Psyllid ID: psy8554
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 148 | ||||||
| 242021327 | 726 | Phosphatidylinositol 3-kinase regulatory | 0.709 | 0.144 | 0.669 | 5e-38 | |
| 312377934 | 1156 | hypothetical protein AND_10630 [Anophele | 0.743 | 0.095 | 0.621 | 5e-36 | |
| 66500538 | 1256 | PREDICTED: hypothetical protein LOC40857 | 0.722 | 0.085 | 0.648 | 5e-35 | |
| 340709184 | 1263 | PREDICTED: hypothetical protein LOC10064 | 0.810 | 0.095 | 0.614 | 4e-34 | |
| 307211841 | 723 | Phosphatidylinositol 3-kinase regulatory | 0.722 | 0.147 | 0.629 | 4e-34 | |
| 350425237 | 1255 | PREDICTED: hypothetical protein LOC10074 | 0.682 | 0.080 | 0.676 | 6e-34 | |
| 328699600 | 394 | PREDICTED: phosphatidylinositol 3-kinase | 0.709 | 0.266 | 0.660 | 1e-33 | |
| 328710005 | 441 | PREDICTED: phosphatidylinositol 3-kinase | 0.817 | 0.274 | 0.574 | 4e-33 | |
| 345486690 | 969 | PREDICTED: phosphatidylinositol 3-kinase | 0.716 | 0.109 | 0.635 | 5e-33 | |
| 157136595 | 568 | phosphatidylinositol 3-kinase regulatory | 0.716 | 0.186 | 0.588 | 9e-33 |
| >gi|242021327|ref|XP_002431096.1| Phosphatidylinositol 3-kinase regulatory subunit alpha, putative [Pediculus humanus corporis] gi|212516345|gb|EEB18358.1| Phosphatidylinositol 3-kinase regulatory subunit alpha, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 162 bits (409), Expect = 5e-38, Method: Composition-based stats.
Identities = 71/106 (66%), Positives = 87/106 (82%), Gaps = 1/106 (0%)
Query: 36 RDLPHHDEKTW-LVRMSRAQAEALLSGRPDGTFLIRPSTTGQYALSIVCSGAPKHCLVYE 94
+ +PH +E W L SRAQA LL +P+GTFL+RPS++GQYALSIVC+G HC++Y+
Sbjct: 601 KSMPHQNEYLWNLPECSRAQAATLLESKPEGTFLVRPSSSGQYALSIVCNGVINHCIIYQ 660
Query: 95 TERGFGFAEPFNIYPSLGALVLHYAANSLEEHNDDLKTTLAYPVFA 140
T+RGFGFAEP+NIYPSL LVLHYA NSLEEHN++LKTTL YPVFA
Sbjct: 661 TDRGFGFAEPYNIYPSLKQLVLHYANNSLEEHNEELKTTLMYPVFA 706
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312377934|gb|EFR24642.1| hypothetical protein AND_10630 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|66500538|ref|XP_392119.2| PREDICTED: hypothetical protein LOC408577 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340709184|ref|XP_003393192.1| PREDICTED: hypothetical protein LOC100643962 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307211841|gb|EFN87788.1| Phosphatidylinositol 3-kinase regulatory subunit alpha [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350425237|ref|XP_003494056.1| PREDICTED: hypothetical protein LOC100743083 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328699600|ref|XP_001952098.2| PREDICTED: phosphatidylinositol 3-kinase regulatory subunit gamma-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328710005|ref|XP_001949153.2| PREDICTED: phosphatidylinositol 3-kinase regulatory subunit beta-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345486690|ref|XP_001606345.2| PREDICTED: phosphatidylinositol 3-kinase regulatory subunit alpha-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|157136595|ref|XP_001663781.1| phosphatidylinositol 3-kinase regulatory subunit [Aedes aegypti] gi|108869909|gb|EAT34134.1| AAEL013596-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 148 | ||||||
| UNIPROTKB|D4A6X0 | 402 | Pik3r3 "Phosphatidylinositol 3 | 0.743 | 0.273 | 0.580 | 6.9e-31 | |
| UNIPROTKB|E2RPB0 | 461 | PIK3R3 "Uncharacterized protei | 0.743 | 0.238 | 0.571 | 1.8e-30 | |
| UNIPROTKB|Q92569 | 461 | PIK3R3 "Phosphatidylinositol 3 | 0.743 | 0.238 | 0.571 | 1.8e-30 | |
| UNIPROTKB|E7EMU8 | 366 | PIK3R3 "Phosphatidylinositol 3 | 0.743 | 0.300 | 0.571 | 1.8e-30 | |
| UNIPROTKB|F1MDQ5 | 461 | PIK3R3 "Phosphatidylinositol 3 | 0.743 | 0.238 | 0.571 | 2.3e-30 | |
| UNIPROTKB|O46404 | 461 | PIK3R3 "Phosphatidylinositol 3 | 0.743 | 0.238 | 0.571 | 2.3e-30 | |
| UNIPROTKB|F1S3V4 | 430 | PIK3R3 "Uncharacterized protei | 0.743 | 0.255 | 0.571 | 2.3e-30 | |
| UNIPROTKB|E1C5L1 | 728 | PIK3R3 "Uncharacterized protei | 0.743 | 0.151 | 0.580 | 2.6e-30 | |
| UNIPROTKB|E1C8M6 | 730 | PIK3R3 "Uncharacterized protei | 0.743 | 0.150 | 0.580 | 2.6e-30 | |
| UNIPROTKB|E1BQ48 | 738 | PIK3R3 "Uncharacterized protei | 0.743 | 0.149 | 0.580 | 2.7e-30 |
| UNIPROTKB|D4A6X0 Pik3r3 "Phosphatidylinositol 3-kinase regulatory subunit gamma" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
Identities = 65/112 (58%), Positives = 79/112 (70%)
Query: 31 LNRTERDLPHHDEKTWLVR-MSRAQAEALLSGRPDGTFLIRPSTT-GQYALSIVCSGAPK 88
+N + LPH+DEKTW V ++R QAE LL G+PDG FLIR S+ G YA S+V G K
Sbjct: 284 INEDDESLPHYDEKTWFVEDVNRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVK 343
Query: 89 HCLVYETERGFGFAEPFNIYPSLGALVLHYAANSLEEHNDDLKTTLAYPVFA 140
HC++Y T RG+GFAEP+N+Y SL LVLHY SL +HND L TLAYPV A
Sbjct: 344 HCVIYSTARGYGFAEPYNLYGSLKELVLHYQQTSLVQHNDSLNVTLAYPVHA 395
|
|
| UNIPROTKB|E2RPB0 PIK3R3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92569 PIK3R3 "Phosphatidylinositol 3-kinase regulatory subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EMU8 PIK3R3 "Phosphatidylinositol 3-kinase regulatory subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MDQ5 PIK3R3 "Phosphatidylinositol 3-kinase regulatory subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O46404 PIK3R3 "Phosphatidylinositol 3-kinase regulatory subunit gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3V4 PIK3R3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C5L1 PIK3R3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8M6 PIK3R3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQ48 PIK3R3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 148 | |||
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 3e-58 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 1e-19 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 6e-19 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 6e-18 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 3e-17 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 1e-15 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 4e-11 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 4e-10 | |
| cd09923 | 81 | cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom | 8e-10 | |
| cd10405 | 103 | cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou | 1e-09 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 2e-09 | |
| cd10406 | 103 | cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou | 2e-09 | |
| cd10407 | 103 | cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou | 4e-09 | |
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 5e-09 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 9e-09 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 1e-08 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 6e-08 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 6e-08 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 3e-07 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 2e-06 | |
| cd10386 | 81 | cd10386, SH2_SOCS5, Src homology 2 (SH2) domain fo | 4e-06 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 7e-06 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 8e-06 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 1e-05 | |
| cd10357 | 87 | cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domai | 1e-05 | |
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 2e-05 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 3e-05 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 3e-05 | |
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 6e-05 | |
| cd10391 | 98 | cd10391, SH2_SHE, Src homology 2 domain found in S | 6e-05 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 6e-05 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 2e-04 | |
| cd10399 | 106 | cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain | 3e-04 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 3e-04 | |
| cd10360 | 79 | cd10360, SH2_Srm, Src homology 2 (SH2) domain foun | 3e-04 | |
| cd10387 | 100 | cd10387, SH2_SOCS6, Src homology 2 (SH2) domain fo | 3e-04 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 3e-04 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 4e-04 | |
| cd10356 | 113 | cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai | 4e-04 | |
| cd09926 | 106 | cd09926, SH2_CRK_like, Src homology 2 domain found | 6e-04 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 0.001 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 0.001 | |
| cd10385 | 101 | cd10385, SH2_SOCS4, Src homology 2 (SH2) domain fo | 0.001 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 0.001 | |
| cd09918 | 85 | cd09918, SH2_Nterm_SPT6_like, N-terminal Src homol | 0.002 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 0.002 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 0.002 | |
| cd10390 | 98 | cd10390, SH2_SHD, Src homology 2 domain found in S | 0.003 | |
| cd09946 | 102 | cd09946, SH2_HSH2_like, Src homology 2 domain foun | 0.004 |
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
Score = 175 bits (446), Expect = 3e-58
Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)
Query: 39 PHHDEKTWLV-RMSRAQAEALLSGRPDGTFLIRPSTT-GQYALSIVCSGAPKHCLVYETE 96
PHHDE+TWLV ++R QAE LL G+PDGTFLIR S+T G YA S+VC+G KHC++Y+TE
Sbjct: 1 PHHDERTWLVGDINRTQAEELLRGKPDGTFLIRESSTQGCYACSVVCNGEVKHCVIYKTE 60
Query: 97 RGFGFAEPFNIYPSLGALVLHYAANSLEEHNDDLKTTLAYPVFA 140
G+GFAEP+N+Y SL LVLHYA NSLE+HND L TLAYPV A
Sbjct: 61 TGYGFAEPYNLYESLKELVLHYAHNSLEQHNDSLTVTLAYPVLA 104
|
Phosphoinositide 3-kinases (PI3Ks) are essential for cell growth, migration, and survival. p110, the catalytic subunit, is composed of an adaptor-binding domain, a Ras-binding domain, a C2 domain, a helical domain, and a kinase domain. The regulatory unit is called p85 and is composed of an SH3 domain, a RhoGap domain, a N-terminal SH2 (nSH2) domain, a inter SH2 (iSH2) domain, and C-terminal (cSH2) domain. There are 2 inhibitory interactions between p110alpha and p85 of P13K: 1) p85 nSH2 domain with the C2, helical, and kinase domains of p110alpha and 2) p85 iSH2 domain with C2 domain of p110alpha. There are 3 inhibitory interactions between p110beta and p85 of P13K: 1) p85 nSH2 domain with the C2, helical, and kinase domains of p110beta, 2) p85 iSH2 domain with C2 domain of p110alpha, and 3) p85 cSH2 domain with the kinase domain of p110alpha. It is interesting to note that p110beta is oncogenic as a wild type protein while p110alpha lacks this ability. One explanation is the idea that the regulation of p110beta by p85 is unique because of the addition of inhibitory contacts from the cSH2 domain and the loss of contacts in the iSH2 domain. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 104 |
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198249 cd10386, SH2_SOCS5, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases D and E (ShkD and ShkE) | Back alignment and domain information |
|---|
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) | Back alignment and domain information |
|---|
| >gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) | Back alignment and domain information |
|---|
| >gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198248 cd10385, SH2_SOCS4, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|198174 cd09918, SH2_Nterm_SPT6_like, N-terminal Src homology 2 (SH2) domain found in Spt6 | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) | Back alignment and domain information |
|---|
| >gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 148 | |||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.92 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.89 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.88 | |
| KOG4637|consensus | 464 | 99.87 | ||
| KOG4637|consensus | 464 | 99.8 | ||
| KOG4278|consensus | 1157 | 99.78 | ||
| KOG4226|consensus | 379 | 99.75 | ||
| KOG1264|consensus | 1267 | 99.75 | ||
| KOG0790|consensus | 600 | 99.73 | ||
| KOG2996|consensus | 865 | 99.72 | ||
| KOG1264|consensus | 1267 | 99.69 | ||
| KOG0197|consensus | 468 | 99.69 | ||
| KOG4792|consensus | 293 | 99.68 | ||
| KOG0194|consensus | 474 | 99.47 | ||
| KOG1930|consensus | 483 | 99.47 | ||
| KOG0790|consensus | 600 | 99.44 | ||
| KOG3601|consensus | 222 | 99.16 | ||
| KOG3697|consensus | 345 | 98.74 | ||
| KOG3751|consensus | 622 | 98.42 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 98.26 | |
| KOG4566|consensus | 258 | 97.56 | ||
| KOG1856|consensus | 1299 | 96.77 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 96.67 | |
| KOG1856|consensus | 1299 | 95.25 | ||
| PF02762 | 86 | Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do | 87.63 |
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
Probab=99.92 E-value=4.4e-24 Score=140.14 Aligned_cols=91 Identities=42% Similarity=0.715 Sum_probs=83.2
Q ss_pred cccc-cCCHHHHHHHhcCCCCceEEEEeC--CCCCEEEEEEeCCeeEEEEEEEeCCceEEecCCCCCCCHHHHHHHHhhC
Q psy8554 45 TWLV-RMSRAQAEALLSGRPDGTFLIRPS--TTGQYALSIVCSGAPKHCLVYETERGFGFAEPFNIYPSLGALVLHYAAN 121 (148)
Q Consensus 45 ~Wyh-~isr~~Ae~lL~~~~~G~FLvR~s--~~~~~~Lsv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~eLI~~y~~~ 121 (148)
+||| .|+|++||++|++.++|+||||.| .++.|+||++.+++++|++|....+++++......|+||.|||+||+.+
T Consensus 1 ~w~~g~i~r~~Ae~~L~~~~~G~FLiR~s~~~~~~~~Lsv~~~~~v~H~~I~~~~~~~~~~~~~~~f~sl~eLv~~y~~~ 80 (94)
T cd00173 1 PWYHGPISREEAEELLKKKPDGTFLVRDSESSPGDYVLSVRVKGKVKHYRIERTDDGYYLLGEGRSFPSLPELIEHYQKN 80 (94)
T ss_pred CccccCCCHHHHHHHHhcCCCceEEEEecCCCCCCEEEEEEECCEEEEEEEEECCCCeEEecCCCccCCHHHHHHHHhhC
Confidence 6999 999999999999899999999999 6899999999999999999999988877776457899999999999999
Q ss_pred CccccCCCccceecccc
Q psy8554 122 SLEEHNDDLKTTLAYPV 138 (148)
Q Consensus 122 ~l~~~~~~l~~~L~~Pv 138 (148)
++ .+++.+.|+.|+
T Consensus 81 ~~---~~~~~~~L~~p~ 94 (94)
T cd00173 81 PL---SDGLGVKLRYPV 94 (94)
T ss_pred cc---CCCcccEeCCcC
Confidence 87 367889999886
|
SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. |
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 148 | ||||
| 2y3a_B | 302 | Crystal Structure Of P110beta In Complex With Icsh2 | 2e-32 | ||
| 1qad_A | 111 | Crystal Structure Of The C-Terminal Sh2 Domain Of T | 6e-31 | ||
| 1bfi_A | 112 | Solution Structure Of The C-Terminal Sh2 Domain Of | 6e-31 | ||
| 1h9o_A | 112 | Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C | 7e-30 | ||
| 3hhm_B | 373 | Crystal Structure Of P110alpha H1047r Mutant In Com | 3e-21 | ||
| 2dlz_A | 118 | Solution Structure Of The Sh2 Domain Of Human Prote | 3e-09 | ||
| 1fu5_A | 111 | Nmr Structure Of The N-Sh2 Domain Of The P85 Subuni | 8e-09 | ||
| 2iug_A | 120 | Crystal Structure Of The Pi3-Kinase P85 N-Terminal | 1e-08 | ||
| 2rd0_B | 279 | Structure Of A Human P110alpha/p85alpha Complex Len | 1e-08 | ||
| 2pna_A | 104 | Structure Of An Sh2 Domain Of The P85 Alpha Subunit | 2e-08 | ||
| 1oo3_A | 111 | P395s Mutant Of The P85 Regulatory Subunit Of The N | 5e-08 | ||
| 2lnw_A | 122 | Identification And Structural Basis For A Novel Int | 9e-08 | ||
| 2lct_A | 107 | Solution Structure Of The Vav1 Sh2 Domain Complexed | 1e-07 | ||
| 2crh_A | 138 | Solution Structure Of The Sh2 Domain Of Human Proto | 2e-07 | ||
| 2eob_A | 124 | Solution Structure Of The Second Sh2 Domain From Ra | 6e-06 | ||
| 1mil_A | 104 | Transforming Protein Length = 104 | 2e-05 | ||
| 1tce_A | 107 | Solution Nmr Structure Of The Shc Sh2 Domain Comple | 5e-05 | ||
| 1r1p_A | 100 | Structural Basis For Differential Recognition Of Ty | 6e-05 | ||
| 2fci_A | 105 | Structural Basis For The Requirement Of Two Phospho | 8e-05 | ||
| 3gqi_B | 226 | Crystal Structure Of Activated Receptor Tyrosine Ki | 1e-04 | ||
| 4ey0_A | 246 | Structure Of Tandem Sh2 Domains From Plcgamma1 Leng | 2e-04 | ||
| 4fbn_A | 246 | Insights Into Structural Integration Of The Plcgamm | 2e-04 | ||
| 2ecd_A | 119 | Solution Structure Of The Human Abl2 Sh2 Domain Len | 3e-04 | ||
| 1ab2_A | 109 | Three-Dimensional Solution Structure Of The Src Hom | 3e-04 |
| >pdb|2Y3A|B Chain B, Crystal Structure Of P110beta In Complex With Icsh2 Of P85beta And The Drug Gdc-0941 Length = 302 | Back alignment and structure |
|
| >pdb|1QAD|A Chain A, Crystal Structure Of The C-Terminal Sh2 Domain Of The P85 Alpha Regulatory Subunit Of Phosphoinositide 3-Kinase: An Sh2 Domain Mimicking Its Own Substrate Length = 111 | Back alignment and structure |
| >pdb|1BFI|A Chain A, Solution Structure Of The C-Terminal Sh2 Domain Of The P85alpha Regulatory Subunit Of Phosphoinositide 3-Kinase, Nmr, 30 Structures Length = 112 | Back alignment and structure |
| >pdb|1H9O|A Chain A, Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C-Terminal Sh2 Domain Complexed With A Tyr751 Phosphopeptide From The Pdgf Receptor, Crystal Structure At 1.79 A Length = 112 | Back alignment and structure |
| >pdb|3HHM|B Chain B, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha And The Drug Wortmannin Length = 373 | Back alignment and structure |
| >pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 | Back alignment and structure |
| >pdb|1FU5|A Chain A, Nmr Structure Of The N-Sh2 Domain Of The P85 Subunit Of Pi3- Kinase Complexed To A Doubly Phosphorylated Peptide Derived From Polyomavirus Middle T Antigen Length = 111 | Back alignment and structure |
| >pdb|2IUG|A Chain A, Crystal Structure Of The Pi3-Kinase P85 N-Terminal Sh2 Domain Length = 120 | Back alignment and structure |
| >pdb|2RD0|B Chain B, Structure Of A Human P110alpha/p85alpha Complex Length = 279 | Back alignment and structure |
| >pdb|2PNA|A Chain A, Structure Of An Sh2 Domain Of The P85 Alpha Subunit Of Phosphatidylinositol-3-Oh Kinase Length = 104 | Back alignment and structure |
| >pdb|1OO3|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N- Terminal Src Homology 2 Domain Of Pi3-Kinase Length = 111 | Back alignment and structure |
| >pdb|2LNW|A Chain A, Identification And Structural Basis For A Novel Interaction Between Vav2 And Arap3 Length = 122 | Back alignment and structure |
| >pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 | Back alignment and structure |
| >pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 | Back alignment and structure |
| >pdb|2EOB|A Chain A, Solution Structure Of The Second Sh2 Domain From Rat Plc Gamma-2 Length = 124 | Back alignment and structure |
| >pdb|1MIL|A Chain A, Transforming Protein Length = 104 | Back alignment and structure |
| >pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 | Back alignment and structure |
| >pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 | Back alignment and structure |
| >pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 | Back alignment and structure |
| >pdb|3GQI|B Chain B, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 226 | Back alignment and structure |
| >pdb|4EY0|A Chain A, Structure Of Tandem Sh2 Domains From Plcgamma1 Length = 246 | Back alignment and structure |
| >pdb|4FBN|A Chain A, Insights Into Structural Integration Of The Plcgamma Regulatory Region And Mechanism Of Autoinhibition And Activation Based On Key Roles Of Sh2 Domains Length = 246 | Back alignment and structure |
| >pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 148 | |||
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 3e-45 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 7e-45 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 2e-35 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 5e-31 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 3e-30 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 4e-27 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 1e-29 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 1e-25 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 4e-25 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-24 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 1e-23 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 2e-23 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 1e-22 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 3e-20 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 1e-22 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 2e-22 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 3e-22 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 4e-22 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 6e-22 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 6e-22 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 9e-22 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 1e-21 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-18 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 1e-21 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 3e-21 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 3e-21 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 1e-14 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 5e-21 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 7e-21 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 7e-21 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 2e-20 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 2e-20 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 4e-20 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 4e-20 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 4e-20 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 6e-20 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 9e-20 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 1e-19 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 1e-19 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 1e-19 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 2e-19 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 2e-19 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 4e-19 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 5e-19 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 5e-19 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 1e-18 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 1e-18 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 7e-18 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 1e-17 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 2e-17 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 3e-17 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 2e-16 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 3e-16 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 2e-15 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-15 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 5e-15 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 7e-15 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 1e-13 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 1e-11 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 1e-13 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 2e-13 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 2e-13 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-12 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-11 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-11 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 3e-11 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-11 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 5e-11 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 1e-10 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 4e-09 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 3e-08 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 4e-08 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 8e-08 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 3e-07 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 1e-06 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 7e-06 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 7e-06 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 1e-05 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 1e-04 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 8e-04 |
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
Score = 148 bits (375), Expect = 3e-45
Identities = 65/113 (57%), Positives = 80/113 (70%), Gaps = 2/113 (1%)
Query: 31 LNRTERDLPHHDEKTWLV-RMSRAQAEALLSGRPDGTFLIRPSTT-GQYALSIVCSGAPK 88
L E LPHH+E+TW V +++R QAE +LSG+ DGTFLIR S+ G YA S+V G K
Sbjct: 181 LMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTK 240
Query: 89 HCLVYETERGFGFAEPFNIYPSLGALVLHYAANSLEEHNDDLKTTLAYPVFAP 141
HC++Y T GFGFAEP+N+Y SL LVLHY SL +HND L TLA+PV AP
Sbjct: 241 HCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAP 293
|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 148 | |||
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.97 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.96 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.96 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.96 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.96 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.96 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.96 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.96 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.96 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.96 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.95 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.95 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.95 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.95 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.95 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.95 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.95 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.95 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.95 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.95 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.95 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.95 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.95 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.95 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.95 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.95 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.95 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.95 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.95 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.94 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.94 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.94 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.94 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.94 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.94 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.94 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.94 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.94 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.93 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.93 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.93 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.93 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.93 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.93 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.93 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.93 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.92 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.92 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.92 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.92 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.92 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.92 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.92 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.92 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.91 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.91 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.91 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.89 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.89 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.89 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.89 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.88 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.88 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.88 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.87 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.78 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.85 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.84 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.84 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.82 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.82 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.81 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.8 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.79 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.79 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.77 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.76 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.74 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.74 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.73 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.71 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.69 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.68 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.38 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 98.72 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 98.45 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 98.22 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 97.56 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 97.24 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 97.09 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 96.98 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 96.88 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 96.32 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 96.0 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 95.81 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 90.67 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 90.04 |
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
Probab=99.97 E-value=2.3e-31 Score=180.03 Aligned_cols=109 Identities=55% Similarity=0.960 Sum_probs=97.1
Q ss_pred CCCCCCccccccc-cCCHHHHHHHhcCCCCceEEEEeC-CCCCEEEEEEeCCeeEEEEEEEeCCceEEecCCCCCCCHHH
Q psy8554 36 RDLPHHDEKTWLV-RMSRAQAEALLSGRPDGTFLIRPS-TTGQYALSIVCSGAPKHCLVYETERGFGFAEPFNIYPSLGA 113 (148)
Q Consensus 36 ~~~~~~~~~~Wyh-~isr~~Ae~lL~~~~~G~FLvR~s-~~~~~~Lsv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~e 113 (148)
++++.++.++||| .|+|++||++|++.++|+||||+| .+|.|+||++.++.++||+|.+.++|+++.+....|+||.+
T Consensus 2 ~~~~~~~~~~Wyhg~isR~~Ae~lL~~~~~G~FLVR~S~~~g~y~LSv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~~ 81 (112)
T 1h9o_A 2 SPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKE 81 (112)
T ss_dssp CSCGGGSGGGTBCCSCCHHHHHHHHTTCCTTEEEEEECSSTTCEEEEEEETTEEEEEEEEEETTEEESSTTCCCBSSHHH
T ss_pred CCCccccCCCcccCCCCHHHHHHHhcCCCCceEEEeecCCCCCEEEEEEECCEEEEEEEEEcCCceEEeCCCCCcCCHHH
Confidence 4567788999999 999999999998889999999999 89999999999999999999998888777765578999999
Q ss_pred HHHHHhhCCccccCCCccceecccccCCCCC
Q psy8554 114 LVLHYAANSLEEHNDDLKTTLAYPVFAPASG 144 (148)
Q Consensus 114 LI~~y~~~~l~~~~~~l~~~L~~Pv~~~~p~ 144 (148)
||+||++++|...++++.+.|+.||++++|.
T Consensus 82 LV~~y~~~~l~~~~~gl~~~L~~P~~~~~p~ 112 (112)
T 1h9o_A 82 LVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR 112 (112)
T ss_dssp HHHHHHHSCGGGTCTTCCCCCCEETTC----
T ss_pred HHHHHhhCcccccCCCcCeeCCCCcCCCCCC
Confidence 9999999999887789999999999998773
|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 148 | ||||
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 4e-35 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 5e-23 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 8e-22 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 2e-20 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 2e-20 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 3e-20 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 5e-20 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 1e-19 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 2e-19 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 3e-19 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 4e-19 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 8e-19 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 2e-18 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-18 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 5e-18 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 8e-18 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 9e-18 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 1e-17 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 1e-17 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 2e-17 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 4e-17 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 4e-17 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 4e-17 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 8e-17 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 1e-16 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 1e-16 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 2e-16 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 2e-16 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 9e-16 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 1e-15 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-14 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 5e-14 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 2e-13 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 6e-12 |
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Phosphatidylinositol 3-kinase, p85-alpha subunit species: Cow (Bos taurus) [TaxId: 9913]
Score = 115 bits (290), Expect = 4e-35
Identities = 62/106 (58%), Positives = 76/106 (71%), Gaps = 2/106 (1%)
Query: 37 DLPHHDEKTWLV-RMSRAQAEALLSGRPDGTFLIRPSTT-GQYALSIVCSGAPKHCLVYE 94
DLPHHDEKTW V +R +AE LL G+ DGTFL+R S+ G YA S+V G KHC++ +
Sbjct: 2 DLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINK 61
Query: 95 TERGFGFAEPFNIYPSLGALVLHYAANSLEEHNDDLKTTLAYPVFA 140
T G+GFAEP+N+Y SL LVLHY SL +HND L TLAYPV+A
Sbjct: 62 TATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA 107
|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 148 | |||
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.97 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.97 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.96 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.96 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.96 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.96 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.96 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.96 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.96 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.96 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.96 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.95 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.95 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.95 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.95 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.95 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.95 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.95 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.95 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.95 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.94 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.94 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.94 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.93 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.93 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.93 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.93 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.92 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.91 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.9 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.9 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.85 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 99.53 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 99.46 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.46 | |
| d3buxb3 | 88 | Cbl {Human (Homo sapiens) [TaxId: 9606]} | 88.9 |
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Abl tyrosine kinase species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97 E-value=7.6e-31 Score=172.88 Aligned_cols=97 Identities=31% Similarity=0.457 Sum_probs=89.8
Q ss_pred Cccccccc-cCCHHHHHHHhcCCCCceEEEEeC--CCCCEEEEEEeCCeeEEEEEEEeCCceEEecCCCCCCCHHHHHHH
Q psy8554 41 HDEKTWLV-RMSRAQAEALLSGRPDGTFLIRPS--TTGQYALSIVCSGAPKHCLVYETERGFGFAEPFNIYPSLGALVLH 117 (148)
Q Consensus 41 ~~~~~Wyh-~isr~~Ae~lL~~~~~G~FLvR~s--~~~~~~Lsv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~eLI~~ 117 (148)
++.++||| .|+|++||.+|++.++|+||||+| .+|.|+||++.+++++||+|....+|.+++.+...|+||.+||+|
T Consensus 2 Le~~~Wy~g~isR~eAe~lL~~~~~G~FLVR~S~~~~~~~~LSv~~~~~v~H~~I~~~~~g~~~~~~~~~F~sl~~LI~~ 81 (101)
T d1opka2 2 LEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHH 81 (101)
T ss_dssp GGGSTTEEEECCHHHHHHHGGGCCTTEEEEEECSSSTTCEEEEEEETTEEEEEECEECTTSCEESSTTSCBSSHHHHHHH
T ss_pred cccCcccCCCCCHHHHHHHhcCCCCCeEEEEecCCCCCCEEEEEEcCcceEEEEeEECCCCCEEeCCCcccCCHHHHHHH
Confidence 57789999 999999999999889999999999 788999999999999999999988888888777889999999999
Q ss_pred HhhCCccccCCCccceecccccCCC
Q psy8554 118 YAANSLEEHNDDLKTTLAYPVFAPA 142 (148)
Q Consensus 118 y~~~~l~~~~~~l~~~L~~Pv~~~~ 142 (148)
|+.++ +++.++|+.||+|++
T Consensus 82 y~~~~-----~~l~~~L~~P~pr~~ 101 (101)
T d1opka2 82 HSTVA-----DGLITTLHYPAPKRN 101 (101)
T ss_dssp HTTCC-----TTSSSCCCEECCCCS
T ss_pred HhhCC-----CCCceECCCccCCCC
Confidence 99986 789999999998753
|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|