921|ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens GN=ETS1 PE=1 SV=1 Back     alignment and function description
>sp|P15062|ETS1B_CHICK Transforming protein p68/c-ets-1 OS=Gallus gallus GN=ETS1 PE=2 SV=1 Back     alignment and function description
>sp|P27577|ETS1_MOUSE Protein C-ets-1 OS=Mus musculus GN=Ets1 PE=1 SV=2 Back     alignment and function description
>sp|P18755|ETS1A_XENLA Protein c-ets-1-A OS=Xenopus laevis GN=ets1-a PE=2 SV=1 Back     alignment and function description
>sp|P18756|ETS1B_XENLA Protein c-ets-1-B (Fragment) OS=Xenopus laevis GN=ets1-b PE=2 SV=1 Back     alignment and function description
>sp|P15036|ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens GN=ETS2 PE=1 SV=1 Back     alignment and function description
>sp|A1A4L6|ETS2_BOVIN Protein C-ets-2 OS=Bos taurus GN=ETS2 PE=2 SV=1 Back     alignment and function description
>sp|P15037|ETS2_MOUSE Protein C-ets-2 OS=Mus musculus GN=Ets2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
189239154488 PREDICTED: similar to Ets domain-contain 0.122 0.122 0.806 1e-20
270010830385 hypothetical protein TcasGA2_TC014512 [T 0.122 0.155 0.806 1e-20
328785918 687 PREDICTED: hypothetical protein LOC41291 0.122 0.087 0.774 4e-20
383862764 683 PREDICTED: uncharacterized protein LOC10 0.122 0.087 0.774 5e-20
380029786 593 PREDICTED: uncharacterized protein LOC10 0.122 0.101 0.774 5e-20
321473814113 hypothetical protein DAPPUDRAFT_46545 [D 0.122 0.530 0.806 6e-20
307212300441 Transforming protein p54/c-ets-1 [Harpeg 0.122 0.136 0.774 9e-20
240952647 609 ets2, putative [Ixodes scapularis] gi|21 0.122 0.098 0.758 1e-19
340719636 680 PREDICTED: hypothetical protein LOC10064 0.122 0.088 0.758 2e-19
350400995 681 PREDICTED: hypothetical protein LOC10074 0.122 0.088 0.758 2e-19
>gi|189239154|ref|XP_971341.2| PREDICTED: similar to Ets domain-containing protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/62 (80%), Positives = 55/62 (88%), Gaps = 2/62 (3%)

Query: 430 PNVCLSKFTR--RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKKD 487
           P +   K +R  RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKP+KK+
Sbjct: 427 PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPEKKE 486

Query: 488 DE 489
           D+
Sbjct: 487 DD 488

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270010830|gb|EFA07278.1| hypothetical protein TcasGA2_TC014512 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328785918|ref|XP_003250677.1| PREDICTED: hypothetical protein LOC412916 [Apis mellifera] Back     alignment and taxonomy information
>gi|383862764|ref|XP_003706853.1| PREDICTED: uncharacterized protein LOC100878829 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380029786|ref|XP_003698546.1| PREDICTED: uncharacterized protein LOC100864450 [Apis florea] Back     alignment and taxonomy information
>gi|321473814|gb|EFX84780.1| hypothetical protein DAPPUDRAFT_46545 [Daphnia pulex] gi|321473815|gb|EFX84781.1| hypothetical protein DAPPUDRAFT_46634 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307212300|gb|EFN88108.1| Transforming protein p54/c-ets-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|240952647|ref|XP_002399485.1| ets2, putative [Ixodes scapularis] gi|215490599|gb|EEC00242.1| ets2, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|340719636|ref|XP_003398254.1| PREDICTED: hypothetical protein LOC100644371 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350400995|ref|XP_003486023.1| PREDICTED: hypothetical protein LOC100745810 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
UNIPROTKB|A5PJG9441 ETS1 "Uncharacterized protein" 0.112 0.124 0.771 3.9e-18
UNIPROTKB|G9LQW2441 TNIP1 "ETS-1A" [Gallus gallus 0.112 0.124 0.771 1.6e-17
UNIPROTKB|P13474441 ETS1 "Transforming protein p54 0.112 0.124 0.771 1.6e-17
UNIPROTKB|F1S6G9415 ETS1 "Uncharacterized protein" 0.112 0.132 0.771 2.1e-17
MGI|MGI:95455440 Ets1 "E26 avian leukemia oncog 0.112 0.125 0.771 2.6e-17
UNIPROTKB|J9NXR6441 ETS1 "Uncharacterized protein" 0.112 0.124 0.771 2.7e-17
UNIPROTKB|P14921441 ETS1 "Protein C-ets-1" [Homo s 0.112 0.124 0.771 2.7e-17
RGD|2583441 Ets1 "v-ets erythroblastosis v 0.112 0.124 0.771 2.7e-17
UNIPROTKB|F1P3R9485 TNIP1 "Uncharacterized protein 0.112 0.113 0.771 3.1e-17
UNIPROTKB|P15062485 ETS1 "Transforming protein p68 0.112 0.113 0.771 3.1e-17
UNIPROTKB|A5PJG9 ETS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 237 (88.5 bits), Expect = 3.9e-18, Sum P(2) = 3.9e-18
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query:   430 PNVCLSKFTR--RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPD 484
             P +   K +R  RYYYDKNIIHKTAGKRYVYRFVCDLQ+LLGY+PEELHAM+D+KPD
Sbjct:   382 PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD 438
GO:0051272 "positive regulation of cellular component movement" evidence=IEA
GO:0048870 "cell motility" evidence=IEA
GO:0046677 "response to antibiotic" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0045786 "negative regulation of cell cycle" evidence=IEA
GO:0045648 "positive regulation of erythrocyte differentiation" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0030578 "PML body organization" evidence=IEA
GO:0006917 "induction of apoptosis" evidence=IEA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
UNIPROTKB|G9LQW2 TNIP1 "ETS-1A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P13474 ETS1 "Transforming protein p54/c-ets-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6G9 ETS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95455 Ets1 "E26 avian leukemia oncogene 1, 5' domain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXR6 ETS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P14921 ETS1 "Protein C-ets-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2583 Ets1 "v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3R9 TNIP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P15062 ETS1 "Transforming protein p68/c-ets-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
smart00853140 smart00853, MutL_C, MutL C terminal dimerisation d 4e-14
cd03486141 cd03486, MutL_Trans_MLH3, MutL_Trans_MLH3: transdu 1e-09
pfam0017885 pfam00178, Ets, Ets-domain 7e-09
pfam08676144 pfam08676, MutL_C, MutL C terminal dimerisation do 2e-08
smart0041387 smart00413, ETS, erythroblast transformation speci 5e-08
COG0323638 COG0323, MutL, DNA mismatch repair enzyme (predict 1e-07
cd00782122 cd00782, MutL_Trans, MutL_Trans: transducer domain 1e-05
pfam01119119 pfam01119, DNA_mis_repair, DNA mismatch repair pro 3e-04
PRK00095617 PRK00095, mutL, DNA mismatch repair protein; Revie 6e-04
>gnl|CDD|214857 smart00853, MutL_C, MutL C terminal dimerisation domain Back     alignment and domain information 
 Score = 68.9 bits (169), Expect = 4e-14
 Identities = 31/96 (32%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 279 VIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFS-YGAFLSHPI-TPCVLNLTPQE 336
            + QV   YI+      L +  DQHA  ERI  E+L    G   S P+  P  L L+PQE
Sbjct: 1   ALGQVAGTYILAEREDGLYL-LDQHAAHERILYEQLLKQAGGLESQPLLIPVRLELSPQE 59

Query: 337 INTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCL 372
              L      L+  G E E       + +  VP  L
Sbjct: 60  AALLEEHLELLRQLGFELEIFGPQS-LILRSVPALL 94

MutL and MutS are key components of the DNA repair machinery that corrects replication errors. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signaling complex for repair. The N terminal region of MutL contains the ATPase domain and the C terminal is involved in dimerisation. Length = 140
>gnl|CDD|239568 cd03486, MutL_Trans_MLH3, MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH3 (MutL homologue 3) Back     alignment and domain information
>gnl|CDD|143944 pfam00178, Ets, Ets-domain Back     alignment and domain information
>gnl|CDD|219965 pfam08676, MutL_C, MutL C terminal dimerisation domain Back     alignment and domain information
>gnl|CDD|197710 smart00413, ETS, erythroblast transformation specific domain Back     alignment and domain information
>gnl|CDD|223400 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238405 cd00782, MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>gnl|CDD|201604 pfam01119, DNA_mis_repair, DNA mismatch repair protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 489
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) 100.0
PRK00095617 mutL DNA mismatch repair protein; Reviewed 100.0
PF08676144 MutL_C: MutL C terminal dimerisation domain; Inter 99.94
smart00853136 MutL_C MutL C terminal dimerisation domain. MutL a 99.9
KOG1978|consensus672 99.83
KOG1977|consensus1142 99.7
KOG3806|consensus177 99.53
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 99.44
cd03482123 MutL_Trans_MutL MutL_Trans_MutL: transducer domain 99.33
cd03483127 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain 99.32
smart0041387 ETS erythroblast transformation specific domain. v 99.29
PF01119119 DNA_mis_repair: DNA mismatch repair protein, C-ter 99.25
cd03485132 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: tran 99.21
cd03486141 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain 99.15
cd03484142 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: tran 99.12
cd00782122 MutL_Trans MutL_Trans: transducer domain, having a 99.09
PF0017885 Ets: Ets-domain; InterPro: IPR000418 Transcription 98.83
cd00329107 TopoII_MutL_Trans MutL_Trans: transducer domain, h 98.76
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 98.56
KOG3804|consensus390 98.47
KOG1979|consensus 694 98.29
KOG3805|consensus361 97.95
PRK05218613 heat shock protein 90; Provisional 97.33
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 96.63
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 85.0
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-48  Score=421.21  Aligned_cols=266  Identities=22%  Similarity=0.253  Sum_probs=224.3

Q ss_pred             hHHHHHHHHHHHhhhcCCCceEEEEeCCc---ccchhhhhhccHHHHHHHHccHHHhcccCcc--ccCCeEEEEEEeCCC
Q psy8492         160 NERKYCEDNIKVDNNLERKTKYCLEANEQ---KPEEAEEIAIEQLEVAKDIYAMKMVENFPEH--KREDYEVDGYISREP  234 (489)
Q Consensus       160 ~E~~h~~d~vkRlALa~p~v~F~L~~ngr---~l~~~~~~s~~l~eRIa~IlG~~fa~~li~I--e~~~l~I~G~Is~P~  234 (489)
                      -|++||.++|+|+||+||+|+|+|+||||   .+..+ ..+++..+||++|||..|+++++++  +.++++|+||+|.|+
T Consensus       167 ~E~~~i~~vv~r~ALahp~I~F~l~~~gk~~~~~~~~-~~~~~~~~ri~~i~G~~~~~~~l~i~~~~~~~~l~G~v~~P~  245 (638)
T COG0323         167 TEFGHITELINRYALAHPDISFSLSHNGKLRIELLKL-PGTGDLEERIAAVYGTEFLKNALPIENEHEDLRLSGYVSLPE  245 (638)
T ss_pred             HHHHHHHHHHHHHHhcCCCeEEEEEECCceeeEEEec-CCCCcHHHHHHHHhCHHHHHhhcccccCCCceEEEEEecccc
Confidence            49999999999999999999999999999   44422 3345777899999999999999999  778999999999999


Q ss_pred             CCCC--cceEEeeccccccchhHHHHHHHhh----------------------------ccc------------------
Q psy8492         235 ISQP--QYQNIYINKRLVTNTILHDTINKLL----------------------------VKS------------------  266 (489)
Q Consensus       235 ~sR~--~~Qy~FVNGR~VRdk~L~~AIr~AL----------------------------~~~------------------  266 (489)
                      ++|+  ++||+|||||+|+|+.|.+||++||                            |++                  
T Consensus       246 ~~r~~~~~q~~fVNgR~V~~~~l~~Ai~~aY~~~L~~~r~P~~vL~l~l~p~~vDVNVHP~K~EVrf~~~~~i~~~I~~~  325 (638)
T COG0323         246 FTRASRDYQYLFVNGRPVRDKLLNHALREAYADYLPRGRYPVFVLFLELDPELVDVNVHPAKKEVRFSDERLVHDLIYEA  325 (638)
T ss_pred             cccCCccceEEEECCCEeccHHHHHHHHHHHHhhccCCCCcEEEEEEeeChhhcccccCCCcceEEecCHHHHHHHHHHH
Confidence            9999  9999999999999999999999992                            000                  


Q ss_pred             ----c------c-----cc--------------------------------------c------ccc-------------
Q psy8492         267 ----F------Y-----LN--------------------------------------I------TKE-------------  274 (489)
Q Consensus       267 ----~------~-----~~--------------------------------------~------~~~-------------  274 (489)
                          +      .     ..                                      .      ...             
T Consensus       326 I~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  405 (638)
T COG0323         326 IKEALAQQGLIPPASVEAPKSASQPLPAFQEPSPLPESRIQKSKVAKSGSSKSDAPSIAEPASGASPSPASPSIRPLSKN  405 (638)
T ss_pred             HHHHHHhcccCCcccccccccccccccccccCcccccccccccccccccCCcccccccccccccCCcccccccccccccc
Confidence                0      0     00                                      0      000             


Q ss_pred             --------------------------------------------ccceEEEEEcCeEEEEEeCCceEEEEehhhHHHHHH
Q psy8492         275 --------------------------------------------SNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIR  310 (489)
Q Consensus       275 --------------------------------------------~~~~vIgQl~~~YILae~~dgLLvLIDQHAAHERIl  310 (489)
                                                                  +.++++||++++|||++.++|| |||||||||||++
T Consensus       406 ~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~i~q~~~~yil~e~~~~L-~lvDqhaa~Eri~  484 (638)
T COG0323         406 ILPESSPGSLKNEDRSYDDLLEEPAESEDKQEEAEQKAISEDVFPLGEAIGQVHGTYILAEHEDGL-VLVDQHAAHERIL  484 (638)
T ss_pred             ccccccccccchhcccccccccccchhcccccccccccccccccccceEEEEecceEEEEEeCCCE-EEEEhHHhHHHHH
Confidence                                                        0235699999999999999997 9999999999999


Q ss_pred             HHHHHhhcCc--cCC-CCCceEeecCHHHHHHHHHHHHHHhhcCeEEEEeCCCcEEEEeecCcchhhccchhh-----hh
Q psy8492         311 VEKLFSYGAF--LSH-PITPCVLNLTPQEINTLSNRQTCLQYYGLEFEFKNTGKCVKVTHVPKCLFVKVHKEE-----DR  382 (489)
Q Consensus       311 yErL~~~~~i--~sQ-LLiPl~l~Ls~~E~~~Lee~~e~L~~lGfeie~fG~~~ti~VrsVPalL~~~~~~~~-----~~  382 (489)
                      ||+|+..++.  ..| ||+|+.++|++.|+..++++.+.|.++||+++.|| +++++|++||++|........     ..
T Consensus       485 ye~l~~~~~~~~~~Q~LliP~~~~l~~~e~~~~~~~~~~l~~~G~~i~~~g-~~~~~v~~vP~~l~~~~~~~~i~~l~~~  563 (638)
T COG0323         485 YEKLKNELGNVGELQPLLIPIRLELSPEEADVLEEHKEELEKLGFEIESFG-ENSVAVRSVPAMLGKAEVQELIRELLDD  563 (638)
T ss_pred             HHHHHHHhcccccccccccCeeeecCHHHHHHHHHHHHHHHhcCEEEEEcC-CceEEEEecChhhcccchHHHHHHHHHH
Confidence            9999998733  467 99999999999999999999999999999999999 789999999999987543221     11


Q ss_pred             hh-----------hh---ccCccchhhhcCcCChhhhcC--CccCCCCCCcccCCCCCCCCCCC
Q psy8492         383 IR-----------EN---QTSREPTSTVYDKVCLGRESN--PQSSACKHVFPRKHHVLRSPMYP  430 (489)
Q Consensus       383 lr-----------~~---~~~r~~AIK~gD~LS~~E~e~--~qL~~ce~PftCPHGrpRp~m~P  430 (489)
                      +.           ..   .++|..|||+|+.|+.++|..  ++|..|++|++||||  ||++..
T Consensus       564 ~~~~~~~~~~~~~~~~~a~~aC~~svk~~~~l~~~~m~~Ll~~~~~~~~~~~cpHG--Rp~~~~  625 (638)
T COG0323         564 LLEGKLKDLKELLEELAATMACRSAVKAGRELSAEEMNALLRDLEACPNPWTCPHG--RPTYIV  625 (638)
T ss_pred             hhcccccchhHHHHHHHHHHHHHHhhhcCCcCCHHHHHHHHHHHHhCCCccCCCCC--CCceEe
Confidence            11           10   234555999999999999999  999999999999999  888764

>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PF08676 MutL_C: MutL C terminal dimerisation domain; InterPro: IPR014790 MutL and MutS are key components of the DNA repair machinery that corrects replication errors [] Back     alignment and domain information
>smart00853 MutL_C MutL C terminal dimerisation domain Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>KOG3806|consensus Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>cd03482 MutL_Trans_MutL MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL Back     alignment and domain information
>cd03483 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1) Back     alignment and domain information
>smart00413 ETS erythroblast transformation specific domain Back     alignment and domain information
>PF01119 DNA_mis_repair: DNA mismatch repair protein, C-terminal domain; InterPro: IPR013507 This entry represents the C-terminal domain of DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>cd03485 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2 Back     alignment and domain information
>cd03486 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH3 (MutL homologue 3) Back     alignment and domain information
>cd03484 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2) Back     alignment and domain information
>cd00782 MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>PF00178 Ets: Ets-domain; InterPro: IPR000418 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] Back     alignment and domain information
>cd00329 TopoII_MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>KOG3804|consensus Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>KOG3805|consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
1k78_B110 Pax5(1-149)+ets-1(331-440)+dna Length = 110 1e-20
1md0_A141 Crystal Structure Of An Inhibited Fragment Of Ets-1 2e-20
3ri4_A163 Ets1 Cooperative Binding To Widely Separated Sites 2e-20
1gvj_A146 Ets-1 Dna Binding And Autoinhibitory Domains Length 3e-20
1mdm_B161 Inhibited Fragment Of Ets-1 And Paired Domain Of Pa 3e-20
3mfk_A162 Ets1 Complex With Stromelysin-1 Promoter Dna Length 4e-20
2nny_A171 Crystal Structure Of The Ets1 Dimer Dna Complex. Le 1e-19
1r36_A140 Nmr-Based Structure Of Autoinhibited Murine Ets-1 D 2e-19
1awc_A110 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-09
2stt_A96 Solution Nmr Structure Of The Human Ets1DNA COMPLEX 1e-07
4avp_A106 Crystal Structure Of The Dna-Binding Domain Of Huma 1e-05
2ypr_A102 Crystal Structure Of The Dna Binding Ets Domain Of 7e-05
1fli_A98 Dna-Binding Domain Of Fli-1 Length = 98 8e-04
>pdb|1K78|B Chain B, Pax5(1-149)+ets-1(331-440)+dna Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (87%), Gaps = 2/57 (3%)
Query: 430 PNVCLSKFTR--RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPD 484
           P +   K +R  RYYYDKNIIHKTAGKRYVYRFVCDLQ+LLGY+PEELHAM+D+KPD
Sbjct: 52  PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD 108
>pdb|1MD0|A Chain A, Crystal Structure Of An Inhibited Fragment Of Ets-1 Length = 141 Back     alignment and structure
>pdb|3RI4|A Chain A, Ets1 Cooperative Binding To Widely Separated Sites On Promoter Dna Length = 163 Back     alignment and structure
>pdb|1GVJ|A Chain A, Ets-1 Dna Binding And Autoinhibitory Domains Length = 146 Back     alignment and structure
>pdb|1MDM|B Chain B, Inhibited Fragment Of Ets-1 And Paired Domain Of Pax5 Bound To Dna Length = 161 Back     alignment and structure
>pdb|3MFK|A Chain A, Ets1 Complex With Stromelysin-1 Promoter Dna Length = 162 Back     alignment and structure
>pdb|2NNY|A Chain A, Crystal Structure Of The Ets1 Dimer Dna Complex. Length = 171 Back     alignment and structure
>pdb|1R36|A Chain A, Nmr-Based Structure Of Autoinhibited Murine Ets-1 Deltan301 Length = 140 Back     alignment and structure
>pdb|1AWC|A Chain A, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 110 Back     alignment and structure
>pdb|2STT|A Chain A, Solution Nmr Structure Of The Human Ets1DNA COMPLEX, 25 Structures Length = 96 Back     alignment and structure
>pdb|4AVP|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Human Etv1. Length = 106 Back     alignment and structure
>pdb|2YPR|A Chain A, Crystal Structure Of The Dna Binding Ets Domain Of Human Protein Fev Length = 102 Back     alignment and structure
>pdb|1FLI|A Chain A, Dna-Binding Domain Of Fli-1 Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 1e-13
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 2e-13
1x9z_A188 DNA mismatch repair protein MUTL; alpha-beta fold, 2e-11
1awc_A110 Protein (GA binding protein alpha); complex (trans 3e-11
2dao_A118 Transcription factor ETV6; ETS domain, structural 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 9e-09
4avp_A106 ETS translocation variant 1; transcription, transc 9e-09
3kdg_A197 DNA mismatch repair protein MUTL; endonuclease, DN 3e-08
3ncv_A220 DNA mismatch repair protein MUTL; endonuclease, di 1e-07
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 3e-07
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 5e-07
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 3e-06
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 2e-05
1yo5_C97 SAM pointed domain containing ETS transcription fa 3e-05
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 2e-04
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 5e-04
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 5e-04
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 6e-04
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Length = 146 Back     alignment and structure
 Score = 67.2 bits (163), Expect = 1e-13
 Identities = 44/61 (72%), Positives = 51/61 (83%), Gaps = 2/61 (3%)

Query: 429 YPNVCLSKFTR--RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKPDKK 486
            P +   K +R  RYYYDKNIIHKTAGKRYVYRFVCDLQ+LLGY+PEELHAM+D+KPD  
Sbjct: 86  KPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD 145

Query: 487 D 487
           +
Sbjct: 146 E 146
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Length = 171 Back     alignment and structure
>1x9z_A DNA mismatch repair protein MUTL; alpha-beta fold, dimer, replication, signaling protein; HET: DNA MSE; 2.10A {Escherichia coli} SCOP: d.292.1.1 Length = 188 Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Length = 110 Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Length = 128 Back     alignment and structure
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} Length = 106 Back     alignment and structure
>3kdg_A DNA mismatch repair protein MUTL; endonuclease, DNA damage, DNA repair, hydrolase; HET: DNA; 2.00A {Bacillus subtilis} PDB: 3gab_A* 3kdk_A* Length = 197 Back     alignment and structure
>3ncv_A DNA mismatch repair protein MUTL; endonuclease, dimer, hydrolase; HET: DNA; 2.40A {Neisseria gonorrhoeae} Length = 220 Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Length = 157 Back     alignment and structure
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} Length = 103 Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Length = 93 Back     alignment and structure
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Length = 107 Back     alignment and structure
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Length = 97 Back     alignment and structure
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Length = 98 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Length = 89 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
3kdg_A197 DNA mismatch repair protein MUTL; endonuclease, DN 100.0
3ncv_A220 DNA mismatch repair protein MUTL; endonuclease, di 100.0
1x9z_A188 DNA mismatch repair protein MUTL; alpha-beta fold, 99.96
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 99.72
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 99.7
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 99.69
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 99.61
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 99.6
1awc_A110 Protein (GA binding protein alpha); complex (trans 99.6
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 99.55
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 99.3
2dao_A118 Transcription factor ETV6; ETS domain, structural 99.5
4avp_A106 ETS translocation variant 1; transcription, transc 99.46
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 99.35
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 99.34
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 99.24
1yo5_C97 SAM pointed domain containing ETS transcription fa 99.13
2ypr_A102 Protein FEV; transcription; 2.64A {Homo sapiens} P 99.09
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 99.06
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 99.02
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 98.98
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 98.67
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 98.26
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 98.07
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 97.95
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 97.87
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 97.87
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 97.51
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 84.2
3rbn_A284 DNA mismatch repair protein MLH1; structural genom 82.29
>3kdg_A DNA mismatch repair protein MUTL; endonuclease, DNA damage, DNA repair, hydrolase; HET: DNA; 2.00A {Bacillus subtilis} PDB: 3gab_A* 3kdk_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-38  Score=299.70  Aligned_cols=160  Identities=18%  Similarity=0.150  Sum_probs=131.7

Q ss_pred             ccceEEEEEcCeEEEEEeCCceEEEEehhhHHHHHHHHHHHhhc---CccCC-CCCceEeecCHHHHHHHHHHHHHHhhc
Q psy8492         275 SNKLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYG---AFLSH-PITPCVLNLTPQEINTLSNRQTCLQYY  350 (489)
Q Consensus       275 ~~~~vIgQl~~~YILae~~dgLLvLIDQHAAHERIlyErL~~~~---~i~sQ-LLiPl~l~Ls~~E~~~Lee~~e~L~~l  350 (489)
                      +.+++|||++++|||++.++|| ||||||||||||+||+|++.+   ++.+| ||+|++++|++.|.+.++++.+.|++|
T Consensus         7 ~~~~~igQ~~~~yIl~~~~~~L-~lIDQHAAhERi~yE~l~~~~~~~~~~sQ~LL~P~~l~ls~~e~~~l~~~~~~l~~~   85 (197)
T 3kdg_A            7 PIMYPIGQMHGTYILAQNENGL-YIIDQHAAQERIKYEYFREKVGEVEPEVQEMIVPLTFHYSTNEALIIEQHKQELESV   85 (197)
T ss_dssp             CCCEEEEEETTTEEEEEETTEE-EEEEHHHHHHHHHHHHHHHHHHCSSCCEEEEEEEEEEECCTTHHHHHHHTHHHHHHT
T ss_pred             CCCeEEEEEcCEEEEEEeCCCE-EEEEHHHHHHHHHHHHHHHHHccCCCCccccCCCEEEecCHHHHHHHHHHHHHHHhC
Confidence            3579999999999999999997 999999999999999999976   45677 999999999999999999999999999


Q ss_pred             CeEEEEeCCCcEEEEeecCcchhhccchhh-----hhh-----------hhh---ccCccchhhhcCcCChhhhcC--Cc
Q psy8492         351 GLEFEFKNTGKCVKVTHVPKCLFVKVHKEE-----DRI-----------REN---QTSREPTSTVYDKVCLGRESN--PQ  409 (489)
Q Consensus       351 Gfeie~fG~~~ti~VrsVPalL~~~~~~~~-----~~l-----------r~~---~~~r~~AIK~gD~LS~~E~e~--~q  409 (489)
                      ||+++.|| ++++.|++||+++........     ..+           +..   .++|++|||+|+.||.+||+.  ++
T Consensus        86 Gf~~e~~g-~~~~~v~~vP~~l~~~~~~~~l~ell~~l~~~~~~~~~~~~~~~~~~~ACr~AIk~g~~Ls~~Em~~Ll~~  164 (197)
T 3kdg_A           86 GVFLESFG-SNSYIVRCHPAWFPKGEEAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKGSIKANRHLRNDEIKALLDD  164 (197)
T ss_dssp             TCCCEECS-TTEEEEEEEETTSCTTCHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHCC----CCCCCHHHHHHHHHH
T ss_pred             CCEEEECC-CCEEEEEecCcccccccHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhhHhhccCCCCCCHHHHHHHHHH
Confidence            99999999 699999999999976543211     000           010   234556999999999999999  99


Q ss_pred             cCCCCCCcccCCCCCCCCCCCcCChhhhhh
Q psy8492         410 SSACKHVFPRKHHVLRSPMYPNVCLSKFTR  439 (489)
Q Consensus       410 L~~ce~PftCPHGrpRp~m~P~mnyeKLsR  439 (489)
                      |+.|++||+||||  ||++.+ +..+.|.+
T Consensus       165 L~~~~~p~~CpHG--RPt~~~-l~~~elek  191 (197)
T 3kdg_A          165 LRSTSDPFTCPHG--RPIIIH-HSTYEMEK  191 (197)
T ss_dssp             HHHSSCTTBCTTS--CBCEEE-EEHHHHHH
T ss_pred             HHcCCCCCcCCCC--CcEEEE-eCHHHHHH
Confidence            9999999999999  999874 54445554
>3ncv_A DNA mismatch repair protein MUTL; endonuclease, dimer, hydrolase; HET: DNA; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1x9z_A DNA mismatch repair protein MUTL; alpha-beta fold, dimer, replication, signaling protein; HET: DNA MSE; 2.10A {Escherichia coli} SCOP: d.292.1.1 Back     alignment and structure
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Back     alignment and structure
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} PDB: 4b06_A Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>2ypr_A Protein FEV; transcription; 2.64A {Homo sapiens} PDB: 1fli_A Back     alignment and structure
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3rbn_A DNA mismatch repair protein MLH1; structural genomics, structural genomics consortium, SGC, DN mismatch repair, endonucleases, protein binding; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 489
d1gvja_142 a.4.5.21 (A:) ETS-1 transcription factor, residues 9e-17
d1awca_110 a.4.5.21 (A:) GA binding protein (GABP) alpha {Mou 1e-13
d1x9za_182 d.292.1.1 (A:) DNA mismatch repair protein MutL {E 2e-08
d1duxc_86 a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 8e-07
d1wwxa194 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human 9e-07
d1hbxg_155 a.4.5.21 (G:) Serum response factor accessory prot 2e-06
d1flia_98 a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 3e-05
d1yo5c188 a.4.5.21 (C:247-334) Sam pointed domain containing 5e-05
d1puee_88 a.4.5.21 (E:) Transcription factor PU.1, residues 3e-04
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ets domain
domain: ETS-1 transcription factor, residues 331-440
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.9 bits (184), Expect = 9e-17
 Identities = 40/44 (90%), Positives = 44/44 (100%)

Query: 440 RYYYDKNIIHKTAGKRYVYRFVCDLQTLLGYSPEELHAMVDLKP 483
           RYYYDKNIIHKTAGKRYVYRFVCDLQ+LLGY+PEELHAM+D+KP
Sbjct: 99  RYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP 142
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1x9za_ d.292.1.1 (A:) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Length = 182 Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
d1x9za_182 DNA mismatch repair protein MutL {Escherichia coli 99.95
d1gvja_142 ETS-1 transcription factor, residues 331-440 {Huma 99.64
d1awca_110 GA binding protein (GABP) alpha {Mouse (Mus muscul 99.59
d1duxc_86 Elk-1 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1hbxg_155 Serum response factor accessory protein 1a, SAP-1 99.29
d1b63a1115 DNA mismatch repair protein MutL {Escherichia coli 99.26
d1wwxa194 E74-like factor 5 ese-2b {Human (Homo sapiens) [Ta 99.16
d1yo5c188 Sam pointed domain containing ets transcription SP 99.09
d1flia_98 Fli-1 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1puee_88 Transcription factor PU.1, residues 171-259 {Mouse 98.94
d1h7sa1134 DNA mismatch repair protein PMS2 {Human (Homo sapi 98.81
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 97.23
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 95.76
>d1x9za_ d.292.1.1 (A:) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNA mismatch repair protein MutL
superfamily: DNA mismatch repair protein MutL
family: DNA mismatch repair protein MutL
domain: DNA mismatch repair protein MutL
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=6e-29  Score=230.02  Aligned_cols=140  Identities=13%  Similarity=0.119  Sum_probs=117.5

Q ss_pred             ceEEEEEcCeEEEEEeCCceEEEEehhhHHHHHHHHHHHhhc-CccCC-CCCceEeecCHHHHHHHHHHHHHHhhcCeEE
Q psy8492         277 KLVIAQVDKKYIVVLLNKTLLVAFDQHAVDERIRVEKLFSYG-AFLSH-PITPCVLNLTPQEINTLSNRQTCLQYYGLEF  354 (489)
Q Consensus       277 ~~vIgQl~~~YILae~~dgLLvLIDQHAAHERIlyErL~~~~-~i~sQ-LLiPl~l~Ls~~E~~~Lee~~e~L~~lGfei  354 (489)
                      .++|||++++|||+++++|| +|||||||||||.||+|++.. ++.+| ||+|+.+++++.+.+.+.++.+.|+++||++
T Consensus         4 grvl~~v~~~Yil~e~~~gl-~lidqhaA~eri~~e~l~~~~~~i~sQ~LL~P~~l~ls~~e~~~l~~~~~~L~~~Gf~~   82 (182)
T d1x9za_           4 GRVLTIVHSDCALLERDGNI-SLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSALEKAQSALAELGIDF   82 (182)
T ss_dssp             CEEEEEETTTEEEEEETTEE-EEEEHHHHHHHHHHHHHSBTTBCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHTTCEE
T ss_pred             hhhhhhhcCEEEEEEeCCce-EEEeHHHHHHHHHHHHHHhccCCCCccccCCCeeecCCHHHHHHHHHHHHHHHHcCCEE
Confidence            48999999999999999997 999999999999999998754 67777 9999999999999999999999999999999


Q ss_pred             EEeCCCcEEEEeecCcchhhccchhh-----hhhhhh---------ccCccchhhhcCcCChhhhcC--CccCCCCCCcc
Q psy8492         355 EFKNTGKCVKVTHVPKCLFVKVHKEE-----DRIREN---------QTSREPTSTVYDKVCLGRESN--PQSSACKHVFP  418 (489)
Q Consensus       355 e~fG~~~ti~VrsVPalL~~~~~~~~-----~~lr~~---------~~~r~~AIK~gD~LS~~E~e~--~qL~~ce~Pft  418 (489)
                      +++|  +++.|++||+++........     ..+.+.         .++|++|||+|+.||..||..  .+|     ++.
T Consensus        83 e~~g--~~i~v~~iP~~l~~~~~~~~i~ell~~l~~~~~~~~~~la~~ac~~aik~~~~Ls~~E~~~LL~el-----e~~  155 (182)
T d1x9za_          83 QSDA--QHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIARNLMSEHAQWSMAQAITLLADV-----ERL  155 (182)
T ss_dssp             EECS--SEEEEEEEEGGGTTSCHHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTSCCCCSCCHHHHHHHHHHH-----HHH
T ss_pred             Eccc--cceeeecCCcccccCCHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHH-----HHh
Confidence            9997  58999999999976543321     111110         134445999999999999999  665     467


Q ss_pred             cCCCCC
Q psy8492         419 RKHHVL  424 (489)
Q Consensus       419 CPHGrp  424 (489)
                      |||+.+
T Consensus       156 Cp~~~~  161 (182)
T d1x9za_         156 CPQLVK  161 (182)
T ss_dssp             CHHHHH
T ss_pred             CCCCCC
Confidence            999943
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h7sa1 d.14.1.3 (A:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure