Psyllid ID: psy84
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 2182 | 2.2.26 [Sep-21-2011] | |||||||
| Q6P9H4 | 555 | Connector enhancer of kin | yes | N/A | 0.130 | 0.511 | 0.357 | 2e-48 | |
| Q5SGD7 | 555 | Connector enhancer of kin | yes | N/A | 0.130 | 0.511 | 0.350 | 1e-46 | |
| Q8BMA3 | 555 | Connector enhancer of kin | yes | N/A | 0.128 | 0.504 | 0.348 | 5e-46 | |
| Q80YA9 | 1032 | Connector enhancer of kin | no | N/A | 0.130 | 0.275 | 0.353 | 7e-45 | |
| Q8WXI2 | 1034 | Connector enhancer of kin | no | N/A | 0.130 | 0.274 | 0.353 | 7e-45 | |
| Q9Z1T4 | 1032 | Connector enhancer of kin | no | N/A | 0.130 | 0.275 | 0.353 | 8e-45 | |
| Q5RES6 | 140 | Trafficking protein parti | no | N/A | 0.060 | 0.935 | 0.473 | 5e-32 | |
| F1SRI0 | 140 | Trafficking protein parti | no | N/A | 0.060 | 0.935 | 0.466 | 9e-32 | |
| Q3T0F2 | 140 | Trafficking protein parti | no | N/A | 0.060 | 0.935 | 0.466 | 9e-32 | |
| Q08CN0 | 140 | Trafficking protein parti | no | N/A | 0.055 | 0.864 | 0.479 | 1e-31 |
| >sp|Q6P9H4|CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens GN=CNKSR3 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 196 bits (499), Expect = 2e-48, Method: Compositional matrix adjust.
Identities = 105/294 (35%), Positives = 163/294 (55%), Gaps = 10/294 (3%)
Query: 1146 PINNWKPDQVADWLKGLDVSIHRYVESFLNNHVNGQHLLNLQPDDLEHHGICKVGHQEII 1205
P+ W P QV DW +GLD + +YV F +NG+ LL + DLE G+ ++GHQE++
Sbjct: 3 PVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELV 62
Query: 1206 LEAVDHLRNFHYELDHENLQLLALRVSCLAHSLHRELWN-YSSPVVSTQT--------LS 1256
LEAVD L +Y L+ +N++ L L++ +H+L + + SP T L+
Sbjct: 63 LEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLT 122
Query: 1257 DVATIIKAVKPLVCWLDRPPFSGQLAFIDKKAELLRLSLEMAFSGQRGKFADHPIENIRN 1316
V +I A K L+ WLDR PF+G F K ++++L L++ + Q+ F + +
Sbjct: 123 SVVELIGAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCFVAEMEDKVLT 182
Query: 1317 SAKGLSELADEMIREIHDPLLLQPSSLDLATLKK-RPGEHLGFCIIPSFHGIHQIGDIKC 1375
K L+ + D+ IR DP++ Q + L+ L +PGE LG I ++ G+H I
Sbjct: 183 VVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNIKPGEGLGMYIKSTYDGLHVITGTTE 242
Query: 1376 NSTAYQSGKIECGDEIVQINYQTVVGWDVKQVMALFEESSSDIFLTLKKRPCHS 1429
NS A +S KI GDE++Q+N QTVVGW +K ++ E+ + + L LKKRP S
Sbjct: 243 NSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGS 296
|
Probably involved in transepithelial sodium transport. Regulates aldosterone-induced and ENaC-mediated sodium transport possibly through regulation of the ERK pathway. Homo sapiens (taxid: 9606) |
| >sp|Q5SGD7|CNKR3_RAT Connector enhancer of kinase suppressor of ras 3 OS=Rattus norvegicus GN=Cnksr3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BMA3|CNKR3_MOUSE Connector enhancer of kinase suppressor of ras 3 OS=Mus musculus GN=Cnksr3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q80YA9|CNKR2_MOUSE Connector enhancer of kinase suppressor of ras 2 OS=Mus musculus GN=Cnksr2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8WXI2|CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens GN=CNKSR2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z1T4|CNKR2_RAT Connector enhancer of kinase suppressor of ras 2 OS=Rattus norvegicus GN=Cnksr2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RES6|TPPC2_PONAB Trafficking protein particle complex subunit 2 OS=Pongo abelii GN=TRAPPC2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|F1SRI0|TPPC2_PIG Trafficking protein particle complex subunit 2 OS=Sus scrofa GN=TRAPPC2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q3T0F2|TPPC2_BOVIN Trafficking protein particle complex subunit 2 OS=Bos taurus GN=TRAPPC2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q08CN0|TPPC2_DANRE Trafficking protein particle complex subunit 2 OS=Danio rerio GN=trappc2 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2182 | ||||||
| 328699555 | 1376 | PREDICTED: hypothetical protein LOC10016 | 0.263 | 0.418 | 0.472 | 1e-142 | |
| 307212264 | 1882 | Connector enhancer of kinase suppressor | 0.274 | 0.318 | 0.445 | 1e-133 | |
| 380028011 | 1846 | PREDICTED: uncharacterized protein LOC10 | 0.190 | 0.224 | 0.546 | 1e-128 | |
| 350409681 | 1874 | PREDICTED: hypothetical protein LOC10074 | 0.189 | 0.220 | 0.544 | 1e-127 | |
| 345488618 | 1885 | PREDICTED: hypothetical protein LOC10011 | 0.142 | 0.164 | 0.675 | 1e-123 | |
| 307187707 | 1736 | Connector enhancer of kinase suppressor | 0.273 | 0.343 | 0.424 | 1e-120 | |
| 242007626 | 1571 | hypothetical protein Phum_PHUM140130 [Pe | 0.176 | 0.245 | 0.522 | 1e-119 | |
| 189236995 | 1491 | PREDICTED: similar to connector enhancer | 0.184 | 0.269 | 0.495 | 1e-109 | |
| 332023977 | 1784 | Connector enhancer of kinase suppressor | 0.141 | 0.173 | 0.590 | 1e-108 | |
| 383858770 | 1785 | PREDICTED: uncharacterized protein LOC10 | 0.164 | 0.201 | 0.472 | 1e-100 |
| >gi|328699555|ref|XP_001949129.2| PREDICTED: hypothetical protein LOC100163820 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 514 bits (1323), Expect = e-142, Method: Compositional matrix adjust.
Identities = 305/646 (47%), Positives = 396/646 (61%), Gaps = 70/646 (10%)
Query: 1 MAYVNVADWKPDQVADWLKGLDVSIHRYVESFLNNHVNGQHLLNLQPDDLEHHGICKVGH 60
MAYVNVADWK DQVADWLKGLD I Y++ F++ VNGQ LL++QP+DL+ G+ K+GH
Sbjct: 1 MAYVNVADWKSDQVADWLKGLDSVIIPYIKYFIDTDVNGQKLLDMQPNDLDKIGVQKIGH 60
Query: 61 QEIILEAVDHLRNFHYELDHENLQLLALRVSCLAHSLHREL-WNY-SSPVVSTQTLSDVA 118
QE+ILEAVD LRNFHYELD EN+QLLALR+SC AHSL++++ NY +S V T+ L+DVA
Sbjct: 61 QELILEAVDLLRNFHYELDKENVQLLALRLSCSAHSLYKDIKQNYLNSTQVPTKILTDVA 120
Query: 119 TIIKAVKPLVCWLDRPPFSGQLAFIDKKAELLRLSLEMAFSGQRGKFADHPIENIRNSAK 178
+ A+KPLV WL+RPPF GQ +I K LL+L+LE+ SGQR +FA++P+ENI AK
Sbjct: 121 NTVAALKPLVNWLNRPPFCGQPHYISMKNNLLKLALEIVTSGQRDRFAENPVENIFEIAK 180
Query: 179 GLSELADEMIREIHDPLLLQPSSLDLATLKKRPGEHLGFCIIPSFHGIHQIGDIKCNSTA 238
L++ AD +I+E D L+LQP+SLD+ATLKKR GE LGF I+PSFHG+HQ+G++KCNS A
Sbjct: 181 QLAQHADHVIQESQDSLILQPASLDVATLKKRSGESLGFYIVPSFHGVHQVGEVKCNSVA 240
Query: 239 YQSGKIECGDEIVQINYQTVVGWDVKQVMALFEESSSDIFLTLKKRPCHSKILGQIYMKP 298
+Q GKIE GDEIVQ+NYQTVVGW +QVMAL EE+S+DIFLTLKKRP HSK+ GQIYMKP
Sbjct: 241 HQCGKIEAGDEIVQVNYQTVVGWQARQVMALLEEASTDIFLTLKKRPRHSKVFGQIYMKP 300
Query: 299 YRLPSKKQVSY--RWFLDDKITPPRISHFDIKPLGHALVNSVTSFTKNRKPLSGSFENAK 356
YRLPSKK +Y R+F D++TPPR S P VN + S +
Sbjct: 301 YRLPSKKLFNYPQRYF--DQLTPPRPSDLLTIPNFSFPVNKQEKMKVPKIQESQLLSDHL 358
Query: 357 EDVSIDIENQNKSIQKEEPEDDLEDDDDDDEDNEPEEEEESISSPTSVRLYHPKPRLPVQ 416
I +SI E + + +E E E + SSPTSVRLY PKP +PVQ
Sbjct: 359 LSPPPVIHLGGRSISPE-----IFSHSNSSSGDESELESANCSSPTSVRLYLPKPHIPVQ 413
Query: 417 RRATITGTGASPTSKRAPLNLEQLWHELKLEKEWRLSGKQRKGEKSTSELLLSATSPSEV 476
RRATI +GASP K AP N +Q W+ELK E + K + ++ L + P+
Sbjct: 414 RRATI--SGASPIGKHAPFNFDQFWNELKQVNEAHNNNKNNSEKSNSEMQLSKRSKPT-- 469
Query: 477 GSDENKIHLKSAPKACSADCLKSVQSDFVRRNKPDLNLLDSKFIAENEIPGKSLKETDQE 536
K+H S P NE +SLK +D
Sbjct: 470 -----KVHWTSLPP--------------------------------NEEKIESLKFSD-- 490
Query: 537 SKKVNDPSLTEE--ESNMFIPLKERIEIFNKKIDDS-NSVHSMKPKVPAKRYVQNEGFIS 593
KK+ D S+ ++ S+ I +KERI KI+DS + + KPK+ K +V
Sbjct: 491 -KKLVDTSIKDDVLNSSNLISVKERINQL--KINDSPEHIINKKPKIMPKPFV------- 540
Query: 594 LTNSPAHRPTEKKPVARPRGKLDKSNSTPVYDFNDRPQGADEIELL 639
S +P + P + RGKLDKS STP YDF+ +++ E
Sbjct: 541 ---SKVSKPIDNPPFTKVRGKLDKSYSTPSYDFSADSNMSNDFEYF 583
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307212264|gb|EFN88072.1| Connector enhancer of kinase suppressor of ras 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|380028011|ref|XP_003697705.1| PREDICTED: uncharacterized protein LOC100863003 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350409681|ref|XP_003488814.1| PREDICTED: hypothetical protein LOC100748006 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345488618|ref|XP_001602905.2| PREDICTED: hypothetical protein LOC100119058 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307187707|gb|EFN72679.1| Connector enhancer of kinase suppressor of ras 3 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242007626|ref|XP_002424634.1| hypothetical protein Phum_PHUM140130 [Pediculus humanus corporis] gi|212508100|gb|EEB11896.1| hypothetical protein Phum_PHUM140130 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|189236995|ref|XP_970755.2| PREDICTED: similar to connector enhancer of ksr CG6556-PA [Tribolium castaneum] gi|270006630|gb|EFA03078.1| hypothetical protein TcasGA2_TC010952 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332023977|gb|EGI64195.1| Connector enhancer of kinase suppressor of ras 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383858770|ref|XP_003704872.1| PREDICTED: uncharacterized protein LOC100882812 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2182 | ||||||
| FB|FBgn0021818 | 1557 | cnk "connector enhancer of ksr | 0.142 | 0.199 | 0.487 | 5.3e-97 | |
| ZFIN|ZDB-GENE-081104-60 | 1031 | si:ch211-26b3.4 "si:ch211-26b3 | 0.128 | 0.272 | 0.343 | 8.6e-50 | |
| UNIPROTKB|K7GLI4 | 898 | CNKSR2 "Uncharacterized protei | 0.130 | 0.316 | 0.336 | 2.5e-49 | |
| MGI|MGI:2661175 | 1032 | Cnksr2 "connector enhancer of | 0.130 | 0.275 | 0.336 | 2.6e-49 | |
| RGD|708454 | 1032 | Cnksr2 "connector enhancer of | 0.130 | 0.275 | 0.336 | 3.4e-49 | |
| UNIPROTKB|Q9Z1T4 | 1032 | Cnksr2 "Connector enhancer of | 0.130 | 0.275 | 0.336 | 3.4e-49 | |
| UNIPROTKB|F1SQN3 | 868 | CNKSR2 "Uncharacterized protei | 0.130 | 0.327 | 0.336 | 6.5e-49 | |
| UNIPROTKB|J9NXH6 | 1034 | CNKSR2 "Uncharacterized protei | 0.130 | 0.274 | 0.336 | 1.1e-48 | |
| UNIPROTKB|Q8WXI2 | 1034 | CNKSR2 "Connector enhancer of | 0.130 | 0.274 | 0.336 | 1.4e-48 | |
| UNIPROTKB|J9NX90 | 900 | CNKSR3 "Uncharacterized protei | 0.125 | 0.303 | 0.332 | 3.9e-48 |
| FB|FBgn0021818 cnk "connector enhancer of ksr" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 746 (267.7 bits), Expect = 5.3e-97, Sum P(6) = 5.3e-97
Identities = 153/314 (48%), Positives = 211/314 (67%)
Query: 1 MAYVNVADWKPDQVADWLKGLDVSIHRYVESFLNNHVNGQHLLNLQPDDLEHHGICKVGH 60
MAY+N+A+W PDQV DW+KGLD S+ Y+ F + G+ LLN++P +LE+ G+ ++GH
Sbjct: 1 MAYINIAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGH 60
Query: 61 QEIILEAVDHLRNFHYELDHENLQLLALRVSCLAHSLHRELW-NYS-SPVVSTQTLSDVA 118
QEI+LEAV++LRNFHY L ++NLQ +AL V+ A +LHREL N++ S + T+ L D+
Sbjct: 61 QEIVLEAVENLRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDIT 120
Query: 119 TIIKAVKPLVCWLDRPPFSGQLAFIDKKAELLRLSLEMAFSGQRGKFADHPIENIRNSAK 178
I +KPLV L+R PF Q + + +L+ LE+A R +FA P+ IR SA+
Sbjct: 121 RTIATLKPLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAE 180
Query: 179 GLSELADEMIREIHXXXXXXXXXXXXATLKKRPGEHLGFCIIPSFHGIHQIGDIKCNSTA 238
L LA+ +I++I TLKKR E LGF I S++GIH++ DIK NS A
Sbjct: 181 RLENLANFVIQDISDPMVLQPASLNLVTLKKRESE-LGFNIESSYNGIHRVTDIKYNSPA 239
Query: 239 YQSGKIECGDEIVQINYQTVVGWDVKQVMALFEESSSDIFLTLKKRPCHSKILGQIYMKP 298
+ SGKIE GDEIVQINYQTVVGW + V+ E+ D+ LT+KKRP H+K+ GQIYM+P
Sbjct: 240 HNSGKIEDGDEIVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQP 299
Query: 299 YRLPSKKQ-VSYRW 311
YRLPSKK+ ++ RW
Sbjct: 300 YRLPSKKRNMAARW 313
|
|
| ZFIN|ZDB-GENE-081104-60 si:ch211-26b3.4 "si:ch211-26b3.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GLI4 CNKSR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2661175 Cnksr2 "connector enhancer of kinase suppressor of Ras 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|708454 Cnksr2 "connector enhancer of kinase suppressor of Ras 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Z1T4 Cnksr2 "Connector enhancer of kinase suppressor of ras 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQN3 CNKSR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NXH6 CNKSR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WXI2 CNKSR2 "Connector enhancer of kinase suppressor of ras 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NX90 CNKSR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 2182 | |||
| pfam04628 | 127 | pfam04628, Sedlin_N, Sedlin, N-terminal conserved | 2e-44 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 1e-38 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 1e-38 | |
| cd09511 | 69 | cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CN | 5e-31 | |
| cd09511 | 69 | cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CN | 1e-29 | |
| COG5603 | 136 | COG5603, TRS20, Subunit of TRAPP, an ER-Golgi teth | 2e-28 | |
| cd01260 | 114 | cd01260, PH_CNK_mammalian-like, Connector enhancer | 3e-23 | |
| cd01260 | 114 | cd01260, PH_CNK_mammalian-like, Connector enhancer | 3e-23 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 1e-14 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 1e-14 | |
| pfam00536 | 62 | pfam00536, SAM_1, SAM domain (Sterile alpha motif) | 2e-12 | |
| pfam00536 | 62 | pfam00536, SAM_1, SAM domain (Sterile alpha motif) | 2e-12 | |
| smart00454 | 68 | smart00454, SAM, Sterile alpha motif | 9e-12 | |
| smart00454 | 68 | smart00454, SAM, Sterile alpha motif | 1e-11 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 2e-11 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 2e-11 | |
| cd09507 | 65 | cd09507, SAM_DGK-delta-eta, SAM domain of diacylgl | 2e-11 | |
| cd09506 | 66 | cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 | 2e-10 | |
| cd09507 | 65 | cd09507, SAM_DGK-delta-eta, SAM domain of diacylgl | 3e-10 | |
| cd09506 | 66 | cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 | 3e-10 | |
| cd13308 | 113 | cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple | 6e-10 | |
| cd13308 | 113 | cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple | 6e-10 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 2e-09 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 2e-09 | |
| pfam07647 | 66 | pfam07647, SAM_2, SAM domain (Sterile alpha motif) | 3e-09 | |
| pfam07647 | 66 | pfam07647, SAM_2, SAM domain (Sterile alpha motif) | 7e-09 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 8e-09 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 8e-09 | |
| cd09487 | 56 | cd09487, SAM_superfamily, SAM (Sterile alpha motif | 2e-08 | |
| cd09487 | 56 | cd09487, SAM_superfamily, SAM (Sterile alpha motif | 2e-08 | |
| cd09576 | 65 | cd09576, SAM_DGK-eta, SAM domain of diacylglycerol | 5e-08 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 9e-08 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 9e-08 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-07 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-07 | |
| cd09533 | 58 | cd09533, SAM_Ste50-like_fungal, SAM domain of Ste5 | 4e-07 | |
| cd09533 | 58 | cd09533, SAM_Ste50-like_fungal, SAM domain of Ste5 | 4e-07 | |
| cd09512 | 70 | cd09512, SAM_Neurabin-like, SAM domain of SAM_Neur | 5e-07 | |
| cd09576 | 65 | cd09576, SAM_DGK-eta, SAM domain of diacylglycerol | 6e-07 | |
| cd09575 | 65 | cd09575, SAM_DGK-delta, SAM domain of diacylglycer | 1e-06 | |
| cd09512 | 70 | cd09512, SAM_Neurabin-like, SAM domain of SAM_Neur | 2e-06 | |
| cd13316 | 95 | cd13316, PH_Boi, Boi family Pleckstrin homology do | 3e-06 | |
| cd13316 | 95 | cd13316, PH_Boi, Boi family Pleckstrin homology do | 3e-06 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 4e-06 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 4e-06 | |
| cd13236 | 105 | cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co | 5e-06 | |
| cd13236 | 105 | cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co | 5e-06 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 6e-06 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 6e-06 | |
| cd13379 | 114 | cd13379, PH_RhoGap24, Rho GTPase activating protei | 8e-06 | |
| cd13379 | 114 | cd13379, PH_RhoGap24, Rho GTPase activating protei | 8e-06 | |
| cd13237 | 90 | cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain | 1e-05 | |
| cd13237 | 90 | cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain | 1e-05 | |
| cd09505 | 72 | cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | 1e-05 | |
| cd09575 | 65 | cd09575, SAM_DGK-delta, SAM domain of diacylglycer | 2e-05 | |
| cd09505 | 72 | cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | 2e-05 | |
| pfam04099 | 135 | pfam04099, Sybindin, Sybindin-like family | 2e-05 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 2e-05 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 2e-05 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 8e-05 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 8e-05 | |
| cd09534 | 62 | cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun | 1e-04 | |
| cd09534 | 62 | cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun | 1e-04 | |
| cd09498 | 71 | cd09498, SAM_caskin1,2_repeat2, SAM domain of cask | 4e-04 | |
| cd09498 | 71 | cd09498, SAM_caskin1,2_repeat2, SAM domain of cask | 5e-04 | |
| cd09501 | 69 | cd09501, SAM_SARM1-like_repeat1, SAM domain ot SAR | 5e-04 | |
| cd09535 | 65 | cd09535, SAM_BOI-like_fungal, SAM domain of BOI-li | 5e-04 | |
| cd09501 | 69 | cd09501, SAM_SARM1-like_repeat1, SAM domain ot SAR | 6e-04 | |
| cd09513 | 71 | cd09513, SAM_BAR, SAM domain of BAR subfamily | 6e-04 | |
| cd09530 | 67 | cd09530, SAM_Samd14, SAM domain of Samd14 subfamil | 9e-04 | |
| cd09535 | 65 | cd09535, SAM_BOI-like_fungal, SAM domain of BOI-li | 0.001 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 0.001 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 0.001 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 0.001 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 0.001 | |
| cd09530 | 67 | cd09530, SAM_Samd14, SAM domain of Samd14 subfamil | 0.002 | |
| smart00228 | 85 | smart00228, PDZ, Domain present in PSD-95, Dlg, an | 0.002 | |
| smart00228 | 85 | smart00228, PDZ, Domain present in PSD-95, Dlg, an | 0.002 | |
| cd13280 | 105 | cd13280, PH_SIP3, Snf1p-interacting protein 3 Plec | 0.002 | |
| cd13280 | 105 | cd13280, PH_SIP3, Snf1p-interacting protein 3 Plec | 0.002 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 0.003 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 0.003 | |
| cd09554 | 67 | cd09554, SAM_EPH-B4, SAM domain of EPH-B4 subfamil | 0.003 | |
| cd09554 | 67 | cd09554, SAM_EPH-B4, SAM domain of EPH-B4 subfamil | 0.003 | |
| cd09513 | 71 | cd09513, SAM_BAR, SAM domain of BAR subfamily | 0.004 | |
| cd09563 | 64 | cd09563, SAM_liprin-beta1,2_repeat1, SAM domain of | 0.004 | |
| cd09510 | 75 | cd09510, SAM_aveugle-like, SAM domain of aveugle-l | 0.004 |
| >gnl|CDD|218183 pfam04628, Sedlin_N, Sedlin, N-terminal conserved region | Back alignment and domain information |
|---|
Score = 157 bits (398), Expect = 2e-44
Identities = 54/112 (48%), Positives = 83/112 (74%), Gaps = 3/112 (2%)
Query: 1038 VGREDNPLYQRGFSCKEANDNENKYYYEFIAHASLDLLDEQVWQTDHMYLKTIDKFNDMM 1097
+G++DNPLY++ FS E + K+ +FIAHASLD+++E W+T++MYL +D FND+
Sbjct: 2 IGKKDNPLYEQEFS-SEGKTSIPKHLNQFIAHASLDIVEELQWKTNNMYLGLVDSFNDLA 60
Query: 1098 VSAFVTPTGVKFLMVHDS--KNEEGIKKFFTSVYELFIKYSLNPFYKINTPI 1147
VS +VT T +KF+++HDS + ++ IK+FF V+EL+IK +NPFY+ N PI
Sbjct: 61 VSGYVTNTHIKFILLHDSSTERDDDIKQFFREVHELYIKTLMNPFYEPNDPI 112
|
Mutations in this protein are associated with the X-linked spondyloepiphyseal dysplasia tarda syndrome (OMIM:313400). This family represents an N-terminal conserved region. Length = 127 |
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|188910 cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CNK1,2,3-suppressor subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188910 cd09511, SAM_CNK1,2,3-suppressor, SAM domain of CNK1,2,3-suppressor subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|227890 COG5603, TRS20, Subunit of TRAPP, an ER-Golgi tethering complex [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215981 pfam00536, SAM_1, SAM domain (Sterile alpha motif) | Back alignment and domain information |
|---|
| >gnl|CDD|215981 pfam00536, SAM_1, SAM domain (Sterile alpha motif) | Back alignment and domain information |
|---|
| >gnl|CDD|197735 smart00454, SAM, Sterile alpha motif | Back alignment and domain information |
|---|
| >gnl|CDD|197735 smart00454, SAM, Sterile alpha motif | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|188906 cd09507, SAM_DGK-delta-eta, SAM domain of diacylglycerol kinase delta and eta subunits | Back alignment and domain information |
|---|
| >gnl|CDD|188905 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 family proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188906 cd09507, SAM_DGK-delta-eta, SAM domain of diacylglycerol kinase delta and eta subunits | Back alignment and domain information |
|---|
| >gnl|CDD|188905 cd09506, SAM_Shank1,2,3, SAM domain of Shank1,2,3 family proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif) | Back alignment and domain information |
|---|
| >gnl|CDD|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif) | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >gnl|CDD|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif ) | Back alignment and domain information |
|---|
| >gnl|CDD|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif ) | Back alignment and domain information |
|---|
| >gnl|CDD|188975 cd09576, SAM_DGK-eta, SAM domain of diacylglycerol kinase eta | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|188932 cd09533, SAM_Ste50-like_fungal, SAM domain of Ste50_like (ubc2) subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188932 cd09533, SAM_Ste50-like_fungal, SAM domain of Ste50_like (ubc2) subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188911 cd09512, SAM_Neurabin-like, SAM domain of SAM_Neurabin-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188975 cd09576, SAM_DGK-eta, SAM domain of diacylglycerol kinase eta | Back alignment and domain information |
|---|
| >gnl|CDD|188974 cd09575, SAM_DGK-delta, SAM domain of diacylglycerol kinase delta | Back alignment and domain information |
|---|
| >gnl|CDD|188911 cd09512, SAM_Neurabin-like, SAM domain of SAM_Neurabin-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|188904 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188974 cd09575, SAM_DGK-delta, SAM domain of diacylglycerol kinase delta | Back alignment and domain information |
|---|
| >gnl|CDD|188904 cd09505, SAM_WDSUB1, SAM domain of WDSUB1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|146632 pfam04099, Sybindin, Sybindin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188897 cd09498, SAM_caskin1,2_repeat2, SAM domain of caskin protein repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|188897 cd09498, SAM_caskin1,2_repeat2, SAM domain of caskin protein repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|188900 cd09501, SAM_SARM1-like_repeat1, SAM domain ot SARM1-like proteins, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188934 cd09535, SAM_BOI-like_fungal, SAM domain of BOI-like fungal subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188900 cd09501, SAM_SARM1-like_repeat1, SAM domain ot SARM1-like proteins, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188912 cd09513, SAM_BAR, SAM domain of BAR subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188929 cd09530, SAM_Samd14, SAM domain of Samd14 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188934 cd09535, SAM_BOI-like_fungal, SAM domain of BOI-like fungal subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|188929 cd09530, SAM_Samd14, SAM domain of Samd14 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|241434 cd13280, PH_SIP3, Snf1p-interacting protein 3 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241434 cd13280, PH_SIP3, Snf1p-interacting protein 3 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188953 cd09554, SAM_EPH-B4, SAM domain of EPH-B4 subfamily of tyrosine kinase receptors | Back alignment and domain information |
|---|
| >gnl|CDD|188953 cd09554, SAM_EPH-B4, SAM domain of EPH-B4 subfamily of tyrosine kinase receptors | Back alignment and domain information |
|---|
| >gnl|CDD|188912 cd09513, SAM_BAR, SAM domain of BAR subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|188962 cd09563, SAM_liprin-beta1,2_repeat1, SAM domain of liprin-beta1,2 proteins repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188909 cd09510, SAM_aveugle-like, SAM domain of aveugle-like subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2182 | |||
| KOG1738|consensus | 638 | 100.0 | ||
| KOG1738|consensus | 638 | 100.0 | ||
| KOG3487|consensus | 139 | 99.93 | ||
| PF04628 | 132 | Sedlin_N: Sedlin, N-terminal conserved region; Int | 99.93 | |
| COG5603 | 136 | TRS20 Subunit of TRAPP, an ER-Golgi tethering comp | 99.9 | |
| PF10534 | 95 | CRIC_ras_sig: Connector enhancer of kinase suppres | 99.85 | |
| PF10534 | 95 | CRIC_ras_sig: Connector enhancer of kinase suppres | 99.85 | |
| KOG3444|consensus | 121 | 99.85 | ||
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.81 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.77 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.74 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.74 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.72 | |
| KOG3369|consensus | 199 | 99.72 | ||
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.71 | |
| KOG0609|consensus | 542 | 99.71 | ||
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.7 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.7 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.69 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.68 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.68 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.68 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.66 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.65 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.65 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.65 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.63 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.63 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.62 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.62 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.62 | |
| PF04099 | 142 | Sybindin: Sybindin-like family ; InterPro: IPR0072 | 99.62 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.62 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.62 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.61 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.59 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.59 | |
| KOG0930|consensus | 395 | 99.59 | ||
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.58 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.57 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.55 | |
| COG5122 | 134 | TRS23 Transport protein particle (TRAPP) complex s | 99.53 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.53 | |
| KOG0930|consensus | 395 | 99.53 | ||
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.52 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.5 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.5 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.49 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.49 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 99.47 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.45 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.45 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.42 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.42 | |
| KOG3549|consensus | 505 | 99.4 | ||
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.4 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.37 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.34 | |
| PF00536 | 64 | SAM_1: SAM domain (Sterile alpha motif); InterPro: | 99.34 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.32 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 99.3 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.29 | |
| KOG0609|consensus | 542 | 99.28 | ||
| PF07647 | 66 | SAM_2: SAM domain (Sterile alpha motif); InterPro: | 99.28 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.28 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.26 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.26 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.25 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 99.25 | |
| KOG3550|consensus | 207 | 99.24 | ||
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.23 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.23 | |
| KOG3209|consensus | 984 | 99.22 | ||
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.22 | |
| PF00536 | 64 | SAM_1: SAM domain (Sterile alpha motif); InterPro: | 99.2 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.2 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 99.19 | |
| PF06663 | 189 | DUF1170: Protein of unknown function (DUF1170); In | 99.18 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.16 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.15 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.14 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.13 | |
| KOG3938|consensus | 334 | 99.12 | ||
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.12 | |
| KOG3209|consensus | 984 | 99.12 | ||
| smart00454 | 68 | SAM Sterile alpha motif. Widespread domain in sign | 99.11 | |
| cd00166 | 63 | SAM Sterile alpha motif.; Widespread domain in sig | 99.11 | |
| PF07647 | 66 | SAM_2: SAM domain (Sterile alpha motif); InterPro: | 99.11 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.09 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.08 | |
| KOG3549|consensus | 505 | 99.07 | ||
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.06 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.06 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.02 | |
| KOG4375|consensus | 272 | 98.97 | ||
| cd00166 | 63 | SAM Sterile alpha motif.; Widespread domain in sig | 98.95 | |
| smart00454 | 68 | SAM Sterile alpha motif. Widespread domain in sign | 98.94 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.94 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.92 | |
| KOG3550|consensus | 207 | 98.91 | ||
| KOG1170|consensus | 1099 | 98.9 | ||
| KOG3938|consensus | 334 | 98.85 | ||
| KOG3368|consensus | 140 | 98.81 | ||
| KOG3551|consensus | 506 | 98.79 | ||
| KOG1170|consensus | 1099 | 98.67 | ||
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.67 | |
| KOG4375|consensus | 272 | 98.64 | ||
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.64 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.62 | |
| KOG1090|consensus | 1732 | 98.61 | ||
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.6 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.6 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.6 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.57 | |
| KOG3606|consensus | 358 | 98.48 | ||
| KOG3531|consensus | 1036 | 98.46 | ||
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.46 | |
| KOG0690|consensus | 516 | 98.44 | ||
| KOG3606|consensus | 358 | 98.42 | ||
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 98.38 | |
| KOG0690|consensus | 516 | 98.35 | ||
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 98.33 | |
| KOG3551|consensus | 506 | 98.32 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.31 | |
| KOG1090|consensus | 1732 | 98.29 | ||
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 98.25 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.25 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.24 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 98.23 | |
| KOG3640|consensus | 1116 | 98.18 | ||
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.16 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 98.15 | |
| KOG3640|consensus | 1116 | 98.12 | ||
| KOG1892|consensus | 1629 | 98.11 | ||
| KOG1892|consensus | 1629 | 98.1 | ||
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.08 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 98.07 | |
| KOG3751|consensus | 622 | 98.06 | ||
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.04 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 98.02 | |
| KOG0932|consensus | 774 | 98.01 | ||
| KOG3651|consensus | 429 | 97.98 | ||
| KOG3571|consensus | 626 | 97.98 | ||
| KOG3531|consensus | 1036 | 97.94 | ||
| KOG3651|consensus | 429 | 97.92 | ||
| KOG2059|consensus | 800 | 97.87 | ||
| KOG3571|consensus | 626 | 97.85 | ||
| KOG0521|consensus | 785 | 97.83 | ||
| KOG0521|consensus | 785 | 97.81 | ||
| KOG3605|consensus | 829 | 97.79 | ||
| KOG3580|consensus | 1027 | 97.79 | ||
| KOG2059|consensus | 800 | 97.78 | ||
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 97.77 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 97.77 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 97.76 | |
| KOG3751|consensus | 622 | 97.71 | ||
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 97.71 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 97.7 | |
| KOG3605|consensus | 829 | 97.7 | ||
| PLN02866 | 1068 | phospholipase D | 97.68 | |
| KOG3552|consensus | 1298 | 97.67 | ||
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 97.62 | |
| KOG3552|consensus | 1298 | 97.6 | ||
| KOG0932|consensus | 774 | 97.59 | ||
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.56 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 97.52 | |
| KOG3580|consensus | 1027 | 97.51 | ||
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.5 | |
| PLN02866 | 1068 | phospholipase D | 97.49 | |
| KOG1739|consensus | 611 | 97.38 | ||
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 97.36 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 97.35 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.32 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 97.31 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.28 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.27 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 97.25 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.2 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.2 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.17 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 97.17 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 97.17 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 97.17 | |
| KOG3678|consensus | 832 | 97.14 | ||
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 97.13 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.06 | |
| KOG1739|consensus | 611 | 97.0 | ||
| KOG0248|consensus | 936 | 96.97 | ||
| KOG3553|consensus | 124 | 96.94 | ||
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 96.88 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 96.87 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 96.87 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 96.87 | |
| KOG3543|consensus | 1218 | 96.87 | ||
| KOG4384|consensus | 361 | 96.86 | ||
| KOG3553|consensus | 124 | 96.77 | ||
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 96.73 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 96.71 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 96.68 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 96.61 | |
| KOG4384|consensus | 361 | 96.61 | ||
| KOG3543|consensus | 1218 | 96.61 | ||
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 96.6 | |
| KOG1451|consensus | 812 | 96.45 | ||
| KOG1451|consensus | 812 | 96.44 | ||
| KOG0196|consensus | 996 | 96.42 | ||
| KOG3723|consensus | 851 | 96.37 | ||
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 96.31 | |
| KOG1117|consensus | 1186 | 96.31 | ||
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 96.27 | |
| KOG0606|consensus | 1205 | 96.26 | ||
| KOG0248|consensus | 936 | 96.23 | ||
| KOG1117|consensus | 1186 | 96.22 | ||
| KOG3542|consensus | 1283 | 96.21 | ||
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 96.21 | |
| KOG3678|consensus | 832 | 96.2 | ||
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 96.17 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 96.16 | |
| KOG3542|consensus | 1283 | 96.12 | ||
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 96.07 | |
| KOG1899|consensus | 861 | 96.05 | ||
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 96.04 | |
| KOG0196|consensus | 996 | 95.92 | ||
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 95.9 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 95.84 | |
| KOG3723|consensus | 851 | 95.77 | ||
| KOG0606|consensus | 1205 | 95.72 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.57 | |
| KOG4374|consensus | 216 | 95.5 | ||
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 95.43 | |
| KOG4424|consensus | 623 | 95.39 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.37 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 95.19 | |
| KOG1737|consensus | 799 | 95.15 | ||
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 94.9 | |
| KOG4374|consensus | 216 | 94.89 | ||
| PF09235 | 75 | Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: | 94.76 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 94.62 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 94.61 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 94.58 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 94.56 | |
| KOG1899|consensus | 861 | 94.5 | ||
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 94.48 | |
| PF09597 | 57 | IGR: IGR protein motif; InterPro: IPR019083 This e | 94.48 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 94.47 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 94.11 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 93.93 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 93.79 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 93.78 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 93.73 | |
| PF09597 | 57 | IGR: IGR protein motif; InterPro: IPR019083 This e | 93.68 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 93.65 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 93.61 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 93.5 | |
| KOG1945|consensus | 377 | 93.49 | ||
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 93.43 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 93.26 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 93.23 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 93.2 | |
| cd08541 | 91 | SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed do | 93.17 | |
| KOG1737|consensus | 799 | 93.17 | ||
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 93.14 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 93.07 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 92.99 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 92.99 | |
| PF02198 | 84 | SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; | 92.97 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 92.94 | |
| cd08540 | 75 | SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed doma | 92.93 | |
| KOG4424|consensus | 623 | 92.89 | ||
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 92.89 | |
| KOG4403|consensus | 575 | 92.87 | ||
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 92.86 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 92.83 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 92.8 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 92.74 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 92.71 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 92.7 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 92.64 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 92.59 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 92.41 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 92.28 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 92.26 | |
| KOG4407|consensus | 1973 | 91.54 | ||
| KOG4807|consensus | 593 | 91.36 | ||
| KOG3727|consensus | 664 | 91.15 | ||
| cd08531 | 75 | SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointe | 91.1 | |
| smart00251 | 82 | SAM_PNT SAM / Pointed domain. A subfamily of the S | 90.9 | |
| cd08533 | 71 | SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed | 90.42 | |
| cd08757 | 68 | SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed doma | 90.21 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 89.89 | |
| cd08532 | 76 | SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointe | 89.83 | |
| cd08534 | 89 | SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Point | 89.78 | |
| KOG0705|consensus | 749 | 89.65 | ||
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 89.54 | |
| PF09235 | 75 | Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: | 89.24 | |
| cd08535 | 68 | SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed | 89.16 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 88.52 | |
| KOG3727|consensus | 664 | 88.44 | ||
| KOG3532|consensus | 1051 | 88.43 | ||
| cd08538 | 78 | SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Point | 88.12 | |
| KOG1945|consensus | 377 | 88.05 | ||
| cd08542 | 88 | SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed do | 87.84 | |
| cd08203 | 66 | SAM_PNT Sterile alpha motif (SAM)/Pointed domain. | 87.61 | |
| cd08541 | 91 | SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed do | 87.55 | |
| KOG4407|consensus | 1973 | 87.5 | ||
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 87.02 | |
| cd08540 | 75 | SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed doma | 86.97 | |
| KOG3532|consensus | 1051 | 86.95 | ||
| KOG4807|consensus | 593 | 86.74 | ||
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 86.47 | |
| KOG4403|consensus | 575 | 86.33 | ||
| KOG3129|consensus | 231 | 86.0 | ||
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 85.77 | |
| PF02198 | 84 | SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; | 85.69 | |
| cd08531 | 75 | SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointe | 85.59 | |
| cd08536 | 66 | SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed doma | 85.19 | |
| cd08543 | 89 | SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed do | 85.12 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 85.04 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 83.78 | |
| KOG3129|consensus | 231 | 83.7 | ||
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 83.63 | |
| cd08539 | 74 | SAM_PNT-ESE-3-like Sterile alpha motif (SAM)/Point | 83.24 | |
| KOG0705|consensus | 749 | 82.73 | ||
| cd08532 | 76 | SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointe | 82.47 | |
| KOG4236|consensus | 888 | 82.39 | ||
| KOG3930|consensus | 389 | 82.27 | ||
| PF06663 | 189 | DUF1170: Protein of unknown function (DUF1170); In | 81.9 | |
| KOG4236|consensus | 888 | 81.32 | ||
| cd08533 | 71 | SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed | 81.18 | |
| KOG3930|consensus | 389 | 80.95 | ||
| cd08757 | 68 | SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed doma | 80.8 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 80.23 |
| >KOG1738|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-77 Score=727.57 Aligned_cols=612 Identities=26% Similarity=0.346 Sum_probs=463.1
Q ss_pred cCCcCCCCchhhhhhhcccchhHHHhHHHHhhccCCchhhhCCChhhhhccCCcccchHHHHHHHHHHHHhhhcccCchh
Q psy84 1144 NTPINNWKPDQVADWLKGLDVSIHRYVESFLNNHVNGQHLLNLQPDDLEHHGICKVGHQEIILEAVDHLRNFHYELDHEN 1223 (2182)
Q Consensus 1144 ~~PI~sWs~dQVv~WLkGLd~~l~~Y~~~F~~~~I~G~~LL~L~~~dL~~LGV~~iGHre~ILeaV~~Lr~~~y~l~~EN 1223 (2182)
+.||.+|+++||++|++|||++|++|...|+++.|.|++|+++++++|+.|||.++|||++||+||++|++|+|.+++||
T Consensus 1 ~~~v~~wsp~~va~w~rgldd~m~~Y~~~~e~~~~~g~ql~~~~pq~le~lg~rrig~qeli~~av~~L~~l~~~l~~en 80 (638)
T KOG1738|consen 1 MEPVETWTPKQVADWIRGLDDSMQSYLAIFEDALIPGRQLLRLKPQSLETLGVRRIGHQELILEAVEQLWALKYKLKTEN 80 (638)
T ss_pred CCcccccCchhhhhHhhcccHhhhHHHHHHHHhhcccccccccChHHHHHHhhhhhhhHHHHHHHHHHHHHHHhccccCc
Confidence 36899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHhcC---CCCCcchhhHHHHHHHHHHHhhhhhccCCCCCCChhhhHHHHHHHHHHHHHHHhh
Q psy84 1224 LQLLALRVSCLAHSLHRELWNY---SSPVVSTQTLSDVATIIKAVKPLVCWLDRPPFSGQLAFIDKKAELLRLSLEMAFS 1300 (2182)
Q Consensus 1224 Lq~La~~l~~~a~sl~~~i~~~---~~~~~~~~~L~~Vv~li~aaK~Ll~WLdR~pF~~~~df~~~r~~I~~l~~eLa~~ 1300 (2182)
||.|++++..++++++ ...| .++++++.||.+|++|++|||.|++||||+||.++.+|+.+|++|.++|++|+++
T Consensus 81 lq~l~~~~~~~~~~~~--~~~y~~~~s~K~~n~vl~~v~~l~~aak~l~~wldR~pf~~~~df~~~~nnV~el~~eL~~~ 158 (638)
T KOG1738|consen 81 LQNLAKKLWTSLKNLQ--EYAYSNQESEKADNFVLLAVVELIRAAKALLFWLDRTPFPQIKDFSFACNNVQELNLELNTL 158 (638)
T ss_pred HHHHHHHHHHHhcccc--ccccccchhhcCccccchhhhhhhHHHHHHHHHhhhCCccccchHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999 3333 6889999999999999999999999999999999999999999999999999999
Q ss_pred cccCCCCCCchHHHHHHHHHHHHHHhHhhccCCCcccCCcccceeeEee-cCCCCCcceEEEecCCcceEEeccCCCChh
Q psy84 1301 GQRGKFADHPIENIRNSAKGLSELADEMIREIHDPLLLQPSSLDLATLK-KRPGEHLGFCIIPSFHGIHQIGDIKCNSTA 1379 (2182)
Q Consensus 1301 vq~D~~a~e~e~~i~~ic~~L~~icD~Il~~spD~l~~q~a~le~V~L~-K~~~e~LG~~I~s~~~G~h~Is~I~~gSPA 1379 (2182)
||+||++++.+..++..|..+.++|+.+|.+|+|||++|.++|+.|+|. .+++++||++|+++++|.|+|+.|.++|||
T Consensus 159 v~~d~~a~e~t~~~~~~~s~~~~~~~~~I~~c~DPl~sQ~a~Le~vqls~~kp~eglg~~I~Ssydg~h~~s~~~e~Spa 238 (638)
T KOG1738|consen 159 VHADIHALETTGDVLCYSESEMEYCLSFIVDCPDPLMSQKASLERVQLSTLSPSEGLGLYIDSSYDGPHVTSKIFEQSPA 238 (638)
T ss_pred HHhhhhhhccCCceeEeehhhhccccceeccCCchHhhhHHHHHHHHhccCCcccCCceEEeeecCCceeccccccCChH
Confidence 9999999999999999999999999999999999999999999999998 557889999999999999999999999999
Q ss_pred hhcCcccCCCeEEEECCeEecCCCHHHHHHHHHhcCCcEEEEEEeCCCCCcccccccccCCCCCccccccccccccCCCC
Q psy84 1380 YQSGKIECGDEIVQINYQTVVGWDVKQVMALFEESSSDIFLTLKKRPCHSKILGQIYMKPYRLPSKKQVSYRWFLDDKIT 1459 (2182)
Q Consensus 1380 d~~g~L~~GDeIvQVNGq~VvGw~h~~Vv~~Lre~~~~vtL~LKkrP~~~~~~~q~~~kp~r~p~~~~~~~~~r~~~~~~ 1459 (2182)
|+|++|++||||+|||+|+||||++++||+.|++.+.+|.|+|||||.+...+.+. |++.. ++..||.+.++
T Consensus 239 d~~~kI~dgdEv~qiN~qtvVgwqlk~vV~sL~~~~sgi~l~lkKrp~~~~~~~~~-------~sp~~-~~~~r~~~~~~ 310 (638)
T KOG1738|consen 239 DYRQKILDGDEVLQINEQTVVGWQLKVVVSSLRETPAGIELTLKKRPVTSESGFLN-------PSPDT-SSASRWHDLLL 310 (638)
T ss_pred HHhhcccCccceeeecccccccchhHhHHhhcccCcccceeeeeccCCCcCCCCCC-------CCccc-chhccCCcccc
Confidence 99999999999999999999999999999999999999999999999998887765 55554 77777778877
Q ss_pred CCCCCcCCCCccccccccccccccccCCCCCCCccCcccccchhhccccccccCCCCCCCCCCCCCCCCCCCCccccccC
Q psy84 1460 PPRISHFDIKPLGHALVNSVTSFTKNRKPLSGSFENAKEDVSIDIENQNKSIQKEEPEDDLEDDDDDDEDNEPEEEEESI 1539 (2182)
Q Consensus 1460 ~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1539 (2182)
.|-++ |+|.++ .+.+++++++ ++|+
T Consensus 311 ~P~~P---------------------~s~~~d--------------------------------~~t~~S~~~t--p~k~ 335 (638)
T KOG1738|consen 311 VPLPP---------------------RSPISD--------------------------------VATSVSEIDT--PTKL 335 (638)
T ss_pred CCCCC---------------------CCcccc--------------------------------cccccccCCC--Cccc
Confidence 77321 111110 0111222222 2344
Q ss_pred CCCc-cccccccCCCccccccc----cccCCCCCCCCCCCCCchhHHHHHhhhhhhhhcccccCCCCCchhhhcccCCCC
Q psy84 1540 SSPT-SVRLYHPKPRLPVQRRA----TITGTGASPTSKRAPLNLEQLWHELKLEKEWRLSGKQRKGEKSTSELLLSATSP 1614 (2182)
Q Consensus 1540 ~~~~-~~rly~pkPr~~~qrr~----t~~~~~~~p~~k~~~~~~~~~w~~~k~~~~~~~~~~~~~~~~~~s~l~~~~~~~ 1614 (2182)
...+ .++||+|+|+.|+++|+ ..+|+.--|.-+ .--.++++++||+|+.++|.+
T Consensus 336 ~~sa~~~~l~p~~~a~P~~~r~e~~~~~~~~~~~~~~~---------------------~p~~k~~~s~~s~l~~~~~kr 394 (638)
T KOG1738|consen 336 YKSARQASLSPPPPARPSTPRNEDGVAPVKDLRNPSIG---------------------SPVHKIRTSPNSTLKEEDRKR 394 (638)
T ss_pred hhhHHHhhccCCCCCCCCCCCccccccCCCccCCCCCC---------------------CCccCCCCCchhhhhHHHHHH
Confidence 4555 56677777889999993 222221111111 112378999999999888777
Q ss_pred CcccCCcccccccCCCCCCccccccccchhhhhcCCCCccccccccccccCCCCCCcccccccccccCCCCCcccccccc
Q psy84 1615 SEVGSDENKIHLKSAPKACSADCLKSVQSDFVRRNKPDLNLLDSKFIAENEIPGKSLKETDQESKKVNDPSLTEEESNMF 1694 (2182)
Q Consensus 1615 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~s~~~~~~~~~ 1694 (2182)
+.++-|...+ ... ...+|+++. + .
T Consensus 395 ~~~~~dd~~l------~~~-------------~~~~~~~~~-------------------~-----~------------- 418 (638)
T KOG1738|consen 395 RNLLRDDPDL------YLR-------------KYRKPKVSN-------------------T-----L------------- 418 (638)
T ss_pred HhhcccCCcc------eee-------------eeecCCccc-------------------c-----c-------------
Confidence 6666544222 111 112222210 0 0
Q ss_pred cchHHHHHHhhccccCCCCcCCCCCCCccccccccccccccCC----------CCCCCCCCC-CCCcCCCCcccCCCCCC
Q psy84 1695 IPLKERIEIFNKKIDDSNSVHSMKPKVPAKRYVQNEGFISLTN----------SPAHRPTEK-KPVARPRGKLDKSNSTP 1763 (2182)
Q Consensus 1695 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~n----------~p~~~~~~~-~~~~~~rg~~dks~s~p 1763 (2182)
.++..+..+...|..+|.+|.|.+-.....+ .+..-++++ .....++++.||+++.+
T Consensus 419 ------------r~~~~~~~~k~~p~~~P~e~~~~g~~d~~e~~~~~~~k~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~ 486 (638)
T KOG1738|consen 419 ------------RIDDIYDQLKANPDDTPQEFKKEGDSDSVENSIGHDRKGKDLLQLTHDVYKAFIFARDTRTDKSMSVR 486 (638)
T ss_pred ------------eeccchhhhccCcccCCchhhhccCcchhhhhccchhhhhhhhhhhhhhhhhhHHHHhcccccccccc
Confidence 0000111222222333333333321100000 000011111 22346688888898888
Q ss_pred cccCCCCCCChhhHHHHHHhhhcccCCCCCCCCCCCCcccccccccccCC------CCCcCCCCCCCCccCCCCcccccc
Q psy84 1764 VYDFNDRPQGADEIELLLSRELKSRINIPASTRNEKPEAQGQILQTEVDD------KKHSCDSSESPKHKATSPKVFRKK 1837 (2182)
Q Consensus 1764 ~yd~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~p~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~s~~~~~KK 1837 (2182)
.|..-+....++ .+...|++++...+.+..+ +++..+..++.++..++. ||
T Consensus 487 ~~~~~~~~s~Sp-------------------~~s~~p~~~~~~~~~~~~~~pv~~~a~~h~~q~s~~q~~~~~~----~~ 543 (638)
T KOG1738|consen 487 HLIPCGEKSSSP-------------------CYSSTPASDPDALRSSSSPSPVPAPAPLHGFQSSALQTESKSK----KK 543 (638)
T ss_pred ccCccccccCCC-------------------CCCCCcccccccccccccCCcCCCCCCCCccccccccCCCCCC----CC
Confidence 777655432222 3344444444433333222 333333444444443221 44
Q ss_pred CcccccccCCCCcccCCCCceEEEEEeecCCCCCCCCceEEEEEEeCCeEEEEecCCCCccceeEecCCcEEEecccccC
Q psy84 1838 TNLLRGKRRNISVKDLVMPDCEGWLFQRDRKISTVPQWIRGWFIIKGNHFYGFTDKDSTKAHLFIYLPGFTVAPAVEVKS 1917 (2182)
Q Consensus 1838 k~sl~~sRRnis~~~Lg~~dkeGWL~KKg~k~s~~K~WKKRWFVLkd~~LyYYKde~d~kp~GsI~L~g~tVs~a~e~ks 1917 (2182)
......++|+.+++.++.++++|||++++...-+...|+|.||||.+..||+|.++..+.+.++|.|..|+|+.+.++.+
T Consensus 544 ~~~s~~s~~~~~~~~l~~G~~qg~~~r~k~~~~~~~kW~k~~~~l~~~~l~~y~n~~~~~~e~~i~l~~~~i~~a~e~~~ 623 (638)
T KOG1738|consen 544 GPGSLKSSREEALELLGRGDRQGWLTRLKLNHLTQEKWRKIWMVLNDDPLLNYRNHRVRAAESVIKLPLFTISVAEEVLG 623 (638)
T ss_pred CCCccchhhhhHHHHhccchhhccchhhccchHHHHHhhhheeeecCchhhhhhhhhhhchhheeeccchhhhhHHHhcc
Confidence 45557899999999999999999999998753356789999999999999999999999999999999999999999996
Q ss_pred cceeEEEEcCCeEEE
Q psy84 1918 RKYALKIYHTGTTFY 1932 (2182)
Q Consensus 1918 Rk~aFkI~~~~rtyy 1932 (2182)
++..|..++..+.||
T Consensus 624 ~~~~~~~~~~~~~f~ 638 (638)
T KOG1738|consen 624 KPELTGEKFRQKSFY 638 (638)
T ss_pred CHhhhccchhhcccC
Confidence 666666666656665
|
|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >KOG3487|consensus | Back alignment and domain information |
|---|
| >PF04628 Sedlin_N: Sedlin, N-terminal conserved region; InterPro: IPR006722 Sedlin is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport | Back alignment and domain information |
|---|
| >COG5603 TRS20 Subunit of TRAPP, an ER-Golgi tethering complex [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF10534 CRIC_ras_sig: Connector enhancer of kinase suppressor of ras; InterPro: IPR019555 The multi-domain protein Connector enhancer of kinase suppressor of ras (Connector enhancer of KSR) (CNK) functions as a scaffold in several signal cascades and acts on proliferation, differentiation and apoptosis | Back alignment and domain information |
|---|
| >PF10534 CRIC_ras_sig: Connector enhancer of kinase suppressor of ras; InterPro: IPR019555 The multi-domain protein Connector enhancer of kinase suppressor of ras (Connector enhancer of KSR) (CNK) functions as a scaffold in several signal cascades and acts on proliferation, differentiation and apoptosis | Back alignment and domain information |
|---|
| >KOG3444|consensus | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3369|consensus | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF04099 Sybindin: Sybindin-like family ; InterPro: IPR007233 Sybindin is a physiological syndecan-2 ligand on dendritic spines, the small protrusions on the surface of dendrites that receive the vast majority of excitatory synapses | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG5122 TRS23 Transport protein particle (TRAPP) complex subunit [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00536 SAM_1: SAM domain (Sterile alpha motif); InterPro: IPR021129 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF06663 DUF1170: Protein of unknown function (DUF1170); InterPro: IPR010599 This region of unknown function is situated between the IPR001478 from INTERPRO and IPR001849 from INTERPRO domains in a cytoplasmic and membrane associated protein which appears to function as an adapter protein or regulator of Ras signalling pathways [] | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >KOG3938|consensus | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >smart00454 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >cd00166 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >PF07647 SAM_2: SAM domain (Sterile alpha motif); InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >KOG4375|consensus | Back alignment and domain information |
|---|
| >cd00166 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >smart00454 SAM Sterile alpha motif | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >KOG1170|consensus | Back alignment and domain information |
|---|
| >KOG3938|consensus | Back alignment and domain information |
|---|
| >KOG3368|consensus | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >KOG1170|consensus | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >KOG4375|consensus | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >KOG3606|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG3606|consensus | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >KOG3651|consensus | Back alignment and domain information |
|---|
| >KOG3571|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG3651|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG3571|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >KOG3678|consensus | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG3553|consensus | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3543|consensus | Back alignment and domain information |
|---|
| >KOG4384|consensus | Back alignment and domain information |
|---|
| >KOG3553|consensus | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >KOG4384|consensus | Back alignment and domain information |
|---|
| >KOG3543|consensus | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3678|consensus | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4374|consensus | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >KOG4374|consensus | Back alignment and domain information |
|---|
| >PF09235 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: IPR015316 The fungal Ste50p SAM domain consists of five helices, which form a compact, globular fold | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF09597 IGR: IGR protein motif; InterPro: IPR019083 This entry is found in fungal and plant proteins and contains a conserved IGR motif | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF09597 IGR: IGR protein motif; InterPro: IPR019083 This entry is found in fungal and plant proteins and contains a conserved IGR motif | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1945|consensus | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF02198 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; InterPro: IPR003118 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >KOG4403|consensus | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors | Back alignment and domain information |
|---|
| >smart00251 SAM_PNT SAM / Pointed domain | Back alignment and domain information |
|---|
| >cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family | Back alignment and domain information |
|---|
| >cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor | Back alignment and domain information |
|---|
| >cd08534 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF09235 Ste50p-SAM: Ste50p, sterile alpha motif; InterPro: IPR015316 The fungal Ste50p SAM domain consists of five helices, which form a compact, globular fold | Back alignment and domain information |
|---|
| >cd08535 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >KOG3532|consensus | Back alignment and domain information |
|---|
| >cd08538 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Pointed domain of ESE-2 like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >KOG1945|consensus | Back alignment and domain information |
|---|
| >cd08542 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed domain of ETS-1 | Back alignment and domain information |
|---|
| >cd08203 SAM_PNT Sterile alpha motif (SAM)/Pointed domain | Back alignment and domain information |
|---|
| >cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor | Back alignment and domain information |
|---|
| >KOG3532|consensus | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG4403|consensus | Back alignment and domain information |
|---|
| >KOG3129|consensus | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02198 SAM_PNT: Sterile alpha motif (SAM)/Pointed domain; InterPro: IPR003118 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] | Back alignment and domain information |
|---|
| >cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors | Back alignment and domain information |
|---|
| >cd08536 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed domain of Mae protein homolog | Back alignment and domain information |
|---|
| >cd08543 SAM_PNT-ETS-2 Sterile alpha motif (SAM)/Pointed domain of ETS-2 | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3129|consensus | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08539 SAM_PNT-ESE-3-like Sterile alpha motif (SAM)/Pointed domain of ESE-3 like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >KOG3930|consensus | Back alignment and domain information |
|---|
| >PF06663 DUF1170: Protein of unknown function (DUF1170); InterPro: IPR010599 This region of unknown function is situated between the IPR001478 from INTERPRO and IPR001849 from INTERPRO domains in a cytoplasmic and membrane associated protein which appears to function as an adapter protein or regulator of Ras signalling pathways [] | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family | Back alignment and domain information |
|---|
| >KOG3930|consensus | Back alignment and domain information |
|---|
| >cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 2182 | ||||
| 2j3w_A | 142 | The Crystal Structure Of The Bet3-Trs31-Sedlin Comp | 1e-32 | ||
| 1h3q_A | 140 | Crystal Sturcture Of Sedl At 2.4 Angstroms Resoluti | 1e-32 | ||
| 3bs5_B | 80 | Crystal Structure Of Hcnk2-SamDHYP-Sam Complex Leng | 2e-14 | ||
| 2ean_A | 83 | Solution Structure Of The N-Terminal Sam-Domain Of | 9e-12 | ||
| 2ean_A | 83 | Solution Structure Of The N-Terminal Sam-Domain Of | 9e-12 | ||
| 1wwv_A | 91 | Solution Structure Of The Sam Domain Of Human Conne | 2e-08 | ||
| 1upq_A | 123 | Crystal Structure Of The Pleckstrin Homology (Ph) D | 4e-04 | ||
| 1upq_A | 123 | Crystal Structure Of The Pleckstrin Homology (Ph) D | 4e-04 | ||
| 2yry_A | 122 | Solution Structure Of The Ph Domain Of Pleckstrin H | 4e-04 | ||
| 2yry_A | 122 | Solution Structure Of The Ph Domain Of Pleckstrin H | 4e-04 | ||
| 3bq7_A | 81 | Sam Domain Of Diacylglycerol Kinase Delta1 (E35g) L | 4e-04 |
| >pdb|2J3W|A Chain A, The Crystal Structure Of The Bet3-Trs31-Sedlin Complex. Length = 142 | Back alignment and structure |
|
| >pdb|1H3Q|A Chain A, Crystal Sturcture Of Sedl At 2.4 Angstroms Resolution Length = 140 | Back alignment and structure |
| >pdb|3BS5|B Chain B, Crystal Structure Of Hcnk2-SamDHYP-Sam Complex Length = 80 | Back alignment and structure |
| >pdb|2EAN|A Chain A, Solution Structure Of The N-Terminal Sam-Domain Of Human Kiaa0902 Protein (Connector Enhancer Of Kinase Suppressor Of Ras 2) Length = 83 | Back alignment and structure |
| >pdb|2EAN|A Chain A, Solution Structure Of The N-Terminal Sam-Domain Of Human Kiaa0902 Protein (Connector Enhancer Of Kinase Suppressor Of Ras 2) Length = 83 | Back alignment and structure |
| >pdb|1WWV|A Chain A, Solution Structure Of The Sam Domain Of Human Connector Enhancer Of Ksr-Like Protein Cnk1 Length = 91 | Back alignment and structure |
| >pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 | Back alignment and structure |
| >pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 | Back alignment and structure |
| >pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 | Back alignment and structure |
| >pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 | Back alignment and structure |
| >pdb|3BQ7|A Chain A, Sam Domain Of Diacylglycerol Kinase Delta1 (E35g) Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2j3w_A Sedlin, trafficking protein particle complex protein 2; multisubunit tethering factor, trapp, palmitate, transport, lipoprotein; HET: PLM; 2.1A {Mus musculus} SCOP: d.110.4.3 PDB: 1h3q_A Length = 142 | Back alignment and structure |
|---|
Score = 150 bits (379), Expect = 7e-42
Identities = 60/121 (49%), Positives = 94/121 (77%), Gaps = 2/121 (1%)
Query: 1029 MANRYYFVMVGREDNPLYQRGF--SCKEANDNENKYYYEFIAHASLDLLDEQVWQTDHMY 1086
M+ +YFV+VG DNP+++ F K + +++++ +FIAHA+LDL+DE +W +++MY
Sbjct: 3 MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMY 62
Query: 1087 LKTIDKFNDMMVSAFVTPTGVKFLMVHDSKNEEGIKKFFTSVYELFIKYSLNPFYKINTP 1146
LKT+DKFN+ VSAFVT ++F+M+HD + E+GIK FFT VY+L+IK+++NPFY+ N+P
Sbjct: 63 LKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSP 122
Query: 1147 I 1147
I
Sbjct: 123 I 123
|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 | Back alignment and structure |
|---|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 | Back alignment and structure |
|---|
| >3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74 | Back alignment and structure |
|---|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74 | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76 | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76 | Back alignment and structure |
|---|
| >3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} Length = 78 | Back alignment and structure |
|---|
| >3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} Length = 78 | Back alignment and structure |
|---|
| >2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 91 | Back alignment and structure |
|---|
| >1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 91 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pr6_A Trapp-associated protein TCA17; longin fold, vesicle tethering regulation, trapp complex, TR network, transport protein; 1.80A {Saccharomyces cerevisiae} Length = 162 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A Length = 89 | Back alignment and structure |
|---|
| >1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A Length = 89 | Back alignment and structure |
|---|
| >1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A Length = 89 | Back alignment and structure |
|---|
| >1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A Length = 89 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} Length = 265 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81 | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2j3t_D Trafficking protein particle complex subunit 4; trapp, palmitate, transport, lipoprotein, ER-golgi transport apparatus, protein transport; HET: PLM; 2.4A {Homo sapiens} PDB: 2zmv_A 2jsn_A Length = 219 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82 | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94 | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82 | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Length = 86 | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Length = 86 | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 Length = 97 | Back alignment and structure |
|---|
| >2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 Length = 97 | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 | Back alignment and structure |
|---|
| >1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2j3t_C Trafficking protein particle complex subunit 1, trafficking protein particle complex subunit 3; trapp, palmitate, transport, lipoprotein, ER-golgi transport apparatus, protein transport; HET: PLM; 2.4A {Mus musculus} Length = 145 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 | Back alignment and structure |
|---|
| >2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2kiv_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, tandem, signaling protein, alternative splicing, ANK repeat; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 Length = 78 | Back alignment and structure |
|---|
| >1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 Length = 78 | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334 | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334 | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334 | Back alignment and structure |
|---|
| >3tac_B Liprin-alpha-2; transferase-protein binding complex; 2.20A {Homo sapiens} PDB: 3tad_A Length = 334 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 | Back alignment and structure |
|---|
| >1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A Length = 85 | Back alignment and structure |
|---|
| >1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A Length = 85 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3cue_A Transport protein particle 23 kDa subunit; membrane traffic, GEF, tethering complex, RAB activation, GU nucleotide exchange factor; HET: PLM; 3.70A {Saccharomyces cerevisiae} Length = 219 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae} Length = 119 | Back alignment and structure |
|---|
| >2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae} Length = 119 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 | Back alignment and structure |
|---|
| >2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A Length = 88 | Back alignment and structure |
|---|
| >2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A Length = 88 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A Length = 101 | Back alignment and structure |
|---|
| >2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A Length = 101 | Back alignment and structure |
|---|
| >2dkz_A Hypothetical protein LOC64762; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2182 | |||
| 2j3w_A | 142 | Sedlin, trafficking protein particle complex prote | 99.94 | |
| 3pr6_A | 162 | Trapp-associated protein TCA17; longin fold, vesic | 99.9 | |
| 2j3t_C | 145 | Trafficking protein particle complex subunit 1, tr | 99.88 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.84 | |
| 1wwv_A | 91 | Connector enhancer of kinase suppressor of RAS 1; | 99.81 | |
| 3cue_C | 159 | Transport protein particle 18 kDa subunit; membran | 99.81 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.8 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.79 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.79 | |
| 1wwv_A | 91 | Connector enhancer of kinase suppressor of RAS 1; | 99.79 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.79 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.78 | |
| 3cue_A | 219 | Transport protein particle 23 kDa subunit; membran | 99.78 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.78 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.78 | |
| 2j3t_D | 219 | Trafficking protein particle complex subunit 4; tr | 99.77 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.77 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.76 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.76 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.76 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.75 | |
| 3bs5_B | 80 | Connector enhancer of kinase suppressor of RAS 2; | 99.75 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.75 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.75 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.75 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.75 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.75 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.74 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.74 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.74 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.74 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.74 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.74 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.73 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.73 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.73 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.73 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.73 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.73 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.72 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.72 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.72 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.72 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.72 | |
| 3bs5_B | 80 | Connector enhancer of kinase suppressor of RAS 2; | 99.71 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.71 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 99.71 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.71 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.7 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.7 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.7 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.7 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.7 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.7 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.7 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.7 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.7 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.7 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 99.7 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.7 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.7 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.69 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.69 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.69 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.69 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.69 | |
| 2ean_A | 83 | Connector enhancer of kinase suppressor of RAS 2; | 99.69 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.69 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.69 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.68 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.68 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.68 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.68 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.68 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.67 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.67 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.67 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.67 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.67 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.66 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.66 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.66 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.66 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.66 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.66 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.66 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.66 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.66 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.66 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.66 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.66 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.65 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.65 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.64 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.64 | |
| 2ean_A | 83 | Connector enhancer of kinase suppressor of RAS 2; | 99.64 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.64 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.64 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.63 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.63 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.63 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.62 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.62 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.62 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.62 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.62 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.62 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.61 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.61 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.6 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.6 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.59 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.59 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.58 | |
| 3bs7_A | 78 | Protein aveugle; sterIle alpha motif (SAM) domain, | 99.58 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.58 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.58 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.56 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.56 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.56 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.55 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.54 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.54 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.54 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.54 | |
| 3bs5_A | 106 | Protein aveugle; sterIle alpha motif, SAM domain, | 99.53 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.53 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.5 | |
| 2gle_A | 74 | Neurabin-1; SAM domain, scaffold, protein protein | 99.5 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.5 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.49 | |
| 2e8o_A | 103 | SAM domain and HD domain-containing protein 1; cel | 99.49 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.48 | |
| 3bq7_A | 81 | Diacylglycerol kinase delta; SAM domain, polymeriz | 99.48 | |
| 3bs7_A | 78 | Protein aveugle; sterIle alpha motif (SAM) domain, | 99.47 | |
| 2f3n_A | 76 | SH3 and multiple ankyrin repeat domains 3; postsyn | 99.46 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.46 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.46 | |
| 1v85_A | 91 | Similar to ring finger protein 36; apoptosis, neur | 99.45 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.45 | |
| 3bs5_A | 106 | Protein aveugle; sterIle alpha motif, SAM domain, | 99.44 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.43 | |
| 2gle_A | 74 | Neurabin-1; SAM domain, scaffold, protein protein | 99.43 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.41 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.4 | |
| 2d8c_A | 97 | Phosphatidylcholine:ceramide cholinephosphotransfe | 99.4 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 99.38 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.38 | |
| 2e8o_A | 103 | SAM domain and HD domain-containing protein 1; cel | 99.38 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.37 | |
| 1kw4_A | 89 | Polyhomeotic; SAM domain, polycomb group, polymer, | 99.37 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.36 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.36 | |
| 3bq7_A | 81 | Diacylglycerol kinase delta; SAM domain, polymeriz | 99.35 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 99.34 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.33 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.33 | |
| 1v85_A | 91 | Similar to ring finger protein 36; apoptosis, neur | 99.33 | |
| 2f3n_A | 76 | SH3 and multiple ankyrin repeat domains 3; postsyn | 99.32 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.31 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.28 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.27 | |
| 1kw4_A | 89 | Polyhomeotic; SAM domain, polycomb group, polymer, | 99.26 | |
| 2d8c_A | 97 | Phosphatidylcholine:ceramide cholinephosphotransfe | 99.25 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 99.23 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.23 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 99.22 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.21 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 99.21 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.2 | |
| 1pk1_B | 89 | Sex COMB on midleg CG9495-PA; hetero SAM domain, p | 99.19 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.19 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.18 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 99.18 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 99.16 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 99.16 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 99.16 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 99.16 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.15 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.15 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 99.14 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 99.14 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 99.14 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 99.14 | |
| 2kso_A | 82 | Ephrin type-A receptor 2; SAM domain, heterodimer, | 99.13 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.13 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 99.13 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 99.12 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 99.12 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 99.12 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 99.12 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.11 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 99.11 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 99.11 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.1 | |
| 2kg5_A | 100 | ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- | 99.1 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 99.1 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 99.1 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 99.09 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 99.09 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 99.09 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 99.09 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 99.09 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 99.09 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.08 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.08 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 99.08 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 99.08 | |
| 2eam_A | 80 | Putative 47 kDa protein; cell-free protein synthes | 99.07 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 99.07 | |
| 2e8n_A | 88 | Ephrin type-A receptor 2; cell-free protein synthe | 99.07 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 99.07 | |
| 2ke7_A | 103 | Ankyrin repeat and sterIle alpha motif domain- con | 99.07 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 99.06 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 99.06 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 99.06 | |
| 2qkq_A | 83 | Ephrin type-B receptor 4; ATP-binding, glycoprotei | 99.06 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 99.06 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 99.05 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 99.05 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 99.05 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 99.05 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 99.05 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 99.05 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 99.04 | |
| 2dl0_A | 97 | SAM and SH3 domain-containing protein 1; cell-free | 99.04 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 99.04 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 99.03 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 99.03 | |
| 1pk1_B | 89 | Sex COMB on midleg CG9495-PA; hetero SAM domain, p | 99.03 | |
| 2k4p_A | 86 | Phosphatidylinositol-3,4,5-trisphosphate 5- phosph | 99.03 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 99.03 | |
| 1ucv_A | 81 | Ephrin type-A receptor 8; receptor oligomerization | 99.03 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.02 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 99.02 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 99.02 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 99.02 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 99.02 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 99.02 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.02 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.02 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 99.02 | |
| 3h8m_A | 90 | Ephrin type-A receptor 7; SAM domain, kinase,struc | 99.02 | |
| 1b4f_A | 82 | EPHB2; SAM domain, EPH receptor, signal transducti | 99.02 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 99.02 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 99.02 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 99.01 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 99.01 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 99.01 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 99.01 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 99.01 | |
| 1ow5_A | 85 | Serine/threonine-protein kinase STE11; MAP kinase, | 99.01 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 99.01 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 99.01 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 99.01 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 99.0 | |
| 2kso_A | 82 | Ephrin type-A receptor 2; SAM domain, heterodimer, | 99.0 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 99.0 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 99.0 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 99.0 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 99.0 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 99.0 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 99.0 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.99 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.99 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.99 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.99 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.98 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.98 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 98.98 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.98 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.98 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.98 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.98 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.98 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.98 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.98 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.98 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.98 | |
| 2eao_A | 99 | Ephrin type-B receptor 1; cell-free protein synthe | 98.98 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.98 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.98 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.97 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.97 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 98.97 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.97 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.97 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.97 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.97 | |
| 1b0x_A | 94 | Protein (EPHA4 receptor tyrosine kinase); protein | 98.97 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.97 | |
| 1uqv_A | 85 | STE50 protein; SAM, sterIle alpha motif, helical, | 98.97 | |
| 2qkq_A | 83 | Ephrin type-B receptor 4; ATP-binding, glycoprotei | 98.97 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.97 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.97 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.97 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.97 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.96 | |
| 2eao_A | 99 | Ephrin type-B receptor 1; cell-free protein synthe | 98.96 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.96 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.96 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.96 | |
| 2kg5_A | 100 | ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- | 98.96 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 98.96 | |
| 2eam_A | 80 | Putative 47 kDa protein; cell-free protein synthes | 98.96 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 98.96 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 98.96 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 98.96 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.96 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.95 | |
| 1ow5_A | 85 | Serine/threonine-protein kinase STE11; MAP kinase, | 98.95 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.95 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 98.95 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.95 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.95 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.95 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.95 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.95 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.94 | |
| 2e8n_A | 88 | Ephrin type-A receptor 2; cell-free protein synthe | 98.94 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.94 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.94 | |
| 1b4f_A | 82 | EPHB2; SAM domain, EPH receptor, signal transducti | 98.94 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.94 | |
| 2ke7_A | 103 | Ankyrin repeat and sterIle alpha motif domain- con | 98.93 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.93 | |
| 1ucv_A | 81 | Ephrin type-A receptor 8; receptor oligomerization | 98.93 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.93 | |
| 3hil_A | 82 | Ephrin type-A receptor 1; ATP-binding, kinase, nuc | 98.93 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.93 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.93 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.93 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.93 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.93 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.93 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.92 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.92 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.92 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.92 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.92 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.92 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.92 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.92 | |
| 2k4p_A | 86 | Phosphatidylinositol-3,4,5-trisphosphate 5- phosph | 98.92 | |
| 3h8m_A | 90 | Ephrin type-A receptor 7; SAM domain, kinase,struc | 98.92 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.92 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.92 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.92 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.91 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.91 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 98.91 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.91 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 98.91 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.91 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.91 | |
| 1b0x_A | 94 | Protein (EPHA4 receptor tyrosine kinase); protein | 98.91 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.9 | |
| 3kka_C | 86 | Ephrin type-A receptor 2; ATP-binding, kinase, nuc | 98.9 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.9 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.9 | |
| 3k1r_B | 74 | Usher syndrome type-1G protein; protein-protein co | 98.9 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.9 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.9 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.9 | |
| 1x40_A | 91 | ARAP2; ASAP-related protein2, GTPase activity, sig | 98.89 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.89 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.89 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.89 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.89 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.89 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.89 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.89 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.88 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.88 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.88 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.88 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.88 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.88 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.88 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.88 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.88 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.87 | |
| 2dl0_A | 97 | SAM and SH3 domain-containing protein 1; cell-free | 98.87 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.87 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.87 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.87 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.86 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.86 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.86 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.85 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.85 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.85 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.85 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.85 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.84 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.84 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.35 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.84 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.84 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.84 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.83 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 98.83 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.83 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.83 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.83 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.83 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.82 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 98.82 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.82 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.82 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.82 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.82 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.82 | |
| 3hil_A | 82 | Ephrin type-A receptor 1; ATP-binding, kinase, nuc | 98.81 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.81 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.81 | |
| 2lmr_A | 101 | ODIN, ankyrin repeat and SAM domain-containing pro | 98.8 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.8 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.8 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.79 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.79 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.79 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.28 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 98.79 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.79 | |
| 3kka_C | 86 | Ephrin type-A receptor 2; ATP-binding, kinase, nuc | 98.79 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.78 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.78 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.78 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.78 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.78 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.78 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.78 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.78 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.78 | |
| 1x40_A | 91 | ARAP2; ASAP-related protein2, GTPase activity, sig | 98.77 | |
| 3tad_C | 265 | Liprin-beta-1; protein binding; 2.90A {Mus musculu | 98.77 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.77 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.77 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.77 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.77 | |
| 1uqv_A | 85 | STE50 protein; SAM, sterIle alpha motif, helical, | 98.77 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.76 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.76 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.76 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.76 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.76 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.76 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.76 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.75 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.75 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.75 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.75 | |
| 3k1r_B | 74 | Usher syndrome type-1G protein; protein-protein co | 98.75 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.74 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.74 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.74 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.74 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.74 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.73 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.73 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.73 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.73 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.73 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.73 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.73 | |
| 3sei_A | 149 | Caskin-1; SAM domain, protein-protein interaction, | 98.72 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.72 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.72 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.72 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.71 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.71 | |
| 2lmr_A | 101 | ODIN, ankyrin repeat and SAM domain-containing pro | 98.71 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.71 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.71 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.7 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.7 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.7 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.7 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.69 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.69 | |
| 1v38_A | 78 | SAM-domain protein samsn-1; structural genomics, h | 98.69 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.69 | |
| 3sei_A | 149 | Caskin-1; SAM domain, protein-protein interaction, | 98.69 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.69 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.68 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.68 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.68 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.68 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.68 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.68 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.67 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.67 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.67 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.67 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 98.66 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.66 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.66 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.66 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.65 |
| >2j3w_A Sedlin, trafficking protein particle complex protein 2; multisubunit tethering factor, trapp, palmitate, transport, lipoprotein; HET: PLM; 2.1A {Mus musculus} SCOP: d.110.4.3 PDB: 1h3q_A | Back alignment and structure |
|---|
Probab=99.94 E-value=1.4e-26 Score=246.31 Aligned_cols=128 Identities=47% Similarity=0.919 Sum_probs=115.9
Q ss_pred ccceEEEEEEcCCCCceEEeccCCCccC--CCchhHHHHHHHHHHHHHHHhhhcccCCCCceeecccCCeEEEEEEcCCC
Q psy84 1029 MANRYYFVMVGREDNPLYQRGFSCKEAN--DNENKYYYEFIAHASLDLLDEQVWQTDHMYLKTIDKFNDMMVSAFVTPTG 1106 (2182)
Q Consensus 1029 mm~i~~laIIGk~d~PLY~~~f~s~~~~--~~~~~l~~qfi~HsSLDiIeEk~~~t~~~yLg~Ld~~e~~~VygYvT~Tg 1106 (2182)
|+++|||+|||++|+|||+++|+..... .++..+.+||++|++||+|+++.|.++++||+.++++++|+||||+|+||
T Consensus 3 M~~i~~~~Ii~~~~~ply~~~~~~~~~~~~~~~~~l~~~~i~hs~ldiv~~~~~~~~~~~l~~~~~~~~y~v~~~~T~tg 82 (142)
T 2j3w_A 3 MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGH 82 (142)
T ss_dssp CCCCEEEEEECTTSCEEEEEEECCSCCGGGHHHHHHHHHHHHHHHHHHHHHHGGGCSCSEEEEEEEETTEEEEEEECTTC
T ss_pred cceEEEEEEEeCCCCEEEEEecCCcCcCCccHHHHHHHHHHHHHHHHHHHHhcCCCCcceeEeeecccceEEEEEEcCCC
Confidence 5568999999999999999999864322 12345778899999999999999999999999999999999999999999
Q ss_pred cEEEEEecCCChHHHHHHHHHHHHHHHHhhcCCCccccCCcCCCCchhhh
Q psy84 1107 VKFLMVHDSKNEEGIKKFFTSVYELFIKYSLNPFYKINTPINNWKPDQVA 1156 (2182)
Q Consensus 1107 iKFILi~d~~~e~~Ir~fF~~VhelYvd~vmNPFy~~~~PI~sWs~dQVv 1156 (2182)
+||||+++..++++||.||++||++|++++|||||.+++||++-.||+-+
T Consensus 83 ~Kfvl~~d~~~~~~i~~~~~~iy~~Y~~~v~NPfy~~~~pI~s~~Fd~~v 132 (142)
T 2j3w_A 83 MRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKV 132 (142)
T ss_dssp CEEEEEESSCCHHHHHHHHHHHHHHHHHHHHSTTCCTTCCCCCHHHHHHH
T ss_pred cEEEEEeCCCCcHHHHHHHHHHHHHHHHHhcCCCCCCCCceecHHHHHHH
Confidence 99999999877889999999999999999999999999999999998755
|
| >3pr6_A Trapp-associated protein TCA17; longin fold, vesicle tethering regulation, trapp complex, TR network, transport protein; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j3t_C Trafficking protein particle complex subunit 1, trafficking protein particle complex subunit 3; trapp, palmitate, transport, lipoprotein, ER-golgi transport apparatus, protein transport; HET: PLM; 2.4A {Mus musculus} | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >3cue_C Transport protein particle 18 kDa subunit; membrane traffic, GEF, tethering complex, RAB activation, GU nucleotide exchange factor; HET: PLM; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >3cue_A Transport protein particle 23 kDa subunit; membrane traffic, GEF, tethering complex, RAB activation, GU nucleotide exchange factor; HET: PLM; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j3t_D Trafficking protein particle complex subunit 4; trapp, palmitate, transport, lipoprotein, ER-golgi transport apparatus, protein transport; HET: PLM; 2.4A {Homo sapiens} PDB: 2zmv_A 2jsn_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1v85_A Similar to ring finger protein 36; apoptosis, neuron, cell death, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1kw4_A Polyhomeotic; SAM domain, polycomb group, polymer, DNA binding protein; 1.75A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk1_A | Back alignment and structure |
|---|
| >2d8c_A Phosphatidylcholine:ceramide cholinephosphotransferase 1; cell-free protein synthesis, protein regulation, lipid metabolism, structural genomics; NMR {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >1pk1_B Sex COMB on midleg CG9495-PA; hetero SAM domain, polymers, transcriptional repression, transcription repression; 1.80A {Drosophila melanogaster} SCOP: a.60.1.2 PDB: 1pk3_A | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A | Back alignment and structure |
|---|
| >2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B | Back alignment and structure |
|---|
| >3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dl0_A SAM and SH3 domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} SCOP: a.60.1.0 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >3tad_C Liprin-beta-1; protein binding; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >1uqv_A STE50 protein; SAM, sterIle alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1z1v_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 2182 | ||||
| d2j3wa1 | 140 | d.110.4.3 (A:1-140) Sedlin (SEDL) {Mouse (Mus musc | 7e-41 | |
| d1wwva1 | 78 | a.60.1.2 (A:8-85) Connector enhancer of kinase sup | 3e-18 | |
| d1wwva1 | 78 | a.60.1.2 (A:8-85) Connector enhancer of kinase sup | 1e-17 | |
| d1kw4a_ | 70 | a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste | 1e-15 | |
| d1kw4a_ | 70 | a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste | 4e-15 | |
| d2f3na1 | 64 | a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat | 2e-14 | |
| d2f3na1 | 64 | a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat | 2e-14 | |
| d2d8ca1 | 85 | a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 { | 2e-13 | |
| d2d8ca1 | 85 | a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 { | 4e-13 | |
| d1pk3a1 | 63 | a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly | 8e-13 | |
| d1pk3a1 | 63 | a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly | 8e-13 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 1e-12 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 1e-12 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 4e-12 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 4e-12 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 4e-12 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 4e-12 | |
| d1x45a1 | 85 | b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei | 4e-12 | |
| d1x45a1 | 85 | b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei | 4e-12 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-11 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 4e-10 | |
| d1v38a_ | 78 | a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M | 2e-11 | |
| d1v38a_ | 78 | a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M | 4e-11 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 4e-11 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 4e-11 | |
| d1kwaa_ | 88 | b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta | 4e-11 | |
| d1kwaa_ | 88 | b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta | 4e-11 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 4e-11 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 4e-11 | |
| d1b0xa_ | 72 | a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou | 1e-10 | |
| d1b0xa_ | 72 | a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou | 1e-10 | |
| d1p1da2 | 99 | b.36.1.1 (A:115-213) Glutamate receptor interactin | 2e-10 | |
| d1p1da2 | 99 | b.36.1.1 (A:115-213) Glutamate receptor interactin | 2e-10 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 3e-10 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 3e-10 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 7e-10 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 7e-10 | |
| d1ucva_ | 81 | a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal | 8e-10 | |
| d1ucva_ | 81 | a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal | 8e-10 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 9e-10 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 9e-10 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 1e-09 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 1e-09 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 1e-09 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 1e-09 | |
| d1x40a1 | 78 | a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human | 1e-09 | |
| d1x40a1 | 78 | a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human | 4e-09 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 1e-09 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 1e-09 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 2e-09 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 2e-09 | |
| d1x6da1 | 107 | b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap | 2e-09 | |
| d1x6da1 | 107 | b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap | 2e-09 | |
| d1qava_ | 90 | b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta | 2e-09 | |
| d1qava_ | 90 | b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta | 2e-09 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 4e-09 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 4e-09 | |
| d1v62a_ | 117 | b.36.1.1 (A:) Glutamate receptor interacting prote | 4e-09 | |
| d1v62a_ | 117 | b.36.1.1 (A:) Glutamate receptor interacting prote | 4e-09 | |
| d2cssa1 | 108 | b.36.1.1 (A:8-115) Regulating synaptic membrane ex | 5e-09 | |
| d2cssa1 | 108 | b.36.1.1 (A:8-115) Regulating synaptic membrane ex | 5e-09 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 5e-09 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 5e-09 | |
| d2fcfa1 | 96 | b.36.1.1 (A:1148-1243) Multiple PDZ domain protein | 6e-09 | |
| d2fcfa1 | 96 | b.36.1.1 (A:1148-1243) Multiple PDZ domain protein | 6e-09 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 6e-09 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 6e-09 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 6e-09 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 6e-09 | |
| d1v5qa_ | 122 | b.36.1.1 (A:) Glutamate receptor interacting prote | 9e-09 | |
| d1v5qa_ | 122 | b.36.1.1 (A:) Glutamate receptor interacting prote | 9e-09 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 1e-08 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 1e-08 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 1e-08 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 1e-08 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 1e-08 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 1e-08 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 1e-08 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 1e-08 | |
| d1b4fa_ | 74 | a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) | 1e-08 | |
| d1b4fa_ | 74 | a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) | 1e-08 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 2e-08 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 2e-08 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 2e-08 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 2e-08 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 2e-08 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 2e-08 | |
| d1ufxa_ | 103 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 3e-08 | |
| d1ufxa_ | 103 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 3e-08 | |
| d1va8a1 | 100 | b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M | 3e-08 | |
| d1va8a1 | 100 | b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M | 3e-08 | |
| d1uewa_ | 114 | b.36.1.1 (A:) Membrane associated guanylate kinase | 4e-08 | |
| d1uewa_ | 114 | b.36.1.1 (A:) Membrane associated guanylate kinase | 4e-08 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 7e-08 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 7e-08 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 7e-08 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 7e-08 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 9e-08 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 9e-08 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 1e-07 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 1e-07 | |
| d1ujua_ | 111 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 2e-07 | |
| d1ujua_ | 111 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 2e-07 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 3e-07 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 3e-07 | |
| d1uepa_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 3e-07 | |
| d1uepa_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 3e-07 | |
| d1q3oa_ | 104 | b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv | 3e-07 | |
| d1q3oa_ | 104 | b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv | 3e-07 | |
| d1qaua_ | 112 | b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS | 5e-07 | |
| d1qaua_ | 112 | b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS | 5e-07 | |
| d1wi4a1 | 96 | b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou | 5e-07 | |
| d1wi4a1 | 96 | b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou | 5e-07 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 5e-07 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 5e-07 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 1e-06 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 1e-06 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 2e-06 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 2e-06 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 2e-06 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 2e-06 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 2e-06 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 2e-06 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 3e-06 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 3e-06 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 4e-06 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 4e-06 | |
| d2f0aa1 | 92 | b.36.1.1 (A:251-342) Segment polarity protein dish | 4e-06 | |
| d2f0aa1 | 92 | b.36.1.1 (A:251-342) Segment polarity protein dish | 4e-06 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 5e-06 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 5e-06 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 6e-06 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 6e-06 | |
| d1m5za_ | 91 | b.36.1.1 (A:) Glutamate receptor interacting prote | 6e-06 | |
| d1m5za_ | 91 | b.36.1.1 (A:) Glutamate receptor interacting prote | 6e-06 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 7e-06 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 7e-06 | |
| d1ow5a_ | 60 | a.60.1.2 (A:) Serine/threonine-protein kinase ste1 | 1e-05 | |
| d1ow5a_ | 60 | a.60.1.2 (A:) Serine/threonine-protein kinase ste1 | 1e-05 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 1e-05 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 1e-05 | |
| d1wi2a_ | 104 | b.36.1.1 (A:) PDZ domain containing protein 11, Pd | 1e-05 | |
| d1wi2a_ | 104 | b.36.1.1 (A:) PDZ domain containing protein 11, Pd | 1e-05 | |
| d1y7na1 | 79 | b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote | 1e-05 | |
| d1y7na1 | 79 | b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote | 1e-05 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-05 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-05 | |
| d1r6ja_ | 82 | b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta | 2e-05 | |
| d1r6ja_ | 82 | b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta | 2e-05 | |
| d1vb7a_ | 94 | b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus | 4e-05 | |
| d1vb7a_ | 94 | b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus | 4e-05 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 4e-05 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 4e-05 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 5e-05 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 5e-05 | |
| d1wh1a_ | 124 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 7e-05 | |
| d1wh1a_ | 124 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 7e-05 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 8e-05 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 8e-05 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 1e-04 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 1e-04 | |
| d1wifa_ | 126 | b.36.1.1 (A:) hypothetical PDZ domain containing p | 1e-04 | |
| d1wifa_ | 126 | b.36.1.1 (A:) hypothetical PDZ domain containing p | 1e-04 | |
| d1rgwa_ | 85 | b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo | 2e-04 | |
| d1rgwa_ | 85 | b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo | 2e-04 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 7e-04 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 7e-04 | |
| d1wf7a_ | 103 | b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu | 0.004 | |
| d1wf7a_ | 103 | b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu | 0.004 |
| >d2j3wa1 d.110.4.3 (A:1-140) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]} Length = 140 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: SNARE-like family: Sedlin (SEDL) domain: Sedlin (SEDL) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 145 bits (368), Expect = 7e-41
Identities = 62/150 (41%), Positives = 100/150 (66%), Gaps = 12/150 (8%)
Query: 1029 MANRYYFVMVGREDNPLYQRGFSC--KEANDNENKYYYEFIAHASLDLLDEQVWQTDHMY 1086
M+ +YFV+VG DNP+++ F K + +++++ +FIAHA+LDL+DE +W +++MY
Sbjct: 1 MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMY 60
Query: 1087 LKTIDKFNDMMVSAFVTPTGVKFLMVHDSKNEEGIKKFFTSVYELFIKYSLNPFYKINTP 1146
LKT+DKFN+ VSAFVT ++F+M+HD + E+GIK FFT VY+L+IK+++NPFY+ N+P
Sbjct: 61 LKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSP 120
Query: 1147 INNWKPDQVADWLKGLDVSIHRYVESFLNN 1176
I + D + + L +
Sbjct: 121 IRS----------SAFDRKVQFLGKKHLLS 140
|
| >d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70 | Back information, alignment and structure |
|---|
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70 | Back information, alignment and structure |
|---|
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64 | Back information, alignment and structure |
|---|
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64 | Back information, alignment and structure |
|---|
| >d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 63 | Back information, alignment and structure |
|---|
| >d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 63 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2182 | |||
| d2j3wa1 | 140 | Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090] | 99.95 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.77 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.75 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.73 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.72 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.72 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.7 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.7 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.7 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.7 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.69 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.68 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.68 | |
| d1wwva1 | 78 | Connector enhancer of kinase suppressor of Ras 1, | 99.68 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.68 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.67 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.67 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.67 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.67 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.67 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.66 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.66 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.65 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.65 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.65 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.65 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.64 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.64 | |
| d1wwva1 | 78 | Connector enhancer of kinase suppressor of Ras 1, | 99.63 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.63 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.63 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.62 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.62 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.62 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.61 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.61 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.6 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.6 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.6 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.59 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.58 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.58 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.58 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.57 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.57 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.57 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.57 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.56 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.54 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.54 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.54 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.54 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.53 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.53 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.52 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.52 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.52 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 99.51 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.5 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 99.49 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.49 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.48 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 99.48 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 99.47 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.47 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 99.46 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 99.45 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 99.45 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 99.45 | |
| d2d8ca1 | 85 | Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu | 99.44 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.44 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.44 | |
| d2f3na1 | 64 | Sh3 and multiple ankyrin repeat domains 3 (Shank3) | 99.44 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 99.44 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.43 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.43 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.43 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.43 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.42 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.42 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 99.42 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 99.42 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 99.42 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 99.42 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.41 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1kw4a_ | 70 | Polyhomeotic {Drosophila melanogaster [TaxId: 7227 | 99.41 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 99.41 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.4 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 99.4 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 99.4 | |
| d1pk3a1 | 63 | Polycomb protein Scm {Fruit fly (Drosophila melano | 99.4 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 99.4 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.4 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 99.4 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 99.39 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 99.39 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.39 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 99.39 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 99.38 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 99.38 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 99.38 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 99.38 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.37 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.37 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.37 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 99.37 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.36 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.36 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 99.36 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.36 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 99.35 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 99.35 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 99.35 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 99.35 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.34 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.34 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 99.33 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.33 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 99.33 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.33 | |
| d2d8ca1 | 85 | Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculu | 99.33 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 99.32 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 99.32 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.32 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.31 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.31 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.3 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.3 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 99.3 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.29 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.29 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.29 | |
| d1kw4a_ | 70 | Polyhomeotic {Drosophila melanogaster [TaxId: 7227 | 99.28 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.28 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.28 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 99.28 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.27 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 99.27 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.27 | |
| d2f3na1 | 64 | Sh3 and multiple ankyrin repeat domains 3 (Shank3) | 99.27 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 99.27 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 99.26 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.26 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.26 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 99.26 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 99.25 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.25 | |
| d1pk3a1 | 63 | Polycomb protein Scm {Fruit fly (Drosophila melano | 99.25 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.25 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 99.24 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.23 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 99.23 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.22 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 99.22 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 99.21 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.21 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.21 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 99.21 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 99.2 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 99.2 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 99.19 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 99.18 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 99.18 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 99.16 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.15 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 99.15 | |
| d1v38a_ | 78 | Sam-domain protein samsn-1 {Mouse (Mus musculus) [ | 99.13 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 99.12 | |
| d1ow5a_ | 60 | Serine/threonine-protein kinase ste11 {Baker's yea | 99.11 | |
| d1b4fa_ | 74 | EphB2 receptor {Human (Homo sapiens) [TaxId: 9606] | 99.11 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 99.11 | |
| d1x40a1 | 78 | Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta | 99.09 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 99.09 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 99.08 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 99.05 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.03 | |
| d1ucva_ | 81 | Ephrin type-A receptor 8, C-terminal domain {Human | 99.03 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 99.02 | |
| d1b0xa_ | 72 | EphA4 receptor tyrosine kinases {Mouse (Mus muscul | 99.01 | |
| d1v38a_ | 78 | Sam-domain protein samsn-1 {Mouse (Mus musculus) [ | 99.01 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.0 | |
| d1b4fa_ | 74 | EphB2 receptor {Human (Homo sapiens) [TaxId: 9606] | 98.99 | |
| d1ow5a_ | 60 | Serine/threonine-protein kinase ste11 {Baker's yea | 98.96 | |
| d1x40a1 | 78 | Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta | 98.95 | |
| d1b0xa_ | 72 | EphA4 receptor tyrosine kinases {Mouse (Mus muscul | 98.91 | |
| d1oxja1 | 62 | RNA-binding protein Smaug {Drosophila melanogaster | 98.91 | |
| d1ucva_ | 81 | Ephrin type-A receptor 8, C-terminal domain {Human | 98.89 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.88 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.8 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.78 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.74 | |
| d1dxsa_ | 57 | C-terminal domain of p73 {Human (Homo sapiens) [Ta | 98.73 | |
| d1oxja1 | 62 | RNA-binding protein Smaug {Drosophila melanogaster | 98.68 | |
| d1dxsa_ | 57 | C-terminal domain of p73 {Human (Homo sapiens) [Ta | 98.53 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.38 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.33 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.18 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.1 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.03 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.03 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.02 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 97.96 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 97.95 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.92 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.91 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 97.85 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 97.79 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 97.73 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.27 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.2 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 97.08 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 97.04 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 97.02 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.02 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.0 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 96.95 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 96.78 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.4 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 96.29 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 96.18 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 96.15 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 96.11 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 96.1 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 96.1 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.07 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 95.97 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 95.92 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 95.89 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 95.71 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 95.66 | |
| d1z1va1 | 70 | Ste50p, N-terminal domain {Baker's yeast (Saccharo | 94.57 | |
| d1rg6a_ | 67 | C-terminal domain of p63 {Human (Homo sapiens) [Ta | 93.89 | |
| d1sv0a_ | 77 | Ets DNA-binding protein pokkuri (Yan) {Fruit fly ( | 92.82 | |
| d1ji7a_ | 77 | Etv6 transcription factor pointed domain (Tel SAM) | 92.12 | |
| d1rg6a_ | 67 | C-terminal domain of p63 {Human (Homo sapiens) [Ta | 92.06 | |
| d1z1va1 | 70 | Ste50p, N-terminal domain {Baker's yeast (Saccharo | 91.12 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 90.44 | |
| d1sxda_ | 91 | GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 1 | 89.82 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 89.05 | |
| d1sxea_ | 97 | Transcriptional regulator ERG {Human (Homo sapiens | 86.46 | |
| d1sv0c_ | 82 | Modulator of the activity of Ets (MAE, CG15085-PA) | 85.15 | |
| d2jv3a_ | 110 | Ets-1 transcription factor pointed domain {Mouse ( | 84.52 | |
| d1sv0a_ | 77 | Ets DNA-binding protein pokkuri (Yan) {Fruit fly ( | 84.41 | |
| d1ji7a_ | 77 | Etv6 transcription factor pointed domain (Tel SAM) | 80.8 |
| >d2j3wa1 d.110.4.3 (A:1-140) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: SNARE-like family: Sedlin (SEDL) domain: Sedlin (SEDL) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95 E-value=8.7e-29 Score=260.17 Aligned_cols=128 Identities=47% Similarity=0.919 Sum_probs=118.6
Q ss_pred ccceEEEEEEcCCCCceEEeccCCCccC--CCchhHHHHHHHHHHHHHHHhhhcccCCCCceeecccCCeEEEEEEcCCC
Q psy84 1029 MANRYYFVMVGREDNPLYQRGFSCKEAN--DNENKYYYEFIAHASLDLLDEQVWQTDHMYLKTIDKFNDMMVSAFVTPTG 1106 (2182)
Q Consensus 1029 mm~i~~laIIGk~d~PLY~~~f~s~~~~--~~~~~l~~qfi~HsSLDiIeEk~~~t~~~yLg~Ld~~e~~~VygYvT~Tg 1106 (2182)
|.++|+|+|||++|+|||+++|++.... .++..+.+||++|+|||+||+++|.++++|||.|+.+++|+||||+|+||
T Consensus 1 ~~~~y~f~IIg~~~~pLY~~ef~~~~~~~~~~~~~~~~~fi~hssLDive~~~~~~~~~~l~~l~~~~~~~v~~y~T~tg 80 (140)
T d2j3wa1 1 MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGH 80 (140)
T ss_dssp CCCCEEEEEECTTSCEEEEEEECCSCCGGGHHHHHHHHHHHHHHHHHHHHHHGGGCSCSEEEEEEEETTEEEEEEECTTC
T ss_pred CccEEEEEEEcCCCCeeEEEecCCcccccccchHHHHHHHHHHHHHHHHHHhcccCCCccceeEEecCCEEEEEEEcCCC
Confidence 6789999999999999999999864322 24457889999999999999999999999999999999999999999999
Q ss_pred cEEEEEecCCChHHHHHHHHHHHHHHHHhhcCCCccccCCcCCCCchhhh
Q psy84 1107 VKFLMVHDSKNEEGIKKFFTSVYELFIKYSLNPFYKINTPINNWKPDQVA 1156 (2182)
Q Consensus 1107 iKFILi~d~~~e~~Ir~fF~~VhelYvd~vmNPFy~~~~PI~sWs~dQVv 1156 (2182)
+||||+++...++.++.||+++|++|++++|||||.+++||++-.||+-+
T Consensus 81 ~Kfvl~td~~~~~~i~~~~~~v~~lYv~~v~NPfy~~~~pI~s~~Fd~~v 130 (140)
T d2j3wa1 81 MRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKV 130 (140)
T ss_dssp CEEEEEESSCCHHHHHHHHHHHHHHHHHHHHSTTCCTTCCCCCHHHHHHH
T ss_pred cEEEEEeCCCcchHHHHHHHHHHHHHHHHhhCccCCCCCcccCHHHHHHH
Confidence 99999999988999999999999999999999999999999999998755
|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|