Psyllid ID: psy8502


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MVHYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
ccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccc
ccEEEcccccEEEcccccccccccEEEEEEcccccEEEEEccccHHccccccccccccccccccccccccccccccccccccccccHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccc
mvhyrlpseyyhidlssrdnygLNTFLLQQGAedmgliikttdtvemggnilpdlntsgrltgtldllpalthnltlnttsgvpellyrhspgvtITFIIGYLAVFLIGLVGNSLVIAVVIrsprmrnvtNYFIVNLAVADMLVITLCLPATLMANIYVHfdlkslnh
MVHYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVirsprmrnVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
MVHYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
****RLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDL*****
********************************EDMGLIIKTTDTVEM***IL****TSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
MVHYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
**HYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHYRLPSEYYHIDLSSRDNYGLNTFLLQQGAEDMGLIIKTTDTVEMGGNILPDLNTSGRLTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSLNH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
O02836 382 Neuropeptide Y receptor t no N/A 0.357 0.157 0.633 2e-13
Q9Y5X5 522 Neuropeptide FF receptor yes N/A 0.416 0.134 0.457 2e-13
P79113 384 Neuropeptide Y receptor t yes N/A 0.357 0.156 0.6 3e-13
Q9Z2D5 381 Neuropeptide Y receptor t no N/A 0.357 0.157 0.616 3e-13
P97295 381 Neuropeptide Y receptor t yes N/A 0.357 0.157 0.616 4e-13
Q5IS62 381 Neuropeptide Y receptor t no N/A 0.357 0.157 0.6 4e-13
P49146 381 Neuropeptide Y receptor t no N/A 0.357 0.157 0.6 4e-13
P56718 416 Orexin receptor type 1 OS no N/A 0.351 0.141 0.610 4e-13
P58307 416 Orexin receptor type 1 OS no N/A 0.351 0.141 0.610 4e-13
Q9DDN6 385 Neuropeptide Y receptor t no N/A 0.363 0.158 0.590 5e-13
>sp|O02836|NPY2R_PIG Neuropeptide Y receptor type 2 OS=Sus scrofa GN=NPY2R PE=2 SV=2 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (76%)

Query: 94  VTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATL 153
           V I  I+ Y ++ L+G+VGNSLVI VVI+   MR VTN+FI NLAVAD+LV TLCLP TL
Sbjct: 50  VQIILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTL 109




Receptor for neuropeptide Y and peptide YY.
Sus scrofa (taxid: 9823)
>sp|Q9Y5X5|NPFF2_HUMAN Neuropeptide FF receptor 2 OS=Homo sapiens GN=NPFFR2 PE=1 SV=2 Back     alignment and function description
>sp|P79113|NPY2R_BOVIN Neuropeptide Y receptor type 2 OS=Bos taurus GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2D5|NPY2R_CAVPO Neuropeptide Y receptor type 2 OS=Cavia porcellus GN=NPY2R PE=3 SV=1 Back     alignment and function description
>sp|P97295|NPY2R_MOUSE Neuropeptide Y receptor type 2 OS=Mus musculus GN=Npy2r PE=2 SV=2 Back     alignment and function description
>sp|Q5IS62|NPY2R_PANTR Neuropeptide Y receptor type 2 OS=Pan troglodytes GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|P49146|NPY2R_HUMAN Neuropeptide Y receptor type 2 OS=Homo sapiens GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|P56718|OX1R_RAT Orexin receptor type 1 OS=Rattus norvegicus GN=Hcrtr1 PE=2 SV=1 Back     alignment and function description
>sp|P58307|OX1R_MOUSE Orexin receptor type 1 OS=Mus musculus GN=Hcrtr1 PE=2 SV=3 Back     alignment and function description
>sp|Q9DDN6|NPY2R_CHICK Neuropeptide Y receptor type 2 OS=Gallus gallus GN=NPY2R PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
91091632 436 PREDICTED: similar to SIFamide receptor 0.535 0.206 0.641 2e-24
347969700 862 AGAP003335-PA [Anopheles gambiae str. PE 0.648 0.126 0.522 2e-24
350397193 483 PREDICTED: neuropeptide FF receptor 2-li 0.928 0.322 0.411 4e-24
357611925175 putative SIFamide receptor [Danaus plexi 0.642 0.617 0.557 5e-24
193659704 440 PREDICTED: neuropeptide FF receptor 2-li 0.488 0.186 0.670 5e-24
383857307 468 PREDICTED: neuropeptide FF receptor 2-li 0.958 0.344 0.423 1e-23
340726492 483 PREDICTED: neuropeptide FF receptor 2-li 0.928 0.322 0.4 2e-23
195053868 771 GH18883 [Drosophila grimshawi] gi|193895 0.434 0.094 0.684 3e-23
157111907151 hypothetical protein AaeL_AAEL005994 [Ae 0.809 0.900 0.441 4e-23
402232702 465 TPA_inf: SIFamide receptor [Bombyx mori] 0.744 0.268 0.507 4e-23
>gi|91091632|ref|XP_970225.1| PREDICTED: similar to SIFamide receptor [Tribolium castaneum] gi|270001267|gb|EEZ97714.1| hypothetical protein TcasGA2_TC011156 [Tribolium castaneum] gi|402232706|tpg|DAA35194.1| TPA_inf: SIFamide receptor, partial [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 2/92 (2%)

Query: 74  NLTLNTT--SGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTN 131
           N TLN T  + VPEL YRHS  +T  + + YL VF +G+VGN  VIAVV RSPRMR VTN
Sbjct: 63  NATLNATETAFVPELFYRHSMAMTAVYCVAYLLVFAVGIVGNFFVIAVVFRSPRMRTVTN 122

Query: 132 YFIVNLAVADMLVITLCLPATLMANIYVHFDL 163
           +FIVNLAVAD+LVI  CLPATLM+NI+V + L
Sbjct: 123 FFIVNLAVADILVIVFCLPATLMSNIFVPWVL 154




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|347969700|ref|XP_314231.4| AGAP003335-PA [Anopheles gambiae str. PEST] gi|333469231|gb|EAA09601.4| AGAP003335-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350397193|ref|XP_003484801.1| PREDICTED: neuropeptide FF receptor 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357611925|gb|EHJ67721.1| putative SIFamide receptor [Danaus plexippus] Back     alignment and taxonomy information
>gi|193659704|ref|XP_001947491.1| PREDICTED: neuropeptide FF receptor 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383857307|ref|XP_003704146.1| PREDICTED: neuropeptide FF receptor 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340726492|ref|XP_003401591.1| PREDICTED: neuropeptide FF receptor 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195053868|ref|XP_001993848.1| GH18883 [Drosophila grimshawi] gi|193895718|gb|EDV94584.1| GH18883 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157111907|ref|XP_001657350.1| hypothetical protein AaeL_AAEL005994 [Aedes aegypti] gi|108878249|gb|EAT42474.1| AAEL005994-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|402232702|tpg|DAA35192.1| TPA_inf: SIFamide receptor [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
FB|FBgn0038880 758 SIFR "SIFamide receptor" [Dros 0.434 0.096 0.657 7.3e-22
ZFIN|ZDB-GENE-060526-183 422 npffr2.1 "neuropeptide FF rece 0.470 0.187 0.455 4.5e-15
UNIPROTKB|F1NVD9 422 NPFFR2 "Uncharacterized protei 0.470 0.187 0.481 1.3e-14
ZFIN|ZDB-GENE-070705-159 438 npffr2.2 "neuropeptide FF rece 0.470 0.180 0.455 2.3e-14
ZFIN|ZDB-GENE-060526-110 480 npffr1l2 "neuropeptide FF rece 0.613 0.214 0.422 2.8e-14
UNIPROTKB|F1SUD0 432 NPFFR1 "Uncharacterized protei 0.416 0.162 0.514 2.8e-14
ZFIN|ZDB-GENE-091118-18 306 npffr1l1 "neuropeptide FF rece 0.416 0.228 0.514 3e-14
ZFIN|ZDB-GENE-040924-8 384 npy2r "neuropeptide Y receptor 0.392 0.171 0.560 7.3e-14
RGD|620475 381 Npy2r "neuropeptide Y receptor 0.357 0.157 0.616 9.2e-14
UNIPROTKB|F1RYR8 382 NPY2R "Neuropeptide Y receptor 0.357 0.157 0.633 9.3e-14
FB|FBgn0038880 SIFR "SIFamide receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 7.3e-22, P = 7.3e-22
 Identities = 48/73 (65%), Positives = 62/73 (84%)

Query:    87 LYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVIT 146
             LYRHS  +++ + + Y+ VFL+GL+GNS VIAVV+R+PRMR VTNYFIVNLA+AD+LVI 
Sbjct:   200 LYRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIV 259

Query:   147 LCLPATLMANIYV 159
              CLPATL+ NI+V
Sbjct:   260 FCLPATLIGNIFV 272




GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0008528 "G-protein coupled peptide receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS;IDA
GO:0004930 "G-protein coupled receptor activity" evidence=ISS
GO:0004984 "olfactory receptor activity" evidence=IEA
GO:0004983 "neuropeptide Y receptor activity" evidence=IEA
GO:0008340 "determination of adult lifespan" evidence=IMP
ZFIN|ZDB-GENE-060526-183 npffr2.1 "neuropeptide FF receptor 2.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVD9 NPFFR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-159 npffr2.2 "neuropeptide FF receptor 2.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-110 npffr1l2 "neuropeptide FF receptor 1 like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUD0 NPFFR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091118-18 npffr1l1 "neuropeptide FF receptor 1 like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040924-8 npy2r "neuropeptide Y receptor Y2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620475 Npy2r "neuropeptide Y receptor Y2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYR8 NPY2R "Neuropeptide Y receptor type 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-07
PHA02638 417 PHA02638, PHA02638, CC chemokine receptor-like pro 0.003
PHA03087 335 PHA03087, PHA03087, G protein-coupled chemokine re 0.003
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
 Score = 48.8 bits (117), Expect = 2e-07
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 118 AVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFD 162
            V++R+ ++R  TN F++NLAVAD+L +    P        V  D
Sbjct: 1   LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPP--WALYYLVGGD 43


This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251

>gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
KOG4219|consensus 423 99.43
PHA03234 338 DNA packaging protein UL33; Provisional 99.27
KOG4220|consensus 503 99.16
PHA02834 323 chemokine receptor-like protein; Provisional 99.02
PHA02638 417 CC chemokine receptor-like protein; Provisional 98.99
PHA03235 409 DNA packaging protein UL33; Provisional 98.78
PHA03087 335 G protein-coupled chemokine receptor-like protein; 98.77
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.49
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 97.81
KOG2087|consensus 363 95.65
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 94.89
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 93.74
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 92.96
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 91.23
PF11710 201 Git3: G protein-coupled glucose receptor regulatin 88.2
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 88.03
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 80.39
>KOG4219|consensus Back     alignment and domain information
Probab=99.43  E-value=1.1e-13  Score=117.81  Aligned_cols=79  Identities=27%  Similarity=0.418  Sum_probs=73.3

Q ss_pred             ccCCCchhhHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCCC
Q psy8502          88 YRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKSL  166 (168)
Q Consensus        88 ~~~~~~~~~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~~  166 (168)
                      +......+.++.++|.++.+++++||++|+|++..+|++|+.+|+||+|||+||++.++++.|+...+.+...|.||.+
T Consensus        28 f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f  106 (423)
T KOG4219|consen   28 FVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSF  106 (423)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccc
Confidence            3445667788899999999999999999999999999999999999999999999999999999999999999999983



>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
4djh_A 480 Structure Of The Human Kappa Opioid Receptor In Com 8e-09
4ea3_B 434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 8e-07
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-05
3pwh_A 329 Thermostabilised Adenosine A2a Receptor Length = 32 6e-05
4dkl_A 464 Crystal Structure Of The Mu-Opioid Receptor Bound T 8e-05
4eiy_A 447 Crystal Structure Of The Chimeric Protein Of A2aar- 1e-04
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 1e-04
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 2e-04
2ydo_A 325 Thermostabilised Human A2a Receptor With Adenosine 2e-04
3vg9_A 326 Crystal Structure Of Human Adenosine A2a Receptor W 2e-04
3odu_A 502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 5e-04
3oe0_A 499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 5e-04
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 5e-04
4ej4_A 461 Structure Of The Delta Opioid Receptor Bound To Nal 7e-04
>pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 28/56 (50%), Positives = 38/56 (67%) Query: 91 SPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVIT 146 SP + + Y VF++GLVGNSLV+ V+IR +M+ TN +I NLA+AD LV T Sbjct: 18 SPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTT 73
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 3e-28
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 3e-20
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 3e-19
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 8e-19
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 6e-18
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 2e-17
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 7e-17
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 2e-16
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 1e-15
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 1e-15
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-15
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 7e-15
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-15
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-14
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 8e-13
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
 Score =  106 bits (267), Expect = 3e-28
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 3/100 (3%)

Query: 61  LTGTLDLLPALTHNLTLNTTSGVPELLYRHSPGVTITFIIGYLAVFLIGLVGNSLVIAVV 120
           +   L +   L+ N++ NT+       +       + +   Y  + +  +VGN +V+ ++
Sbjct: 1   MDNVLPVDSDLSPNISTNTSEPNQ---FVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWII 57

Query: 121 IRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVH 160
           +   RMR VTNYF+VNLA A+  +            ++  
Sbjct: 58  LAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNE 97


>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.44
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.4
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.39
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.39
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.35
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.33
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.31
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.29
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.27
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.23
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.22
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.22
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.22
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.22
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.19
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.17
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.11
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.09
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 96.58
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
Probab=99.44  E-value=8.7e-13  Score=107.91  Aligned_cols=70  Identities=26%  Similarity=0.450  Sum_probs=64.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCC
Q psy8502          96 ITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKS  165 (168)
Q Consensus        96 ~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~  165 (168)
                      .++.+++.+++++|++||+++++++.+++++|+++|+|++|||++|++.+++.+|..+.....+.|.+|+
T Consensus        33 ~~~~~~~~~i~~~gi~gN~lvi~vi~~~~~l~~~~~~~l~~LaiaDll~~~~~~p~~~~~~~~~~~~~~~  102 (364)
T 2ks9_A           33 VLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGL  102 (364)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHTSCSSCH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccchH
Confidence            4457888999999999999999999999999999999999999999999999999999888889999885



>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 2e-15
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 70.4 bits (171), Expect = 2e-15
 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 74  NLTLNTTSGVPELLYRHSPGVTITFIIGYLA-VFLIGLVGNSLVIAVVIRSPRMRNVTNY 132
           N T    S      Y  +     + +  Y+  + ++G   N L + V ++  ++R   NY
Sbjct: 15  NKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNY 74

Query: 133 FIVNLAVADMLVITLCLPATLMANIYVHF 161
            ++NLAVAD+ ++      TL  +++ +F
Sbjct: 75  ILLNLAVADLFMVFGGFTTTLYTSLHGYF 103


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.35
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.35  E-value=2.5e-12  Score=102.44  Aligned_cols=75  Identities=23%  Similarity=0.337  Sum_probs=67.0

Q ss_pred             CCchhhHHHHHHHHHHHHHHHHHHHhhHHHhhcCCCCchhHHHHHHHHHHHHHHHhhhhhHHHHHHhhCCCcCCC
Q psy8502          91 SPGVTITFIIGYLAVFLIGLVGNSLVIAVVIRSPRMRNVTNYFIVNLAVADMLVITLCLPATLMANIYVHFDLKS  165 (168)
Q Consensus        91 ~~~~~~~~~~~~~ii~l~gl~GN~lvl~~i~~~~~l~~~~~~fi~nLA~aDLl~~~~~~P~~i~~~~~~~W~fG~  165 (168)
                      .++...++.+++.+++++|++||+++++++.++|++|++.|++++|||++|++.++..+|..+.....+.|.+|.
T Consensus        33 ~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~  107 (348)
T d1u19a_          33 EPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGP  107 (348)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHH
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCc
Confidence            344566778889999999999999999999999999999999999999999999999999999888888887754