Psyllid ID: psy8502
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| 91091632 | 436 | PREDICTED: similar to SIFamide receptor | 0.535 | 0.206 | 0.641 | 2e-24 | |
| 347969700 | 862 | AGAP003335-PA [Anopheles gambiae str. PE | 0.648 | 0.126 | 0.522 | 2e-24 | |
| 350397193 | 483 | PREDICTED: neuropeptide FF receptor 2-li | 0.928 | 0.322 | 0.411 | 4e-24 | |
| 357611925 | 175 | putative SIFamide receptor [Danaus plexi | 0.642 | 0.617 | 0.557 | 5e-24 | |
| 193659704 | 440 | PREDICTED: neuropeptide FF receptor 2-li | 0.488 | 0.186 | 0.670 | 5e-24 | |
| 383857307 | 468 | PREDICTED: neuropeptide FF receptor 2-li | 0.958 | 0.344 | 0.423 | 1e-23 | |
| 340726492 | 483 | PREDICTED: neuropeptide FF receptor 2-li | 0.928 | 0.322 | 0.4 | 2e-23 | |
| 195053868 | 771 | GH18883 [Drosophila grimshawi] gi|193895 | 0.434 | 0.094 | 0.684 | 3e-23 | |
| 157111907 | 151 | hypothetical protein AaeL_AAEL005994 [Ae | 0.809 | 0.900 | 0.441 | 4e-23 | |
| 402232702 | 465 | TPA_inf: SIFamide receptor [Bombyx mori] | 0.744 | 0.268 | 0.507 | 4e-23 |
| >gi|91091632|ref|XP_970225.1| PREDICTED: similar to SIFamide receptor [Tribolium castaneum] gi|270001267|gb|EEZ97714.1| hypothetical protein TcasGA2_TC011156 [Tribolium castaneum] gi|402232706|tpg|DAA35194.1| TPA_inf: SIFamide receptor, partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 117 bits (293), Expect = 2e-24, Method: Compositional matrix adjust.
Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
Query: 74 NLTLNTT--SGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTN 131
N TLN T + VPEL YRHS +T + + YL VF +G+VGN VIAVV RSPRMR VTN
Sbjct: 63 NATLNATETAFVPELFYRHSMAMTAVYCVAYLLVFAVGIVGNFFVIAVVFRSPRMRTVTN 122
Query: 132 YFIVNLAVADMLVITLCLPATLMANIYVHFDL 163
+FIVNLAVAD+LVI CLPATLM+NI+V + L
Sbjct: 123 FFIVNLAVADILVIVFCLPATLMSNIFVPWVL 154
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|347969700|ref|XP_314231.4| AGAP003335-PA [Anopheles gambiae str. PEST] gi|333469231|gb|EAA09601.4| AGAP003335-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|350397193|ref|XP_003484801.1| PREDICTED: neuropeptide FF receptor 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|357611925|gb|EHJ67721.1| putative SIFamide receptor [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|193659704|ref|XP_001947491.1| PREDICTED: neuropeptide FF receptor 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383857307|ref|XP_003704146.1| PREDICTED: neuropeptide FF receptor 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340726492|ref|XP_003401591.1| PREDICTED: neuropeptide FF receptor 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|195053868|ref|XP_001993848.1| GH18883 [Drosophila grimshawi] gi|193895718|gb|EDV94584.1| GH18883 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|157111907|ref|XP_001657350.1| hypothetical protein AaeL_AAEL005994 [Aedes aegypti] gi|108878249|gb|EAT42474.1| AAEL005994-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|402232702|tpg|DAA35192.1| TPA_inf: SIFamide receptor [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| FB|FBgn0038880 | 758 | SIFR "SIFamide receptor" [Dros | 0.434 | 0.096 | 0.657 | 7.3e-22 | |
| ZFIN|ZDB-GENE-060526-183 | 422 | npffr2.1 "neuropeptide FF rece | 0.470 | 0.187 | 0.455 | 4.5e-15 | |
| UNIPROTKB|F1NVD9 | 422 | NPFFR2 "Uncharacterized protei | 0.470 | 0.187 | 0.481 | 1.3e-14 | |
| ZFIN|ZDB-GENE-070705-159 | 438 | npffr2.2 "neuropeptide FF rece | 0.470 | 0.180 | 0.455 | 2.3e-14 | |
| ZFIN|ZDB-GENE-060526-110 | 480 | npffr1l2 "neuropeptide FF rece | 0.613 | 0.214 | 0.422 | 2.8e-14 | |
| UNIPROTKB|F1SUD0 | 432 | NPFFR1 "Uncharacterized protei | 0.416 | 0.162 | 0.514 | 2.8e-14 | |
| ZFIN|ZDB-GENE-091118-18 | 306 | npffr1l1 "neuropeptide FF rece | 0.416 | 0.228 | 0.514 | 3e-14 | |
| ZFIN|ZDB-GENE-040924-8 | 384 | npy2r "neuropeptide Y receptor | 0.392 | 0.171 | 0.560 | 7.3e-14 | |
| RGD|620475 | 381 | Npy2r "neuropeptide Y receptor | 0.357 | 0.157 | 0.616 | 9.2e-14 | |
| UNIPROTKB|F1RYR8 | 382 | NPY2R "Neuropeptide Y receptor | 0.357 | 0.157 | 0.633 | 9.3e-14 |
| FB|FBgn0038880 SIFR "SIFamide receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 265 (98.3 bits), Expect = 7.3e-22, P = 7.3e-22
Identities = 48/73 (65%), Positives = 62/73 (84%)
Query: 87 LYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVIT 146
LYRHS +++ + + Y+ VFL+GL+GNS VIAVV+R+PRMR VTNYFIVNLA+AD+LVI
Sbjct: 200 LYRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIV 259
Query: 147 LCLPATLMANIYV 159
CLPATL+ NI+V
Sbjct: 260 FCLPATLIGNIFV 272
|
|
| ZFIN|ZDB-GENE-060526-183 npffr2.1 "neuropeptide FF receptor 2.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVD9 NPFFR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-159 npffr2.2 "neuropeptide FF receptor 2.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060526-110 npffr1l2 "neuropeptide FF receptor 1 like 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUD0 NPFFR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091118-18 npffr1l1 "neuropeptide FF receptor 1 like 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040924-8 npy2r "neuropeptide Y receptor Y2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|620475 Npy2r "neuropeptide Y receptor Y2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYR8 NPY2R "Neuropeptide Y receptor type 2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 2e-07 | |
| PHA02638 | 417 | PHA02638, PHA02638, CC chemokine receptor-like pro | 0.003 | |
| PHA03087 | 335 | PHA03087, PHA03087, G protein-coupled chemokine re | 0.003 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 48.8 bits (117), Expect = 2e-07
Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
Query: 118 AVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFD 162
V++R+ ++R TN F++NLAVAD+L + P V D
Sbjct: 1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPP--WALYYLVGGD 43
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
| >gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| KOG4219|consensus | 423 | 99.43 | ||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.27 | |
| KOG4220|consensus | 503 | 99.16 | ||
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 99.02 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 98.99 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 98.78 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 98.77 | |
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 98.49 | |
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 97.81 | |
| KOG2087|consensus | 363 | 95.65 | ||
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 94.89 | |
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 93.74 | |
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 92.96 | |
| PF05462 | 303 | Dicty_CAR: Slime mold cyclic AMP receptor | 91.23 | |
| PF11710 | 201 | Git3: G protein-coupled glucose receptor regulatin | 88.2 | |
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 88.03 | |
| PF10317 | 292 | 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept | 80.39 |
| >KOG4219|consensus | Back alignment and domain information |
|---|
Probab=99.43 E-value=1.1e-13 Score=117.81 Aligned_cols=79 Identities=27% Similarity=0.418 Sum_probs=73.3
Q ss_pred ccCCCchhhHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCCC
Q psy8502 88 YRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSL 166 (168)
Q Consensus 88 ~~~~~~~~~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~~ 166 (168)
+......+.++.++|.++.+++++||++|+|++..+|++|+.+|+||+|||+||++.++++.|+...+.+...|.||.+
T Consensus 28 f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f 106 (423)
T KOG4219|consen 28 FVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSF 106 (423)
T ss_pred ccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccc
Confidence 3445667788899999999999999999999999999999999999999999999999999999999999999999983
|
|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF05462 Dicty_CAR: Slime mold cyclic AMP receptor | Back alignment and domain information |
|---|
| >PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
| >PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 168 | ||||
| 4djh_A | 480 | Structure Of The Human Kappa Opioid Receptor In Com | 8e-09 | ||
| 4ea3_B | 434 | Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI | 8e-07 | ||
| 3pbl_A | 481 | Structure Of The Human Dopamine D3 Receptor In Comp | 1e-05 | ||
| 3pwh_A | 329 | Thermostabilised Adenosine A2a Receptor Length = 32 | 6e-05 | ||
| 4dkl_A | 464 | Crystal Structure Of The Mu-Opioid Receptor Bound T | 8e-05 | ||
| 4eiy_A | 447 | Crystal Structure Of The Chimeric Protein Of A2aar- | 1e-04 | ||
| 3eml_A | 488 | The 2.6 A Crystal Structure Of A Human A2a Adenosin | 1e-04 | ||
| 3oe6_A | 508 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 2e-04 | ||
| 2ydo_A | 325 | Thermostabilised Human A2a Receptor With Adenosine | 2e-04 | ||
| 3vg9_A | 326 | Crystal Structure Of Human Adenosine A2a Receptor W | 2e-04 | ||
| 3odu_A | 502 | The 2.5 A Structure Of The Cxcr4 Chemokine Receptor | 5e-04 | ||
| 3oe0_A | 499 | Crystal Structure Of The Cxcr4 Chemokine Receptor I | 5e-04 | ||
| 4daj_A | 479 | Structure Of The M3 Muscarinic Acetylcholine Recept | 5e-04 | ||
| 4ej4_A | 461 | Structure Of The Delta Opioid Receptor Bound To Nal | 7e-04 |
| >pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 | Back alignment and structure |
|
| >pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 | Back alignment and structure |
| >pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 | Back alignment and structure |
| >pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 | Back alignment and structure |
| >pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 | Back alignment and structure |
| >pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 | Back alignment and structure |
| >pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 | Back alignment and structure |
| >pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 | Back alignment and structure |
| >pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 | Back alignment and structure |
| >pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 | Back alignment and structure |
| >pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 | Back alignment and structure |
| >pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 | Back alignment and structure |
| >pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 | Back alignment and structure |
| >pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 3e-28 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 3e-20 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 3e-19 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 8e-19 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 6e-18 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 2e-17 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 7e-17 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 2e-16 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 1e-15 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 1e-15 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 2e-15 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 7e-15 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 7e-15 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 2e-14 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 8e-13 |
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 | Back alignment and structure |
|---|
Score = 106 bits (267), Expect = 3e-28
Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 3/100 (3%)
Query: 61 LTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVV 120
+ L + L+ N++ NT+ + + + Y + + +VGN +V+ ++
Sbjct: 1 MDNVLPVDSDLSPNISTNTSEPNQ---FVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWII 57
Query: 121 IRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVH 160
+ RMR VTNYF+VNLA A+ + ++
Sbjct: 58 LAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNE 97
|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.44 | |
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 99.4 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.39 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.39 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.35 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.33 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.31 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.29 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 99.27 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 99.23 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.22 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.22 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.22 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 99.22 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 99.19 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 99.17 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 99.11 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.09 | |
| 2lot_A | 64 | Apelin receptor; membrane protein; NMR {Homo sapie | 96.58 |
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
Probab=99.44 E-value=8.7e-13 Score=107.91 Aligned_cols=70 Identities=26% Similarity=0.450 Sum_probs=64.5
Q ss_pred hHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCC
Q psy8502 96 ITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKS 165 (168)
Q Consensus 96 ~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~ 165 (168)
.++.+++.+++++|++||+++++++.+++++|+++|+|++|||++|++.+++.+|..+.....+.|.+|+
T Consensus 33 ~~~~~~~~~i~~~gi~gN~lvi~vi~~~~~l~~~~~~~l~~LaiaDll~~~~~~p~~~~~~~~~~~~~~~ 102 (364)
T 2ks9_A 33 VLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGL 102 (364)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHTSCSSCH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhcccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccchH
Confidence 4457888999999999999999999999999999999999999999999999999999888889999885
|
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 168 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 2e-15 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 70.4 bits (171), Expect = 2e-15
Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%)
Query: 74 NLTLNTTSGVPELLYRHSPGVTITFIIGYLA-VFLIGLVGNSLVIAVVIRSPRMRNVTNY 132
N T S Y + + + Y+ + ++G N L + V ++ ++R NY
Sbjct: 15 NKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNY 74
Query: 133 FIVNLAVADMLVITLCLPATLMANIYVHF 161
++NLAVAD+ ++ TL +++ +F
Sbjct: 75 ILLNLAVADLFMVFGGFTTTLYTSLHGYF 103
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.35 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.35 E-value=2.5e-12 Score=102.44 Aligned_cols=75 Identities=23% Similarity=0.337 Sum_probs=67.0
Q ss_pred CCchhhHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCC
Q psy8502 91 SPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKS 165 (168)
Q Consensus 91 ~~~~~~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~ 165 (168)
.++...++.+++.+++++|++||+++++++.++|++|++.|++++|||++|++.++..+|..+.....+.|.+|.
T Consensus 33 ~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~ 107 (348)
T d1u19a_ 33 EPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGP 107 (348)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHH
T ss_pred cHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCc
Confidence 344566778889999999999999999999999999999999999999999999999999999888888887754
|