Psyllid ID: psy8618
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 158297323 | 2864 | AGAP007905-PA [Anopheles gambiae str. PE | 0.961 | 0.077 | 0.557 | 2e-71 | |
| 170031843 | 2888 | cadherin [Culex quinquefasciatus] gi|167 | 0.961 | 0.077 | 0.549 | 3e-70 | |
| 157108477 | 3131 | cadherin [Aedes aegypti] gi|108884003|gb | 0.961 | 0.071 | 0.553 | 1e-69 | |
| 195437548 | 3471 | GK24627 [Drosophila willistoni] gi|19416 | 0.875 | 0.058 | 0.622 | 2e-69 | |
| 4887715 | 3503 | adherin [Drosophila melanogaster] | 0.642 | 0.042 | 0.755 | 3e-69 | |
| 195575605 | 3038 | GD22944 [Drosophila simulans] gi|1941896 | 0.646 | 0.049 | 0.751 | 3e-69 | |
| 25090185 | 3503 | RecName: Full=Protein dachsous; AltName: | 0.642 | 0.042 | 0.755 | 3e-69 | |
| 24580686 | 3556 | dachsous [Drosophila melanogaster] gi|22 | 0.642 | 0.041 | 0.755 | 4e-69 | |
| 194853658 | 3556 | GG24633 [Drosophila erecta] gi|190660069 | 0.642 | 0.041 | 0.75 | 4e-69 | |
| 195470324 | 3556 | GE15963 [Drosophila yakuba] gi|194173559 | 0.642 | 0.041 | 0.755 | 5e-69 |
| >gi|158297323|ref|XP_317578.4| AGAP007905-PA [Anopheles gambiae str. PEST] gi|157015140|gb|EAA12903.4| AGAP007905-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 274 bits (700), Expect = 2e-71, Method: Compositional matrix adjust.
Identities = 140/251 (55%), Positives = 181/251 (72%), Gaps = 28/251 (11%)
Query: 1 EISTREPLDREARSSHELVAEARDQGSPPRSSRVAVKISVTDVNDNAPELVDPQEDVISV 60
EI+TR+ LDRE ++S++LV EARDQG+P RSSRV+VK+ + DVNDNAP++VDPQEDV+SV
Sbjct: 584 EITTRDSLDRETKASYDLVVEARDQGTPYRSSRVSVKVQILDVNDNAPDIVDPQEDVVSV 643
Query: 61 REEQPPGTEVVRARAVDKDDGSNATISYSILKGRDTDGYGVFTIDPISGVIRTKSVLDHE 120
REEQP GTEVV+ RA+D+D G NA+ISYSILKGRD+DGYG+F+IDP+SGVIRTK+ LDHE
Sbjct: 644 REEQPIGTEVVKVRAIDRDHGQNASISYSILKGRDSDGYGMFSIDPMSGVIRTKTSLDHE 703
Query: 121 DRSIYRIAVAATDNGFPSRQTVRLLRVEVLDLNDNRPTFTSSSLLFKVSASDPDCGVNAM 180
+++IYR+AVAATDNG P +QTVRLLR+EVLDLNDNRPTFTSSSL+F++ D GV +
Sbjct: 704 EKTIYRLAVAATDNGKPPKQTVRLLRIEVLDLNDNRPTFTSSSLVFRLRE---DVGVGHI 760
Query: 181 VNYTLGESPSRTNHFYMKSV-------------------------SGEICISQDLDFESR 215
+ G S +F S SG++ +++ LD E +
Sbjct: 761 IGSISGNEQSDAENFISSSSDLHITYTLTPLTNDITEGAFDIDRNSGKLVVARQLDREQQ 820
Query: 216 SSYEFPVVATD 226
S Y + A D
Sbjct: 821 SEYRMEIRALD 831
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170031843|ref|XP_001843793.1| cadherin [Culex quinquefasciatus] gi|167871192|gb|EDS34575.1| cadherin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157108477|ref|XP_001650243.1| cadherin [Aedes aegypti] gi|108884003|gb|EAT48228.1| AAEL000700-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195437548|ref|XP_002066702.1| GK24627 [Drosophila willistoni] gi|194162787|gb|EDW77688.1| GK24627 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|4887715|gb|AAA79329.2| adherin [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195575605|ref|XP_002077668.1| GD22944 [Drosophila simulans] gi|194189677|gb|EDX03253.1| GD22944 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|25090185|sp|Q24292.3|DS_DROME RecName: Full=Protein dachsous; AltName: Full=Adherin; Flags: Precursor | Back alignment and taxonomy information |
|---|
| >gi|24580686|ref|NP_523446.2| dachsous [Drosophila melanogaster] gi|22945533|gb|AAF51468.3| dachsous [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194853658|ref|XP_001968202.1| GG24633 [Drosophila erecta] gi|190660069|gb|EDV57261.1| GG24633 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| FB|FBgn0000497 | 3503 | ds "dachsous" [Drosophila mela | 0.724 | 0.047 | 0.755 | 2.4e-67 | |
| ZFIN|ZDB-GENE-070122-3 | 2916 | celsr3 "cadherin, EGF LAG seve | 0.948 | 0.075 | 0.358 | 6.2e-31 | |
| UNIPROTKB|G3V8P3 | 2919 | Celsr2 "Cadherin EGF LAG seven | 0.956 | 0.076 | 0.386 | 2.1e-30 | |
| UNIPROTKB|Q6V0I7 | 4981 | FAT4 "Protocadherin Fat 4" [Ho | 0.935 | 0.043 | 0.371 | 3.1e-30 | |
| RGD|1309878 | 3278 | Dchs1 "dachsous 1 (Drosophila) | 0.943 | 0.066 | 0.373 | 3.1e-30 | |
| UNIPROTKB|F1M9W4 | 807 | Pcdhgb7 "Protein Pcdhgb7" [Rat | 0.931 | 0.267 | 0.412 | 3.4e-30 | |
| UNIPROTKB|Q9HCU4 | 2923 | CELSR2 "Cadherin EGF LAG seven | 0.956 | 0.075 | 0.390 | 3.5e-30 | |
| UNIPROTKB|E2R4F0 | 2926 | CELSR2 "Uncharacterized protei | 0.956 | 0.075 | 0.390 | 4.4e-30 | |
| RGD|1588516 | 931 | Pcdhgb7 "protocadherin gamma s | 0.931 | 0.232 | 0.412 | 4.6e-30 | |
| UNIPROTKB|E2RR85 | 4982 | FAT4 "Uncharacterized protein" | 0.935 | 0.043 | 0.363 | 6.4e-30 |
| FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 668 (240.2 bits), Expect = 2.4e-67, Sum P(2) = 2.4e-67
Identities = 127/168 (75%), Positives = 151/168 (89%)
Query: 1 EISTREPLDREARSSHELVAEARDQGSPPRSSRVAVKISVTDVNDNAPELVDPQEDVISV 60
EISTREPLDRE R ++LV EARDQG+P RS+RV V+I V+DVNDNAPE+ DPQEDV+SV
Sbjct: 1154 EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSV 1213
Query: 61 REEQPPGTEVVRARAVDKDDGSNATISYSILKGRDTDGYGVFTIDPISGVIRTKSVLDHE 120
REEQPPGTEVVR RAVD+D G NA+I+YSI+KGRD+DG+G+F+IDP SGVIRT+ VLDHE
Sbjct: 1214 REEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHE 1273
Query: 121 DRSIYRIAVAATDNGFPSRQTVRLLRVEVLDLNDNRPTFTSSSLLFKV 168
+RSIYR+ VAA+D G P R+TVR+LRVEVLDLNDNRPTFTSSSL+F+V
Sbjct: 1274 ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRV 1321
|
|
| ZFIN|ZDB-GENE-070122-3 celsr3 "cadherin, EGF LAG seven-pass G-type receptor 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V8P3 Celsr2 "Cadherin EGF LAG seven-pass G-type receptor 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1309878 Dchs1 "dachsous 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M9W4 Pcdhgb7 "Protein Pcdhgb7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9HCU4 CELSR2 "Cadherin EGF LAG seven-pass G-type receptor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4F0 CELSR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1588516 Pcdhgb7 "protocadherin gamma subfamily B, 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR85 FAT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 3e-28 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 4e-23 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 1e-22 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 2e-14 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 7e-14 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 2e-13 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 9e-11 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 1e-08 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 2e-08 | |
| cd00031 | 98 | cd00031, CA_like, Cadherin repeat-like domain | 1e-04 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
Score = 102 bits (256), Expect = 3e-28
Identities = 42/99 (42%), Positives = 58/99 (58%), Gaps = 3/99 (3%)
Query: 57 VISVREEQPPGTEVVRARAVDKDDGSNATISYSILKGRDTDGYGVFTIDPISGVIRTKSV 116
+SV E PPGT V+ A D D G N ++YSI+ G + G+F+IDP +G I T
Sbjct: 3 EVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSG---NEDGLFSIDPSTGEITTAKP 59
Query: 117 LDHEDRSIYRIAVAATDNGFPSRQTVRLLRVEVLDLNDN 155
LD E++S Y + V ATD G P + + + VLD+NDN
Sbjct: 60 LDREEQSSYTLTVTATDGGGPPLSSTATVTITVLDVNDN 98
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98 |
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206635 cd00031, CA_like, Cadherin repeat-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 100.0 | |
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.95 | |
| KOG1834|consensus | 952 | 99.84 | ||
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.83 | |
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.76 | |
| KOG1834|consensus | 952 | 99.74 | ||
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.36 | |
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.21 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 97.96 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 97.36 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 97.24 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 96.62 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 96.09 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 94.89 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 92.89 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 92.26 | |
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 91.62 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 89.5 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 88.19 | |
| TIGR03660 | 137 | T1SS_rpt_143 T1SS-143 repeat domain. This model re | 87.05 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 85.28 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 84.45 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-45 Score=321.18 Aligned_cols=225 Identities=36% Similarity=0.615 Sum_probs=214.7
Q ss_pred CeEecCCCCcCCCCeEEEEEEEEeCCCCCceeEEEEEEEEEeCCCCCCeecCCCceEEEEecCCCCCcEEEEEEEEeCCC
Q psy8618 1 EISTREPLDREARSSHELVAEARDQGSPPRSSRVAVKISVTDVNDNAPELVDPQEDVISVREEQPPGTEVVRARAVDKDD 80 (232)
Q Consensus 1 ~i~~~~~lD~E~~~~~~l~v~a~d~~~~~~~~~~~v~v~V~dvNd~~P~f~~~~~~~~~v~E~~~~g~~v~~v~a~D~D~ 80 (232)
.|++++.||||.++.+.|.|.|.|.+.|+++++++|+|.|.|+|||.|+|.+. .|.-++.|+.+.|+.|.++.|+|.|+
T Consensus 220 ~irta~~lDREt~e~HvlrVtA~d~~~P~~SAtttv~V~V~D~nDhsPvFEq~-~Y~e~lREn~evGy~vLtvrAtD~Ds 298 (2531)
T KOG4289|consen 220 AIRTAKSLDRETKETHVLRVTAQDHGDPRRSATTTVTVLVLDTNDHSPVFEQD-EYREELRENLEVGYEVLTVRATDGDS 298 (2531)
T ss_pred cchhhhhhhhhhhheeEEEEEeeecCCCcccceeEEEEEEeecCCCCcccchh-HHHHHHhhccccCceEEEEEeccCCC
Confidence 36789999999999999999999999999999999999999999999999998 78899999999999999999999999
Q ss_pred CCCcEEEEEEeeCCCCCCcccEEEeCCceEEEECccCCccCCCEEEEEEEEEeCCCCCcceeEEEEEEEEecCCCCCeee
Q psy8618 81 GSNATISYSILKGRDTDGYGVFTIDPISGVIRTKSVLDHEDRSIYRIAVAATDNGFPSRQTVRLLRVEVLDLNDNRPTFT 160 (232)
Q Consensus 81 ~~~~~v~y~i~~~~~~~~~~~f~id~~tG~i~~~~~ld~e~~~~~~l~v~a~d~~~~~~~~~~~v~i~v~d~Nd~~P~f~ 160 (232)
++|+.++|+++.| +....|.|++.+|.|++..+||||....|++.|.|.|.|.++...++.|.|+|.|.|||+|+|.
T Consensus 299 p~Nani~Yrl~eg---~~~~~f~in~rSGvI~T~a~lDRE~~~~y~L~VeAsDqG~~pgp~Ta~V~itV~D~NDNaPqFs 375 (2531)
T KOG4289|consen 299 PPNANIRYRLLEG---NAKNVFEINPRSGVISTRAPLDREELESYQLDVEASDQGRPPGPRTAMVEITVEDENDNAPQFS 375 (2531)
T ss_pred CCCCceEEEecCC---CccceeEEcCccceeeccCccCHHhhhheEEEEEeccCCCCCCCceEEEEEEEEecCCCCcccc
Confidence 9999999999988 6788999999999999999999999999999999999999988889999999999999999999
Q ss_pred CCceEEE-------------EEeecCCCCCCeEEEEEEccCCCCCCcEEEECCceEEEEeecCCCccccEEEEEEEEEEC
Q psy8618 161 SSSLLFK-------------VSASDPDCGVNAMVNYTLGESPSRTNHFYMKSVSGEICISQDLDFESRSSYEFPVVATDR 227 (232)
Q Consensus 161 ~~~~~~~-------------v~~~D~d~~~~~~i~y~l~~~~~~~~~f~i~~~~G~i~~~~~ld~e~~~~y~l~V~a~D~ 227 (232)
...|.++ |+++|.|.+.|+.|.|+|.++ +..+.|.|+..+|+|.+..+||+|.. .|.+.|+|.|+
T Consensus 376 e~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sg-n~~G~f~id~~tGel~vv~plD~e~~-~ytl~IrAqDg 453 (2531)
T KOG4289|consen 376 EKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASG-NGRGQFYIDSLTGELDVVEPLDFENS-EYTLRIRAQDG 453 (2531)
T ss_pred ccceEEEecccCCCCceEEEEEecccCCCcCceEEEEeecc-CccccEEEecccceEEEeccccccCC-eeEEEEEcccC
Confidence 9998665 556999999999999999998 88999999999999999999999999 89999999999
Q ss_pred CccC
Q psy8618 228 GKET 231 (232)
Q Consensus 228 g~~~ 231 (232)
|.|+
T Consensus 454 grPp 457 (2531)
T KOG4289|consen 454 GRPP 457 (2531)
T ss_pred CCCC
Confidence 9997
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 232 | ||||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 7e-15 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 1e-12 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 8e-06 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 2e-12 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 7e-09 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 7e-12 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 1e-05 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 8e-12 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 7e-06 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 1e-11 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 1e-05 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 1e-11 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 2e-11 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 2e-11 | ||
| 3ubh_A | 419 | Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le | 7e-11 | ||
| 3ubh_A | 419 | Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le | 3e-09 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 9e-11 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 4e-10 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 1e-05 | ||
| 3ppe_A | 203 | Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng | 4e-10 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 2e-09 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 7e-05 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 4e-09 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 8e-06 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 4e-09 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 2e-06 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 5e-09 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 5e-09 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 8e-09 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 2e-05 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 1e-08 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 1e-04 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 1e-08 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 1e-05 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 1e-08 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 1e-08 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 1e-05 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 1e-08 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 1e-05 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 1e-08 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 1e-05 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 1e-08 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 3e-05 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 1e-08 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 1e-05 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 1e-08 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 1e-05 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 1e-08 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 1e-05 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 2e-08 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 1e-05 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 3e-07 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 4e-04 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 1e-05 | ||
| 1nch_A | 110 | Structural Basis Of Cell-Cell Adhesion By Cadherins | 8e-05 | ||
| 1suh_A | 146 | Amino-Terminal Domain Of Epithelial Cadherin In The | 1e-04 | ||
| 2yst_A | 119 | Solution Structure Of The Third Cadherin Domain Fro | 3e-04 | ||
| 2yqg_A | 123 | Solution Structure Of The First Cadherin Domain Fro | 3e-04 |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
|
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 | Back alignment and structure |
| >pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|1NCH|A Chain A, Structural Basis Of Cell-Cell Adhesion By Cadherins Length = 110 | Back alignment and structure |
| >pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 | Back alignment and structure |
| >pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 | Back alignment and structure |
| >pdb|2YQG|A Chain A, Solution Structure Of The First Cadherin Domain From Human Desmoglein-2 Length = 123 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 1e-58 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 9e-36 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 1e-04 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-57 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 2e-38 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 3e-33 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 7e-11 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 9e-57 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 5e-54 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 7e-49 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 3e-37 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 2e-36 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 8e-08 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 1e-56 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 2e-52 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 7e-40 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 5e-34 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 2e-54 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 3e-51 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 2e-49 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 5e-41 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-38 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-08 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 1e-53 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-52 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 1e-49 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 3e-36 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-33 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-06 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-52 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-49 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-42 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-31 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-28 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-06 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 4e-50 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 1e-45 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 2e-44 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 1e-37 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 2e-13 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 2e-43 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 2e-42 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 1e-42 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 6e-41 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 5e-41 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 7e-34 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 9e-15 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 1e-40 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 3e-37 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 2e-39 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 9e-38 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 3e-39 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 1e-38 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 2e-34 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 4e-23 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 3e-15 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 4e-31 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-16 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 7e-11 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 2e-30 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 3e-22 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 3e-09 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 5e-30 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-15 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-08 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 3e-22 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 1e-11 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 6e-09 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 5e-22 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 2e-11 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 8e-09 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 2e-21 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 3e-09 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 8e-08 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 1e-19 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 8e-10 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 2e-08 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 2e-17 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 9e-10 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 7e-08 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 3e-16 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 5e-08 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 3e-07 |
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
Score = 186 bits (475), Expect = 1e-58
Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 31/256 (12%)
Query: 1 EISTREPLDREARSSHELVAEARDQ-GSPPRSSRVAVKISVTDVNDNAPELVDPQEDVIS 59
+I + LDRE ++ + L A+A D + P I V D+NDNAPE ++ +
Sbjct: 56 DIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQDINDNAPEFLN-GPYHAT 114
Query: 60 VREEQPPGTEVVRARAVDKDD---GSNATISYSILKGRDTDGYGVFTIDPISGVIRT-KS 115
V E GT V A D DD G++A + YSIL+G+ F+I+P + +I+T
Sbjct: 115 VPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILEGQP-----YFSIEPETAIIKTALP 169
Query: 116 VLDHEDRSIYRIAVAATDNG--FPSRQTVRLLRVEVLDLNDNRPTFTSSS---------- 163
+D E + Y + + A D G L V + D+NDN P F S
Sbjct: 170 NMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVV 229
Query: 164 ---LLFKVSASDPDCGVNAMVNYTLGESPSRTNHFYM----KSVSGEICISQDLDFESRS 216
+ +V A+D D G NA +Y + T F + ++ G I + + LDFE++
Sbjct: 230 LGTAIGRVKANDQDIGENAQSSYDI-IDGDGTALFEITSDAQAQDGVIRLRKPLDFETKK 288
Query: 217 SYEFPVVATDRGKETQ 232
SY V A + + +
Sbjct: 289 SYTLKVEAANIHIDPR 304
|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.97 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 99.97 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 99.97 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.97 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.96 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.95 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.92 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.89 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.84 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.83 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.83 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.8 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.79 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.78 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.77 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.77 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.76 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.62 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.48 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.48 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.43 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.41 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.34 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.33 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.31 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.29 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.07 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 98.16 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 95.04 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 92.77 | |
| 3rb5_A | 298 | Na/Ca exchange protein; CBD12, calcium binding and | 91.48 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 89.17 | |
| 3ead_A | 137 | Na/Ca exchange protein; CBD1, calcium regulation, | 88.92 | |
| 3gin_A | 160 | Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calci | 85.49 | |
| 2yrl_A | 102 | KIAA1837 protein; PKD domain, NPPSFA, national pro | 85.36 | |
| 2kpn_A | 103 | Bacillolysin; solution structure, BIG_3 domain, PF | 84.18 |
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-49 Score=324.32 Aligned_cols=225 Identities=34% Similarity=0.501 Sum_probs=202.0
Q ss_pred CeEecCCCCcCCCCeEEEEEEEEeCCC-CCceeEEEEEEEEEeCCCCCCeecCCCceEEEEecCCCCCcEEEEEEEEeCC
Q psy8618 1 EISTREPLDREARSSHELVAEARDQGS-PPRSSRVAVKISVTDVNDNAPELVDPQEDVISVREEQPPGTEVVRARAVDKD 79 (232)
Q Consensus 1 ~i~~~~~lD~E~~~~~~l~v~a~d~~~-~~~~~~~~v~v~V~dvNd~~P~f~~~~~~~~~v~E~~~~g~~v~~v~a~D~D 79 (232)
.|.+.++||||.+..|.|+|.|+|+++ +++++.+.|+|.|.|+|||+|.|... .|.+.|+|+.++|+.++++.|+|+|
T Consensus 56 ~i~~~~~LDrE~~~~y~l~v~a~D~~~~~~~~~~~~v~I~V~DvNDn~P~F~~~-~y~~~v~E~~~~gt~v~~v~A~D~D 134 (322)
T 2a62_A 56 DIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQDINDNAPEFLNG-PYHATVPEMSILGTSVTNVTATDAD 134 (322)
T ss_dssp EEEECSCCCTTTCSBCCEEEEEECTTTCSEEEEEEEECEECCCCSCSCBCCSSS-EEEEEECSSCCTTCBCCCCCCCBCS
T ss_pred EEEEeccCCcccccEEEEEEEEEECCCCCcccceEEEEEEEEecCCCCCccCCC-ceEEEEeCCCCCCCEEEEEEEEeCC
Confidence 378899999999999999999999875 45788899999999999999999987 7899999999999999999999999
Q ss_pred C---CCCcEEEEEEeeCCCCCCcccEEEeCCceEEEEC-ccCCccCCCEEEEEEEEEeCCCCC--cceeEEEEEEEEecC
Q psy8618 80 D---GSNATISYSILKGRDTDGYGVFTIDPISGVIRTK-SVLDHEDRSIYRIAVAATDNGFPS--RQTVRLLRVEVLDLN 153 (232)
Q Consensus 80 ~---~~~~~v~y~i~~~~~~~~~~~f~id~~tG~i~~~-~~ld~e~~~~~~l~v~a~d~~~~~--~~~~~~v~i~v~d~N 153 (232)
. |.|+.++|+|.++ ..+|.|++.+|.|++. +.||||....|.|.|.|+|+|.|+ +++.+.|+|+|.|+|
T Consensus 135 ~~~~G~n~~i~Y~i~~~-----~~~F~Id~~tG~i~~~~~~LD~E~~~~y~l~V~a~D~g~p~~~~s~~~~v~I~V~DvN 209 (322)
T 2a62_A 135 DPVYGNSAKLVYSILEG-----QPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVN 209 (322)
T ss_dssp CSSSTTSSCEEEEEEEC-----TTTEEECTTTCCEEECSSCCCGGGCSEEEEEEEEEESCSSSSCCBCCEEEEEEECCCC
T ss_pred CCCCCccEEEEEEEccC-----CCCEEEecCCCEEEecccCCCcccCCeEEEEEEEEECCCCCCCceeEEEEEEEEEecC
Confidence 6 7788999999875 2579999999999998 899999999999999999998874 889999999999999
Q ss_pred CCCCeeeCCceEE-------------EEEeecCCCCCCeEEEEEEccCCCCCCcEEEE----CCceEEEEeecCCCcccc
Q psy8618 154 DNRPTFTSSSLLF-------------KVSASDPDCGVNAMVNYTLGESPSRTNHFYMK----SVSGEICISQDLDFESRS 216 (232)
Q Consensus 154 d~~P~f~~~~~~~-------------~v~~~D~d~~~~~~i~y~l~~~~~~~~~f~i~----~~~G~i~~~~~ld~e~~~ 216 (232)
||+|.|....|.+ +|.++|+|.+.++.++|+|..+ +..+.|.|+ +.+|.|++.++||||...
T Consensus 210 Dn~P~F~~~~y~~~v~En~~~gt~v~~v~A~D~D~g~n~~i~Y~i~~g-~~~~~F~I~~d~~~~tG~i~~~~~LD~E~~~ 288 (322)
T 2a62_A 210 DNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDG-DGTALFEITSDAQAQDGVIRLRKPLDFETKK 288 (322)
T ss_dssp CCCCCCSCSEEEEEECSCCSSCCEEEEEECCCSSCGGGTCCEEEEC----CCSSBCCBCCTTTSEEEEEBCSCCCCSSCC
T ss_pred CCCCeecCCCceeEeECCCCCCcEEEEEEEEeCCCCCCceEEEEEECC-CCCCcEEEeccCCCceEEEEECCcCCcccCC
Confidence 9999999887755 4556888988888999999876 567899998 468999999999999999
Q ss_pred EEEEEEEEEECCccCC
Q psy8618 217 SYEFPVVATDRGKETQ 232 (232)
Q Consensus 217 ~y~l~V~a~D~g~~~q 232 (232)
.|.|.|+|+|+|.|++
T Consensus 289 ~y~l~V~A~D~g~pp~ 304 (322)
T 2a62_A 289 SYTLKVEAANIHIDPR 304 (322)
T ss_dssp EEEEEEEEECCCSSCT
T ss_pred eEEEEEEEEECCCCCc
Confidence 9999999999998864
|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 | Back alignment and structure |
|---|
| >3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 | Back alignment and structure |
|---|
| >3gin_A Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calcium binding domain 1, antiport, calcium transport, calmodulin-binding, cell membrane; 2.40A {Canis lupus familiaris} PDB: 2dpk_A* 2fws_A | Back alignment and structure |
|---|
| >2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 232 | ||||
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 5e-17 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 9e-06 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 9e-17 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 2e-05 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 8e-15 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 3e-05 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 0.003 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 2e-12 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 7e-06 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 1e-04 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 4e-12 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-04 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 9e-12 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 2e-06 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 7e-04 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 8e-10 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 3e-09 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 0.002 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 0.003 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 4e-09 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 1e-04 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 2e-04 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 4e-05 |
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: E-cadherin (epithelial) species: Human (Homo sapiens) [TaxId: 9606]
Score = 72.1 bits (176), Expect = 5e-17
Identities = 22/95 (23%), Positives = 38/95 (40%), Gaps = 2/95 (2%)
Query: 58 ISVREEQPPGTEVVRARAVDKDDGSNATISYSIL-KGRDTDGYGVFTIDPISGVIRTKSV 116
IS E + G + + + YSI +G DT GVF I+ +G ++
Sbjct: 10 ISCPENEK-GPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEP 68
Query: 117 LDHEDRSIYRIAVAATDNGFPSRQTVRLLRVEVLD 151
LD E + Y + A + + + + + V D
Sbjct: 69 LDRERIATYTLFSHAVSSNGNAVEDPMEILITVTD 103
|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.9 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.9 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.88 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.86 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.82 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.81 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.74 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.7 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.69 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.68 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.54 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.54 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.53 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.49 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.28 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.27 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.21 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.18 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.16 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.14 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 93.18 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 91.53 |
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: E-cadherin (epithelial) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.90 E-value=3.5e-23 Score=142.01 Aligned_cols=107 Identities=35% Similarity=0.411 Sum_probs=95.4
Q ss_pred CCCCCeecCCCceEEEEecCCCCCcEEEEEEEEeCCCC---CCcEEEEEEeeCCCC-CCcccEEEeCCceEEEE-CccCC
Q psy8618 44 NDNAPELVDPQEDVISVREEQPPGTEVVRARAVDKDDG---SNATISYSILKGRDT-DGYGVFTIDPISGVIRT-KSVLD 118 (232)
Q Consensus 44 Nd~~P~f~~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~---~~~~v~y~i~~~~~~-~~~~~f~id~~tG~i~~-~~~ld 118 (232)
|||+|.|... .|.+.|+|+.++|+.|+++.|+|+|.+ .++.++|+|..+... ....+|.|++.+|.|++ .+.||
T Consensus 1 NDn~P~F~~~-~y~~~V~E~~~~gt~v~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~lD 79 (112)
T d1edha2 1 NDNRPEFTQE-VFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLD 79 (112)
T ss_dssp SCCCCEESCS-EEEEEEETTCCTTCEEEECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTCEEEECSSCCC
T ss_pred CCCCCccCCC-EEEEEEECCCCCCCEEEEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccceEEEEecccc
Confidence 8999999988 889999999999999999999999976 367899999876432 23578999999999986 56799
Q ss_pred ccCCCEEEEEEEEEeCCCCCcceeEEEEEEEEe
Q psy8618 119 HEDRSIYRIAVAATDNGFPSRQTVRLLRVEVLD 151 (232)
Q Consensus 119 ~e~~~~~~l~v~a~d~~~~~~~~~~~v~i~v~d 151 (232)
||....|.|.|.|+|++.|++++.+.|.|+|.|
T Consensus 80 ~E~~~~y~l~V~a~D~g~~~~~~~~~v~I~V~D 112 (112)
T d1edha2 80 RESYPTYTLVVQAADLQGEGLSTTAKAVITVKD 112 (112)
T ss_dssp TTTCCEEEEEEEEETGGGTSCEEEEEEEEEEEC
T ss_pred cccCcEEEEEEEEEECCCCccEEEEEEEEEEEC
Confidence 999999999999999999999999999999986
|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|