Psyllid ID: psy8651
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 302 | 2.2.26 [Sep-21-2011] | |||||||
| Q05319 | 787 | Serine proteinase stubble | no | N/A | 0.586 | 0.224 | 0.351 | 3e-28 | |
| Q9DBI0 | 811 | Transmembrane protease se | yes | N/A | 0.592 | 0.220 | 0.370 | 5e-28 | |
| P98074 | 1034 | Enteropeptidase OS=Sus sc | yes | N/A | 0.665 | 0.194 | 0.343 | 1e-27 | |
| Q66TN7 | 980 | Ovochymase-2 OS=Rhinella | N/A | N/A | 0.629 | 0.193 | 0.346 | 2e-27 | |
| P79953 | 1004 | Ovochymase-2 OS=Xenopus l | N/A | N/A | 0.632 | 0.190 | 0.351 | 1e-26 | |
| Q90629 | 248 | Trypsin II-P29 OS=Gallus | yes | N/A | 0.599 | 0.729 | 0.358 | 1e-26 | |
| Q90WD8 | 974 | Ovochymase-2 OS=Bufo japo | N/A | N/A | 0.652 | 0.202 | 0.343 | 1e-26 | |
| Q91Y47 | 624 | Coagulation factor XI OS= | no | N/A | 0.655 | 0.317 | 0.334 | 1e-26 | |
| P21902 | 375 | Proclotting enzyme OS=Tac | N/A | N/A | 0.596 | 0.48 | 0.354 | 2e-26 | |
| P29786 | 254 | Trypsin 3A1 OS=Aedes aegy | N/A | N/A | 0.566 | 0.673 | 0.367 | 2e-26 |
| >sp|Q05319|STUB_DROME Serine proteinase stubble OS=Drosophila melanogaster GN=Sb PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 125 bits (314), Expect = 3e-28, Method: Compositional matrix adjust.
Identities = 71/202 (35%), Positives = 104/202 (51%), Gaps = 25/202 (12%)
Query: 100 RIVGGNVTKLHEFPWIAALTKKGKF------YCGATLIAKRHVLTAAHCIEGVNPKEIKV 153
RIVGG +PW ++ + F CG LI + + TA HC++ + +I++
Sbjct: 543 RIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRI 602
Query: 154 TLGEHDRLSKNESVPVIIRKVKRAIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACL 213
+GE+D E +P I R V + + HP +S + D+AL+++E ++F AP + P CL
Sbjct: 603 RVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEF-APHVSPICL 661
Query: 214 P---------------GNSLDERKPTANSLRKVEVPILSEEECKSAGYSASR---ITNNM 255
P L E + L++V VPI+S + CKS A R I +
Sbjct: 662 PETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIF 721
Query: 256 LCAGYAEGKRDSCQGDSGGPLQ 277
LCAGY G +DSCQGDSGGPLQ
Sbjct: 722 LCAGYETGGQDSCQGDSGGPLQ 743
|
Hormone dependent protease required for epithelial morphogenesis, including the formation of bristles, legs, and wings. Has a dual function, detaches imaginal disk cells from extracellular matrices through its extracellular proteolytic domain and transmits an outside-to-inside signal to its intracellular domain to modify the cytoskeleton during morphogenesis. Drosophila melanogaster (taxid: 7227) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q9DBI0|TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus GN=Tmprss6 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P98074|ENTK_PIG Enteropeptidase OS=Sus scrofa GN=TMPRSS15 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q66TN7|OVCH2_RHIAE Ovochymase-2 OS=Rhinella arenarum GN=OVCH2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P79953|OVCH2_XENLA Ovochymase-2 OS=Xenopus laevis GN=ovch2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q90629|TRY3_CHICK Trypsin II-P29 OS=Gallus gallus PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q90WD8|OVCH2_BUFJA Ovochymase-2 OS=Bufo japonicus GN=OVCH2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q91Y47|FA11_MOUSE Coagulation factor XI OS=Mus musculus GN=F11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P21902|PCE_TACTR Proclotting enzyme OS=Tachypleus tridentatus PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P29786|TRY3_AEDAE Trypsin 3A1 OS=Aedes aegypti GN=AAEL007818 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 302 | ||||||
| 170035729 | 580 | trypsin [Culex quinquefasciatus] gi|1678 | 0.907 | 0.472 | 0.451 | 2e-70 | |
| 242019714 | 315 | trypsin, putative [Pediculus humanus cor | 0.619 | 0.593 | 0.516 | 1e-54 | |
| 189234557 | 286 | PREDICTED: similar to oviductin [Triboli | 0.642 | 0.678 | 0.471 | 2e-49 | |
| 383858790 | 320 | PREDICTED: plasma kallikrein-like [Megac | 0.672 | 0.634 | 0.452 | 2e-49 | |
| 193610622 | 311 | PREDICTED: transmembrane protease serine | 0.642 | 0.623 | 0.462 | 2e-47 | |
| 157116261 | 287 | oviductin [Aedes aegypti] gi|108876549|g | 0.675 | 0.710 | 0.427 | 2e-47 | |
| 195025144 | 356 | GH20777 [Drosophila grimshawi] gi|193902 | 0.665 | 0.564 | 0.420 | 1e-46 | |
| 170035733 | 291 | oviductin [Culex quinquefasciatus] gi|16 | 0.678 | 0.704 | 0.437 | 1e-46 | |
| 307180766 | 338 | Plasma kallikrein [Camponotus floridanus | 0.635 | 0.568 | 0.448 | 1e-46 | |
| 193610620 | 338 | PREDICTED: serine proteinase stubble-lik | 0.615 | 0.550 | 0.495 | 2e-46 |
| >gi|170035729|ref|XP_001845720.1| trypsin [Culex quinquefasciatus] gi|167878026|gb|EDS41409.1| trypsin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 271 bits (694), Expect = 2e-70, Method: Compositional matrix adjust.
Identities = 135/299 (45%), Positives = 190/299 (63%), Gaps = 25/299 (8%)
Query: 5 NYTGKIGIVAGWGRLDERKPTANSLRKVEVPILSEEECKSAGYSASRITNNMLCAGYAEG 64
++TG G+V GWG E + +L++V VPI+S +CK +GY RIT+NMLCAG+AEG
Sbjct: 230 SFTGYDGLVTGWGATSENGQVSVNLQEVMVPIMSNADCKKSGYGDKRITDNMLCAGFAEG 289
Query: 65 KRDSCQGDSGGPLQIA--------VARPGKMEVIACGQVERNQRIVGGNVTKLHEFPWIA 116
K+DSCQGDSGGPL I + + + CG+ + +RIVGG T++++FPW+A
Sbjct: 290 KKDSCQGDSGGPLHIINKEKAAENIHQIAGIVSWECGRTNQIKRIVGGMETRVNQFPWMA 349
Query: 117 ALTKKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIRKVKR 176
L FYCG +LI RHV+TAAHC+ G NP+ I VTL +HDR + +ES I +V+R
Sbjct: 350 ILKYGDSFYCGGSLITDRHVMTAAHCVTGFNPRRISVTLLDHDRSTDSES-ETITARVER 408
Query: 177 AIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLP--GNSLDERKPT---------- 224
IRHP ++ N++ND+A+L+++ ++ A ++ P C P G S T
Sbjct: 409 VIRHPAYNPGNYDNDVAILKLDKVLEMNA-RLRPVCQPTSGESFAGENGTVTGWGTTSQG 467
Query: 225 ---ANSLRKVEVPILSEEECKSAGYSASRITNNMLCAGYAEGKRDSCQGDSGGPLQIAV 280
+N+L++V VPILS E+C+ Y RIT+NMLCAGY EG +DSCQGDSGGPL +
Sbjct: 468 GDVSNTLQEVIVPILSNEDCRKTAYGERRITDNMLCAGYPEGMKDSCQGDSGGPLHVTT 526
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242019714|ref|XP_002430304.1| trypsin, putative [Pediculus humanus corporis] gi|212515419|gb|EEB17566.1| trypsin, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|189234557|ref|XP_974113.2| PREDICTED: similar to oviductin [Tribolium castaneum] gi|270002766|gb|EEZ99213.1| serine protease P11 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383858790|ref|XP_003704882.1| PREDICTED: plasma kallikrein-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|193610622|ref|XP_001945107.1| PREDICTED: transmembrane protease serine 11B-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|157116261|ref|XP_001658407.1| oviductin [Aedes aegypti] gi|108876549|gb|EAT40774.1| AAEL007508-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195025144|ref|XP_001986008.1| GH20777 [Drosophila grimshawi] gi|193902008|gb|EDW00875.1| GH20777 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|170035733|ref|XP_001845722.1| oviductin [Culex quinquefasciatus] gi|167878028|gb|EDS41411.1| oviductin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|307180766|gb|EFN68635.1| Plasma kallikrein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|193610620|ref|XP_001943273.1| PREDICTED: serine proteinase stubble-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 302 | ||||||
| FB|FBgn0042098 | 364 | CG18735 [Drosophila melanogast | 0.635 | 0.527 | 0.427 | 1.1e-41 | |
| FB|FBgn0034661 | 372 | CG4386 [Drosophila melanogaste | 0.655 | 0.532 | 0.420 | 1.1e-41 | |
| UNIPROTKB|E1B9Z9 | 1095 | TMPRSS9 "Uncharacterized prote | 0.642 | 0.177 | 0.347 | 2.8e-36 | |
| RGD|1309581 | 1061 | Tmprss9 "transmembrane proteas | 0.562 | 0.160 | 0.360 | 9e-36 | |
| UNIPROTKB|F1NZZ9 | 805 | OVCH2 "Uncharacterized protein | 0.622 | 0.233 | 0.342 | 4e-35 | |
| FB|FBgn0036436 | 374 | CG4914 [Drosophila melanogaste | 0.596 | 0.481 | 0.446 | 4e-35 | |
| FB|FBgn0034666 | 352 | CG9294 [Drosophila melanogaste | 0.612 | 0.525 | 0.389 | 9.5e-34 | |
| UNIPROTKB|Q7Z410 | 1059 | TMPRSS9 "Transmembrane proteas | 0.695 | 0.198 | 0.346 | 5.2e-23 | |
| UNIPROTKB|F1N633 | 935 | F1N633 "Uncharacterized protei | 0.556 | 0.179 | 0.352 | 4.4e-33 | |
| FB|FBgn0039272 | 325 | CG11836 [Drosophila melanogast | 0.609 | 0.566 | 0.394 | 6.7e-33 |
| FB|FBgn0042098 CG18735 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 442 (160.7 bits), Expect = 1.1e-41, P = 1.1e-41
Identities = 91/213 (42%), Positives = 131/213 (61%)
Query: 84 PGKMEVI--ACGQVERNQRIVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAH 141
P K E +CG + RIVGG T++HE+PW+ L G FYCGA+L+ ++ LTAAH
Sbjct: 64 PAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAH 123
Query: 142 CIEGVNPKEIKVTLGEHDRLSKNESVPVIIRKVKRAIRHPDFSLSNFNNDIALLEMESGV 201
C+ G + I V L EH+R ++ V ++ R+V R + HP +S NF++DIAL+ V
Sbjct: 124 CVNGFYHRLITVRLLEHNR--QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181
Query: 202 DFEAPQIHPACLPGNS---------------LDERKPTANSLRKVEVPILSEEECKSAGY 246
+HP C+P S L E P +++L++VEVPILS+EEC+++ Y
Sbjct: 182 RLGI-DMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNY 240
Query: 247 SASRITNNMLCAGYAE-GKRDSCQGDSGGPLQI 278
S+IT+NM+CAGY E G +DSCQGDSGGP+ +
Sbjct: 241 GESKITDNMICAGYVEQGGKDSCQGDSGGPMHV 273
|
|
| FB|FBgn0034661 CG4386 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B9Z9 TMPRSS9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1309581 Tmprss9 "transmembrane protease, serine 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZZ9 OVCH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036436 CG4914 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034666 CG9294 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z410 TMPRSS9 "Transmembrane protease serine 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N633 F1N633 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039272 CG11836 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 302 | |||
| smart00020 | 229 | smart00020, Tryp_SPc, Trypsin-like serine protease | 1e-69 | |
| cd00190 | 232 | cd00190, Tryp_SPc, Trypsin-like serine protease; M | 3e-69 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 7e-45 | |
| cd00190 | 232 | cd00190, Tryp_SPc, Trypsin-like serine protease; M | 1e-28 | |
| smart00020 | 229 | smart00020, Tryp_SPc, Trypsin-like serine protease | 1e-26 | |
| COG5640 | 413 | COG5640, COG5640, Secreted trypsin-like serine pro | 3e-17 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 3e-16 | |
| COG3591 | 251 | COG3591, COG3591, V8-like Glu-specific endopeptida | 0.003 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 0.003 |
| >gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease | Back alignment and domain information |
|---|
Score = 215 bits (550), Expect = 1e-69
Identities = 78/195 (40%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
Query: 100 RIVGGNVTKLHEFPWIAALT-KKGKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEH 158
RIVGG+ + FPW +L G+ +CG +LI+ R VLTAAHC+ G +P I+V LG H
Sbjct: 1 RIVGGSEANIGSFPWQVSLQYGGGRHFCGGSLISPRWVLTAAHCVRGSDPSNIRVRLGSH 60
Query: 159 DRLSKNESVPVIIRKVKRAIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLP---- 214
D S E + KV + I HP+++ S ++NDIALL+++ V + P CLP
Sbjct: 61 DLSSGEEGQ---VIKVSKVIIHPNYNPSTYDNDIALLKLKEPVTLS-DNVRPICLPSSNY 116
Query: 215 -------------GNSLDERKPTANSLRKVEVPILSEEECKSAGYSASRITNNMLCAGYA 261
G + + ++L++V VPI+S C+ A IT+NMLCAG
Sbjct: 117 NVPAGTTCTVSGWGRTSEGAGSLPDTLQEVNVPIVSNATCRRAYSGGGAITDNMLCAGGL 176
Query: 262 EGKRDSCQGDSGGPL 276
EG +D+CQGDSGGPL
Sbjct: 177 EGGKDACQGDSGGPL 191
|
Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues. Length = 229 |
| >gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|226119 COG3591, COG3591, V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 302 | |||
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 100.0 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 100.0 | |
| KOG3627|consensus | 256 | 100.0 | ||
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.97 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 99.93 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 99.51 | |
| KOG3627|consensus | 256 | 99.49 | ||
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 99.47 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.16 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 98.88 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 98.82 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 98.45 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.34 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 97.8 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.57 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.29 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 97.14 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 97.08 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 96.84 | |
| PF02395 | 769 | Peptidase_S6: Immunoglobulin A1 protease Serine pr | 96.57 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 84.04 |
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.7e-36 Score=248.82 Aligned_cols=191 Identities=44% Similarity=0.764 Sum_probs=159.6
Q ss_pred ecCCeecccccchhHHhhhcc-CeeeeeEEEeeCCEEEecccccCCCCCceEEEEEcccccccCCCCCceEEEeEeEEEe
Q psy8651 101 IVGGNVTKLHEFPWIAALTKK-GKFYCGATLIAKRHVLTAAHCIEGVNPKEIKVTLGEHDRLSKNESVPVIIRKVKRAIR 179 (302)
Q Consensus 101 i~~g~~~~~~~~pwi~~l~~~-~~~~C~GsLI~~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~ 179 (302)
|.+|..+..++|||++.+... ..+.|+|+||+++||||||||+.......+.|++|........ ...+.+.|.++++
T Consensus 1 i~~G~~~~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~--~~~~~~~v~~~~~ 78 (232)
T cd00190 1 IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHDLSSNE--GGGQVIKVKKVIV 78 (232)
T ss_pred CcCCeECCCCCCCCEEEEEccCCcEEEEEEEeeCCEEEECHHhcCCCCCccEEEEeCcccccCCC--CceEEEEEEEEEE
Confidence 457889999999999999876 7889999999999999999999765567889999988765322 1257789999999
Q ss_pred CCCCCCCCCCCCeEEEEEcCCCcCCCCceeeeeeCCCC--CC--------------CCCccCcCceEEEeeeeCHHhHhc
Q psy8651 180 HPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLPGNS--LD--------------ERKPTANSLRKVEVPILSEEECKS 243 (302)
Q Consensus 180 hp~y~~~~~~~DiALl~L~~~~~~~~~~v~picl~~~~--~~--------------~~~~~~~~l~~~~~~~~~~~~C~~ 243 (302)
||+|+.....+|||||||++|+.++. .++|||||... .. .....+..++...+.+++...|..
T Consensus 79 hp~y~~~~~~~DiAll~L~~~~~~~~-~v~picl~~~~~~~~~~~~~~~~G~g~~~~~~~~~~~~~~~~~~~~~~~~C~~ 157 (232)
T cd00190 79 HPNYNPSTYDNDIALLKLKRPVTLSD-NVRPICLPSSGYNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKR 157 (232)
T ss_pred CCCCCCCCCcCCEEEEEECCcccCCC-cccceECCCccccCCCCCEEEEEeCCcCCCCCCCCceeeEEEeeeECHHHhhh
Confidence 99999888899999999999999988 99999999873 21 011345678999999999999998
Q ss_pred cCCCCCCCCCCeEEeeeCCCCCCCCCCCCCCceEEEecCCCceeEEEEEEeeeee
Q psy8651 244 AGYSASRITNNMLCAGYAEGKRDSCQGDSGGPLQIAVARPGKMEATLSKVVSRVQ 298 (302)
Q Consensus 244 ~~~~~~~~~~~~~Ca~~~~~~~~~C~gDsGgPL~~~~~~~g~~~~~l~GI~S~~~ 298 (302)
.+.....+.++++|++......+.|.|||||||++.. ++ +++|+||+|++.
T Consensus 158 ~~~~~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~--~~--~~~lvGI~s~g~ 208 (232)
T cd00190 158 AYSYGGTITDNMLCAGGLEGGKDACQGDSGGPLVCND--NG--RGVLVGIVSWGS 208 (232)
T ss_pred hccCcccCCCceEeeCCCCCCCccccCCCCCcEEEEe--CC--EEEEEEEEehhh
Confidence 8743357889999998655467899999999999988 43 568999999975
|
Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. |
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >KOG3627|consensus | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >KOG3627|consensus | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 302 | ||||
| 1ekb_B | 235 | The Serine Protease Domain Of Enteropeptidase Bound | 3e-27 | ||
| 2f91_A | 237 | 1.2a Resolution Structure Of A Crayfish Trypsin Com | 1e-25 | ||
| 4dgj_A | 235 | Structure Of A Human Enteropeptidase Light Chain Va | 4e-25 | ||
| 1zhp_A | 238 | Crystal Structure Of The Catalytic Domain Of Coagul | 5e-25 | ||
| 1xxd_A | 238 | Crystal Structure Of The Fxia Catalytic Domain In C | 5e-25 | ||
| 1xx9_A | 238 | Crystal Structure Of The Fxia Catalytic Domain In C | 6e-25 | ||
| 1zhm_A | 238 | Crystal Structure Of The Catalytic Domain Of The Co | 7e-25 | ||
| 2f83_A | 625 | Crystal Structure At 2.9 Angstroms Resolution Of Hu | 9e-25 | ||
| 2any_A | 241 | Expression, Crystallization And The Three-Dimension | 3e-24 | ||
| 1fxy_A | 228 | Coagulation Factor Xa-Trypsin Chimera Inhibited Wit | 3e-24 | ||
| 2anw_A | 241 | Expression, Crystallization And Three-Dimensional S | 4e-24 | ||
| 1gdu_A | 224 | Fusarium Oxysporum Trypsin At Atomic Resolution Len | 6e-24 | ||
| 1zjd_A | 237 | Crystal Structure Of The Catalytic Domain Of Coagul | 6e-24 | ||
| 1zzz_A | 237 | Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes | 7e-24 | ||
| 1tgs_Z | 229 | Three-Dimensional Structure Of The Complex Between | 7e-24 | ||
| 3bg8_A | 238 | Crystal Structure Of Factor Xia In Complex With Cla | 8e-24 | ||
| 3sor_A | 238 | Factor Xia In Complex With A Clorophenyl-tetrazole | 8e-24 | ||
| 1f0t_A | 243 | Bovine Trypsin Complexed With Rpr131247 Length = 24 | 9e-24 | ||
| 1zlr_A | 237 | Factor Xi Catalytic Domain Complexed With 2-Guanidi | 9e-24 | ||
| 1zhr_A | 238 | Crystal Structure Of The Catalytic Domain Of Coagul | 9e-24 | ||
| 2ftm_A | 224 | Crystal Structure Of A Bpti Variant (Cys38->ser) In | 1e-23 | ||
| 1zpz_A | 238 | Factor Xi Catalytic Domain Complexed With N-((R)-1- | 1e-23 | ||
| 2bq6_B | 249 | Crystal Structure Of Factor Xa In Complex With 21 L | 2e-23 | ||
| 1co7_E | 245 | R117h Mutant Rat Anionic Trypsin Complexed With Bov | 2e-23 | ||
| 1ppz_A | 224 | Trypsin Complexes At Atomic And Ultra-High Resoluti | 2e-23 | ||
| 1oph_B | 243 | Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh | 2e-23 | ||
| 1xvm_A | 224 | Trypsin From Fusarium Oxysporum- Room Temperature T | 2e-23 | ||
| 1g3b_A | 228 | Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba | 2e-23 | ||
| 1a0j_A | 223 | Crystal Structure Of A Non-Psychrophilic Trypsin Fr | 3e-23 | ||
| 3tgj_E | 233 | S195a Trypsinogen Complexed With Bovine Pancreatic | 4e-23 | ||
| 3veq_B | 223 | A Binary Complex Betwwen Bovine Pancreatic Trypsin | 4e-23 | ||
| 1f7z_A | 233 | Rat Trypsinogen K15a Complexed With Bovine Pancreat | 4e-23 | ||
| 1y59_T | 223 | Dianhydrosugar-Based Benzamidine, Factor Xa Specifi | 4e-23 | ||
| 2y5f_A | 234 | Factor Xa - Cation Inhibitor Complex Length = 234 | 4e-23 | ||
| 2bok_A | 241 | Factor Xa- Cation Length = 241 | 5e-23 | ||
| 1mq5_A | 233 | Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch | 5e-23 | ||
| 1fjs_A | 234 | Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 | 5e-23 | ||
| 1xka_C | 235 | Factor Xa Complexed With A Synthetic Inhibitor Fx-2 | 6e-23 | ||
| 1hcg_A | 241 | Structure Of Human Des(1-45) Factor Xa At 2.2 Angst | 6e-23 | ||
| 3ens_B | 238 | Crystal Structure Of Human Fxa In Complex With Meth | 6e-23 | ||
| 1tab_E | 223 | Structure Of The Trypsin-Binding Domain Of Bowman-B | 7e-23 | ||
| 1utj_A | 242 | Trypsin Specificity As Elucidated By Lie Calculatio | 7e-23 | ||
| 1ql9_A | 223 | Factor Xa Specific Inhibitor In Complex With Rat Tr | 7e-23 | ||
| 1ezq_A | 254 | Crystal Structure Of Human Coagulation Factor Xa Co | 8e-23 | ||
| 1c5m_D | 255 | Structural Basis For Selectivity Of A Small Molecul | 8e-23 | ||
| 2fi4_E | 223 | Crystal Structure Of A Bpti Variant (Cys14->ser) In | 1e-22 | ||
| 1j15_A | 223 | Benzamidine In Complex With Rat Trypsin Mutant X991 | 1e-22 | ||
| 1hj8_A | 222 | 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | 1e-22 | ||
| 1taw_A | 223 | Bovine Trypsin Complexed To Appi Length = 223 | 1e-22 | ||
| 1mbq_A | 220 | Anionic Trypsin From Pacific Chum Salmon Length = 2 | 1e-22 | ||
| 2gd4_H | 241 | Crystal Structure Of The Antithrombin-S195a Factor | 1e-22 | ||
| 1h4w_A | 224 | Structure Of Human Trypsin Iv (Brain Trypsin) Lengt | 2e-22 | ||
| 1and_A | 223 | Anionic Trypsin Mutant With Arg 96 Replaced By His | 2e-22 | ||
| 3tgi_E | 223 | Wild-Type Rat Anionic Trypsin Complexed With Bovine | 2e-22 | ||
| 1anc_A | 223 | Anionic Trypsin Mutant With Ser 214 Replaced By Lys | 2e-22 | ||
| 1anb_A | 223 | Anionic Trypsin Mutant With Ser 214 Replaced By Glu | 2e-22 | ||
| 4an7_A | 231 | Kunitz Type Trypsin Inhibitor Complex With Porcine | 2e-22 | ||
| 1bzx_E | 222 | The Crystal Structure Of Anionic Salmon Trypsin In | 2e-22 | ||
| 1ntp_A | 223 | Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU | 2e-22 | ||
| 1fax_A | 254 | Coagulation Factor Xa Inhibitor Complex Length = 25 | 2e-22 | ||
| 3otj_E | 223 | A Crystal Structure Of Trypsin Complexed With Bpti | 2e-22 | ||
| 5ptp_A | 223 | Structure Of Hydrolase (Serine Proteinase) Length = | 2e-22 | ||
| 3gyl_B | 261 | Structure Of Prostasin At 1.3 Angstroms Resolution | 2e-22 | ||
| 3e0p_B | 271 | The X-Ray Structure Of Human Prostasin In Complex W | 2e-22 | ||
| 2zpq_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 1 From | 2e-22 | ||
| 2zps_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 3 From | 2e-22 | ||
| 3myw_A | 223 | The Bowman-Birk Type Inhibitor From Mung Bean In Te | 3e-22 | ||
| 1qrz_A | 246 | Catalytic Domain Of Plasminogen Length = 246 | 3e-22 | ||
| 1k9o_E | 223 | Crystal Structure Of Michaelis Serpin-Trypsin Compl | 4e-22 | ||
| 1bui_B | 250 | Structure Of The Ternary Microplasmin-Staphylokinas | 4e-22 | ||
| 3uir_A | 247 | Crystal Structure Of The Plasmin-Textilinin-1 Compl | 5e-22 | ||
| 1bit_A | 237 | The Crystal Structure Of Anionic Salmon Trypsin In | 5e-22 | ||
| 2oq5_A | 232 | Crystal Structure Of Desc1, A New Member Of The Typ | 5e-22 | ||
| 3gov_B | 251 | Crystal Structure Of The Catalytic Region Of Human | 5e-22 | ||
| 1tfx_A | 223 | Complex Of The Second Kunitz Domain Of Tissue Facto | 5e-22 | ||
| 4igd_A | 406 | Crystal Structure Of The Zymogen Catalytic Region O | 6e-22 | ||
| 1dpo_A | 223 | Structure Of Rat Trypsin Length = 223 | 6e-22 | ||
| 1trm_A | 223 | The Three-Dimensional Structure Of Asn102 Mutant Of | 6e-22 | ||
| 3dfj_A | 263 | Crystal Structure Of Human Prostasin Length = 263 | 6e-22 | ||
| 1an1_E | 223 | Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len | 7e-22 | ||
| 3qk1_A | 229 | Crystal Structure Of Enterokinase-Like Trypsin Vari | 7e-22 | ||
| 2wph_S | 235 | Factor Ixa Superactive Triple Mutant Length = 235 | 7e-22 | ||
| 2zpr_A | 222 | Crystal Structure Of Anionic Trypsin Isoform 2 From | 7e-22 | ||
| 2r9p_A | 224 | Human Mesotrypsin Complexed With Bovine Pancreatic | 7e-22 | ||
| 1a0l_A | 244 | Human Beta-Tryptase: A Ring-Like Tetramer With Acti | 8e-22 | ||
| 2bm2_A | 245 | Human Beta-Ii Tryptase In Complex With 4-(3-Aminome | 8e-22 | ||
| 4dg4_A | 224 | Human Mesotrypsin-S39y Complexed With Bovine Pancre | 9e-22 | ||
| 2zeb_A | 243 | Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr | 9e-22 | ||
| 2d8w_A | 223 | Structure Of Hyper-Vil-Trypsin Length = 223 | 9e-22 | ||
| 1slx_B | 223 | Rat Anionic N143h, E151h Trypsin Complexed To A86h | 1e-21 | ||
| 1bml_A | 250 | Complex Of The Catalytic Domain Of Human Plasmin An | 1e-21 | ||
| 2wpm_S | 235 | Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le | 1e-21 | ||
| 1l4d_A | 249 | Crystal Structure Of Microplasminogen-streptokinase | 1e-21 | ||
| 1amh_A | 223 | Uncomplexed Rat Trypsin Mutant With Asp 189 Replace | 1e-21 | ||
| 1l4z_A | 248 | X-Ray Crystal Structure Of The Complex Of Microplas | 1e-21 | ||
| 3p8g_A | 241 | Crystal Structure Of Mt-Sp1 In Complex With Benzami | 1e-21 | ||
| 1eaw_A | 241 | Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A | 1e-21 | ||
| 1ddj_A | 247 | Crystal Structure Of Human Plasminogen Catalytic Do | 1e-21 | ||
| 1slw_B | 223 | Rat Anionic N143h, E151h Trypsin Complexed To A86h | 1e-21 | ||
| 4dur_A | 791 | The X-Ray Crystal Structure Of Full-Length Type Ii | 1e-21 | ||
| 1brb_E | 223 | Crystal Structures Of Rat Anionic Trypsin Complexed | 1e-21 | ||
| 1mct_A | 223 | The Refined 1.6 Angstroms Resolution Crystal Struct | 2e-21 | ||
| 2wpi_S | 235 | Factor Ixa Superactive Double Mutant Length = 235 | 2e-21 | ||
| 2a31_A | 223 | Trypsin In Complex With Borate Length = 223 | 2e-21 | ||
| 1ezs_C | 223 | Crystal Structure Of Ecotin Mutant M84r, W67a, G68a | 2e-21 | ||
| 1spj_A | 238 | Structure Of Mature Human Tissue Kallikrein (Human | 2e-21 | ||
| 1f5r_A | 231 | Rat Trypsinogen Mutant Complexed With Bovine Pancre | 2e-21 | ||
| 2eek_A | 220 | Crystal Structure Of Atlantic Cod Trypsin Complexed | 3e-21 | ||
| 1fy8_E | 231 | Crystal Structure Of The Deltaile16val17 Rat Anioni | 3e-21 | ||
| 1vzq_H | 250 | Complex Of Thrombin With Designed Inhibitor 7165 Le | 3e-21 | ||
| 2bvr_H | 252 | Human Thrombin Complexed With Fragment-based Small | 3e-21 | ||
| 1trn_A | 224 | Crystal Structure Of Human Trypsin 1: Unexpected Ph | 3e-21 | ||
| 1h8d_H | 260 | X-Ray Structure Of The Human Alpha-Thrombin Complex | 4e-21 | ||
| 1h8i_H | 253 | X-Ray Crystal Structure Of Human Alpha-Thrombin Wit | 5e-21 | ||
| 2f9n_A | 245 | Crystal Structure Of The Recombinant Human Alpha I | 5e-21 | ||
| 1rjx_B | 247 | Human Plasminogen Catalytic Domain, K698m Mutant Le | 5e-21 | ||
| 2tbs_A | 222 | Cold-Adaption Of Enzymes: Structural Comparison Bet | 6e-21 | ||
| 1md8_A | 329 | Monomeric Structure Of The Active Catalytic Domain | 6e-21 | ||
| 2ra3_A | 224 | Human Cationic Trypsin Complexed With Bovine Pancre | 7e-21 | ||
| 3f6u_H | 240 | Crystal Structure Of Human Activated Protein C (Apc | 8e-21 | ||
| 1pfx_C | 235 | Porcine Factor Ixa Length = 235 | 8e-21 | ||
| 1aut_C | 250 | Human Activated Protein C Length = 250 | 8e-21 | ||
| 1rfn_A | 235 | Human Coagulation Factor Ixa In Complex With P-Amin | 9e-21 | ||
| 1dst_A | 228 | Mutant Of Factor D With Enhanced Catalytic Activity | 9e-21 | ||
| 1hj9_A | 223 | Atomic Resolution Structures Of Trypsin Provide Ins | 9e-21 | ||
| 3tgk_E | 231 | Trypsinogen Mutant D194n And Deletion Of Ile 16-Val | 9e-21 | ||
| 2xxl_A | 408 | Crystal Structure Of Drosophila Grass Clip Serine P | 1e-20 | ||
| 1fdp_A | 235 | Proenzyme Of Human Complement Factor D, Recombinant | 1e-20 | ||
| 3gic_B | 250 | Structure Of Thrombin Mutant Delta(146-149e) In The | 1e-20 | ||
| 1mh0_A | 287 | Crystal Structure Of The Anticoagulant Slow Form Of | 1e-20 | ||
| 1kig_H | 241 | Bovine Factor Xa Length = 241 | 1e-20 | ||
| 3r3g_B | 259 | Structure Of Human Thrombin With Residues 145-150 O | 1e-20 | ||
| 3bn9_B | 241 | Crystal Structure Of Mt-Sp1 In Complex With Fab Inh | 1e-20 | ||
| 1nm6_A | 287 | Thrombin In Complex With Selective Macrocyclic Inhi | 2e-20 | ||
| 1jwt_A | 305 | Crystal Structure Of Thrombin In Complex With A Nov | 2e-20 | ||
| 1nu9_A | 291 | Staphylocoagulase-prethrombin-2 Complex Length = 29 | 2e-20 | ||
| 1d9i_A | 288 | Structure Of Thrombin Complexed With Selective Non- | 2e-20 | ||
| 1eoj_A | 289 | Design Of P1' And P3' Residues Of Trivalent Thrombi | 2e-20 | ||
| 2bdy_A | 289 | Thrombin In Complex With Inhibitor Length = 289 | 2e-20 | ||
| 1sc8_U | 262 | Urokinase Plasminogen Activator B-Chain-J435 Comple | 2e-20 | ||
| 1d6w_A | 287 | Structure Of Thrombin Complexed With Selective Non- | 2e-20 | ||
| 1hag_E | 295 | The Isomorphous Structures Of Prethrombin2, Hirugen | 2e-20 | ||
| 1md7_A | 328 | Monomeric Structure Of The Zymogen Of Complement Pr | 2e-20 | ||
| 3kcg_H | 235 | Crystal Structure Of The Antithrombin-Factor Ixa- P | 2e-20 | ||
| 2f9o_A | 245 | Crystal Structure Of The Recombinant Human Alpha I | 2e-20 | ||
| 1bth_H | 259 | Structure Of Thrombin Complexed With Bovine Pancrea | 2e-20 | ||
| 1lto_A | 245 | Human Alpha1-Tryptase Length = 245 | 2e-20 | ||
| 3nxp_A | 424 | Crystal Structure Of Human Prethrombin-1 Length = 4 | 2e-20 | ||
| 1gpz_A | 399 | The Crystal Structure Of The Zymogen Catalytic Doma | 3e-20 | ||
| 1mkw_K | 308 | The Co-Crystal Structure Of Unliganded Bovine Alpha | 3e-20 | ||
| 1dm4_B | 260 | Ser195ala Mutant Of Human Thrombin Complexed With F | 3e-20 | ||
| 3sqe_E | 290 | Crystal Structure Of Prethrombin-2 Mutant S195a In | 3e-20 | ||
| 1dan_H | 254 | Complex Of Active Site Inhibited Human Blood Coagul | 3e-20 | ||
| 3k65_B | 308 | Crystal Structure Of Prethombin-2FRAGMENT-2 Complex | 4e-20 | ||
| 4d9q_A | 228 | Inhibiting Alternative Pathway Complement Activatio | 4e-20 | ||
| 2vnt_A | 276 | Urokinase-Type Plasminogen Activator Inhibitor Comp | 4e-20 | ||
| 1dsu_A | 228 | Human Factor D, Complement Activating Enzyme Length | 4e-20 | ||
| 2xwa_A | 228 | Crystal Structure Of Complement Factor D Mutant R20 | 5e-20 | ||
| 2a0q_B | 257 | Structure Of Thrombin In 400 Mm Potassium Chloride | 5e-20 | ||
| 1sfq_B | 259 | Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack | 5e-20 | ||
| 3jz1_B | 259 | Crystal Structure Of Human Thrombin Mutant N143p In | 5e-20 | ||
| 1qur_H | 257 | Human Alpha-Thrombin In Complex With Bivalent, Benz | 6e-20 | ||
| 1gj5_H | 258 | Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 | 6e-20 | ||
| 1rd3_B | 259 | 2.5a Structure Of Anticoagulant Thrombin Variant E2 | 6e-20 | ||
| 1abi_H | 259 | Structure Of The Hirulog 3-Thrombin Complex And Nat | 6e-20 | ||
| 1wbg_B | 259 | Active Site Thrombin Inhibitors Length = 259 | 6e-20 | ||
| 1b7x_B | 259 | Structure Of Human Alpha-Thrombin Y225i Mutant Boun | 6e-20 | ||
| 1twx_B | 259 | Crystal Structure Of The Thrombin Mutant D221aD222K | 6e-20 | ||
| 1tq0_B | 257 | Crystal Structure Of The Potent Anticoagulant Throm | 6e-20 | ||
| 3ig6_B | 253 | Low Molecular Weigth Human Urokinase Type Plasminog | 6e-20 | ||
| 1w0z_U | 247 | Urokinase Type Plasminogen Activator Length = 247 | 6e-20 | ||
| 2thf_B | 259 | Structure Of Human Alpha-thrombin Y225f Mutant Boun | 6e-20 | ||
| 3ee0_B | 259 | Crystal Structure Of The W215aE217A MUTANT OF HUMAN | 6e-20 | ||
| 3mwi_U | 246 | The Complex Crystal Structure Of Urokianse And 5-Ni | 6e-20 | ||
| 1thp_B | 259 | Structure Of Human Alpha-Thrombin Y225p Mutant Boun | 7e-20 | ||
| 1ejn_A | 253 | Urokinase Plasminogen Activator B-Chain Inhibitor C | 7e-20 | ||
| 1a5i_A | 265 | Catalytic Domain Of Vampire Bat (Desmodus Rotundus) | 8e-20 | ||
| 2olg_A | 278 | Crystal Structure Of The Serine Protease Domain Of | 8e-20 | ||
| 1id5_H | 256 | Crystal Structure Of Bovine Thrombin Complex With P | 9e-20 | ||
| 1bbr_K | 259 | The Structure Of Residues 7-16 Of The A Alpha Chain | 9e-20 | ||
| 2cga_A | 245 | Bovine Chymotrypsinogen A. X-Ray Crystal Structure | 9e-20 | ||
| 2xw9_A | 228 | Crystal Structure Of Complement Factor D Mutant S18 | 1e-19 | ||
| 1z8g_A | 372 | Crystal Structure Of The Extracellular Region Of Th | 1e-19 | ||
| 1jou_B | 259 | Crystal Structure Of Native S195a Thrombin With An | 1e-19 | ||
| 3t2n_A | 372 | Human Hepsin Protease In Complex With The Fab Fragm | 1e-19 | ||
| 1fv9_A | 245 | Crystal Structure Of Human Microurokinase In Comple | 1e-19 | ||
| 1lmw_B | 253 | Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A | 1e-19 | ||
| 1owd_A | 245 | Substituted 2-naphthamidine Inhibitors Of Urokinase | 1e-19 | ||
| 1dx5_M | 259 | Crystal Structure Of The Thrombin-Thrombomodulin Co | 1e-19 | ||
| 1ybw_A | 283 | Protease Domain Of Hgfa With No Inhibitor Length = | 1e-19 | ||
| 1ym0_A | 238 | Crystal Structure Of Earthworm Fibrinolytic Enzyme | 2e-19 | ||
| 3edx_B | 258 | Crystal Structure Of The W215aE217A MUTANT OF MURIN | 2e-19 | ||
| 2ocv_B | 259 | Structural Basis Of Na+ Activation Mimicry In Murin | 2e-19 | ||
| 3ela_H | 254 | Crystal Structure Of Active Site Inhibited Coagulat | 2e-19 | ||
| 2gp9_B | 259 | Crystal Structure Of The Slow Form Of Thrombin In A | 2e-19 | ||
| 2tld_E | 220 | Crystal Structure Of An Engineered Subtilisin Inhib | 3e-19 | ||
| 4fu7_A | 246 | Crystal Structure Of The Urokinase Length = 246 | 3e-19 | ||
| 1z8i_B | 259 | Crystal Structure Of The Thrombin Mutant G193a Boun | 3e-19 | ||
| 1gj7_B | 253 | Engineering Inhibitors Highly Selective For The S1 | 3e-19 | ||
| 1owe_A | 245 | Substituted 2-Naphthamidine Inhibitors Of Urokinase | 3e-19 | ||
| 1gi8_B | 245 | A Novel Serine Protease Inhibition Motif Involving | 3e-19 | ||
| 2nwn_A | 253 | New Pharmacophore For Serine Protease Inhibition Re | 3e-19 | ||
| 2pux_B | 258 | Crystal Structure Of Murine Thrombin In Complex Wit | 4e-19 | ||
| 1dlk_B | 230 | Crystal Structure Analysis Of Delta-Chymotrypsin Bo | 4e-19 | ||
| 1o5e_H | 255 | Dissecting And Designing Inhibitor Selectivity Dete | 5e-19 | ||
| 1z8j_B | 259 | Crystal Structure Of The Thrombin Mutant G193p Boun | 5e-19 | ||
| 1vr1_H | 261 | Specifity For Plasminogen Activator Inhibitor-1 Len | 5e-19 | ||
| 2pgb_B | 259 | Inhibitor-Free Human Thrombin Mutant C191a-C220a Le | 6e-19 | ||
| 2b9l_A | 394 | Crystal Structure Of Prophenoloxidase Activating Fa | 6e-19 | ||
| 2o8u_A | 253 | Crystal Structure And Binding Epitopes Of Urokinase | 6e-19 | ||
| 1v2u_T | 223 | Benzamidine In Complex With Bovine Trypsin Varinat | 7e-19 | ||
| 1o5a_B | 253 | Dissecting And Designing Inhibitor Selectivity Dete | 7e-19 | ||
| 1bru_P | 241 | Structure Of Porcine Pancreatic Elastase Complexed | 7e-19 | ||
| 1sgf_G | 237 | Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro | 1e-18 | ||
| 3uqv_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 1e-18 | ||
| 1v2o_T | 223 | Trypsin Inhibitor In Complex With Bovine Trypsin Va | 1e-18 | ||
| 2xrc_A | 565 | Human Complement Factor I Length = 565 | 1e-18 | ||
| 1v2q_T | 223 | Trypsin Inhibitor In Complex With Bovine Trypsin Va | 1e-18 | ||
| 2qy0_B | 242 | Active Dimeric Structure Of The Catalytic Domain Of | 1e-18 | ||
| 1v2j_T | 223 | Benzamidine In Complex With Bovine Trypsin Variant | 1e-18 | ||
| 1v2s_T | 223 | Benzamidine In Complex With Bovine Trypsin Variant | 2e-18 | ||
| 1v2n_T | 223 | Potent Factor Xa Inhibitor In Complex With Bovine T | 2e-18 | ||
| 1euf_A | 227 | Bovine Duodenase(New Serine Protease), Crystal Stru | 2e-18 | ||
| 1v2k_T | 223 | Factor Xa Specific Inhibitor In Complex With Bovine | 2e-18 | ||
| 3pwb_A | 223 | Bovine Trypsin Variant X(Tripleglu217ile227) In Com | 2e-18 | ||
| 3pmj_A | 223 | Bovine Trypsin Variant X(Tripleile227) In Complex W | 2e-18 | ||
| 3uns_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 2e-18 | ||
| 2od3_B | 259 | Human Thrombin Chimera With Human Residues 184a, 18 | 2e-18 | ||
| 3unq_A | 223 | Bovine Trypsin Variant X(Triplephe227) In Complex W | 3e-18 | ||
| 2wub_A | 257 | Crystal Structure Of Hgfa In Complex With The Allos | 3e-18 | ||
| 2r0l_A | 248 | Short Form Hgfa With Inhibitory Fab75 Length = 248 | 3e-18 | ||
| 1elv_A | 333 | Crystal Structure Of The Catalytic Domain Of Human | 3e-18 | ||
| 2psx_A | 227 | Crystal Structure Of Human Kallikrein 5 In Complex | 5e-18 | ||
| 3plk_A | 223 | Bovine Trypsin Variant X(Tripleile227) In Complex W | 5e-18 | ||
| 1npm_A | 225 | Neuropsin, A Serine Protease Expressed In The Limbi | 5e-18 | ||
| 4b1t_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 5e-18 | ||
| 4b2a_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 5e-18 | ||
| 4b2c_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 5e-18 | ||
| 4b2b_A | 223 | Structure Of The Factor Xa-Like Trypsin Variant Tri | 5e-18 | ||
| 1h9h_E | 231 | Complex Of Eeti-Ii With Porcine Trypsin Length = 23 | 7e-18 | ||
| 3uwi_A | 223 | Bovine Trypsin Variant X(Tripleglu217phe227) In Com | 8e-18 | ||
| 3v0x_A | 223 | Bovine Trypsin Variant X(Tripleglu217phe227) In Com | 9e-18 | ||
| 1elt_A | 236 | Structure Of Native Pancreatic Elastase From North | 1e-17 | ||
| 1mza_A | 240 | Crystal Structure Of Human Pro-Granzyme K Length = | 2e-17 | ||
| 1q3x_A | 328 | Crystal Structure Of The Catalytic Region Of Human | 6e-17 | ||
| 1bda_A | 265 | Catalytic Domain Of Human Single Chain Tissue Plasm | 7e-17 | ||
| 1eai_A | 240 | Complex Of Ascaris Chymotrpsin/elastase Inhibitor W | 8e-17 | ||
| 1l2e_A | 223 | Human Kallikrein 6 (Hk6) Active Form With Benzamidi | 8e-17 | ||
| 1sgf_A | 240 | Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro | 9e-17 | ||
| 1hax_B | 240 | Snapshots Of Serine Protease Catalysis: (A) Acyl-En | 1e-16 | ||
| 1fiz_A | 263 | Three Dimensional Structure Of Beta-Acrosin From Bo | 1e-16 | ||
| 2est_E | 240 | Crystallographic Study Of The Binding Of A Trifluor | 1e-16 | ||
| 1gvl_A | 223 | Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P | 2e-16 | ||
| 4h4f_A | 249 | Crystal Structure Of Human Chymotrypsin C (ctrc) Bo | 2e-16 | ||
| 3i78_A | 229 | 3599170186220-Loops Of Fxa In Sgt Length = 229 | 2e-16 | ||
| 1pyt_D | 251 | Ternary Complex Of Procarboxypeptidase A, Proprotei | 2e-16 | ||
| 1zjk_A | 403 | Crystal Structure Of The Zymogen Catalytic Region O | 4e-16 | ||
| 3beu_A | 224 | Na+-Dependent Allostery Mediates Coagulation Factor | 5e-16 | ||
| 3tvj_B | 242 | Catalytic Fragment Of Masp-2 In Complex With Its Sp | 5e-16 | ||
| 1fiw_A | 290 | Three-Dimensional Structure Of Beta-Acrosin From Ra | 6e-16 | ||
| 1fq3_A | 227 | Crystal Structure Of Human Granzyme B Length = 227 | 6e-16 | ||
| 1rtf_B | 252 | Complex Of Benzamidine With The Catalytic Domain Of | 7e-16 | ||
| 1ton_A | 235 | Rat Submaxillary Gland Serine Protease, Tonin. Stru | 8e-16 | ||
| 1iau_A | 227 | Human Granzyme B In Complex With Ac-Iepd-Cho Length | 9e-16 | ||
| 3rp2_A | 224 | The Structure Of Rat Mast Cell Protease Ii At 1.9-A | 9e-16 | ||
| 4d8n_A | 223 | Human Kallikrein 6 Inhibitors With A Para-Amidobenz | 9e-16 | ||
| 4fxg_H | 242 | Complement C4 In Complex With Masp-2 Length = 242 | 1e-15 | ||
| 3i77_A | 230 | 3599170-Loops Of Fxa In Sgt Length = 230 | 1e-15 | ||
| 1azz_A | 226 | Fiddler Crab Collagenase Complexed To Ecotin Length | 3e-15 | ||
| 2zgc_A | 240 | Crystal Structure Of Active Human Granzyme M Length | 3e-15 | ||
| 3g01_A | 227 | Structure Of Grc Mutant E192rE193G Length = 227 | 5e-15 | ||
| 1fi8_A | 228 | Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie | 8e-15 | ||
| 1orf_A | 234 | The Oligomeric Structure Of Human Granzyme A Reveal | 9e-15 | ||
| 4gaw_A | 226 | Crystal Structure Of Active Human Granzyme H Length | 1e-14 | ||
| 2zgj_A | 240 | Crystal Structure Of D86n-gzmm Complexed With Its O | 1e-14 | ||
| 2fmj_A | 222 | 220-Loop Mutant Of Streptomyces Griseus Trypsin Len | 1e-14 | ||
| 2qxg_A | 224 | Crystal Structure Of Human Kallikrein 7 In Complex | 1e-14 | ||
| 3bsq_A | 227 | Crystal Structure Of Human Kallikrein 7 Produced As | 2e-14 | ||
| 1ao5_A | 237 | Mouse Glandular Kallikrein-13 (Prorenin Converting | 3e-14 | ||
| 2zch_P | 237 | Crystal Structure Of Human Prostate Specific Antige | 3e-14 | ||
| 1op8_A | 234 | Crystal Structure Of Human Granzyme A Length = 234 | 4e-14 | ||
| 3tju_A | 226 | Crystal Structure Of Human Granzyme H With An Inhib | 4e-14 | ||
| 3fzz_A | 227 | Structure Of Grc Length = 227 | 4e-14 | ||
| 1pyt_C | 253 | Ternary Complex Of Procarboxypeptidase A, Proprotei | 1e-13 | ||
| 1au8_A | 224 | Human Cathepsin G Length = 224 | 2e-13 | ||
| 1os8_A | 223 | Recombinant Streptomyces Griseus Trypsin Length = 2 | 2e-13 | ||
| 1kyn_B | 235 | Cathepsin-G Length = 235 | 2e-13 | ||
| 1sgt_A | 223 | Refined Crystal Structure Of Streptomyces Griseus T | 2e-13 | ||
| 1eq9_A | 222 | Crystal Structure Of Fire Ant Chymotrypsin Complexe | 4e-13 | ||
| 1oss_A | 223 | T190p Streptomyces Griseus Trypsin In Complex With | 5e-13 | ||
| 1m9u_A | 241 | Crystal Structure Of Earthworm Fibrinolytic Enzyme | 5e-13 | ||
| 1klt_A | 226 | Crystal Structure Of Pmsf-Treated Human Chymase At | 7e-13 | ||
| 3s9a_A | 234 | Russell's Viper Venom Serine Proteinase, Rvv-V (Clo | 9e-13 | ||
| 1nn6_A | 228 | Human Pro-Chymase Length = 228 | 1e-12 | ||
| 3n7o_A | 226 | X-Ray Structure Of Human Chymase In Complex With Sm | 1e-12 | ||
| 4afq_A | 226 | Human Chymase - Fynomer Complex Length = 226 | 1e-12 | ||
| 4gso_A | 232 | Structure Of Jararacussin-I Length = 232 | 2e-12 | ||
| 1fon_A | 240 | Crystal Structure Of Bovine Procarboxypeptidase A-S | 3e-12 | ||
| 1pjp_A | 226 | The 2.2 A Crystal Structure Of Human Chymase In Com | 3e-12 | ||
| 1gvz_A | 237 | Prostate Specific Antigen (Psa) From Stallion Semin | 7e-12 | ||
| 2bdg_A | 223 | Human Kallikrein 4 Complex With Nickel And P-aminob | 9e-12 | ||
| 2aip_A | 231 | Crystal Structure Of Native Protein C Activator Fro | 5e-11 | ||
| 2jet_B | 128 | Crystal Structure Of A Trypsin-Like Mutant (S189d, | 6e-11 | ||
| 1fy3_A | 225 | [g175q]hbp, A Mutant Of Human Heparin Binding Prote | 7e-11 | ||
| 1bqy_A | 234 | Plasminogen Activator (tsv-pa) From Snake Venom Len | 8e-11 | ||
| 1a7s_A | 225 | Atomic Resolution Structure Of Hbp Length = 225 | 8e-11 | ||
| 4e7n_A | 238 | Crystal Structure Of Ahv_tl-I, A Glycosylated Snake | 1e-10 | ||
| 1bhx_B | 147 | X-Ray Structure Of The Complex Of Human Alpha Throm | 1e-10 | ||
| 1mtn_B | 131 | Bovine Alpha-Chymotrypsin:bpti Crystallization Leng | 3e-10 | ||
| 1kdq_A | 131 | Crystal Structure Analysis Of The Mutant S189d Rat | 6e-10 | ||
| 1op0_A | 234 | Crystal Structure Of Aav-sp-i, A Glycosylated Snake | 7e-10 | ||
| 1bbr_H | 150 | The Structure Of Residues 7-16 Of The A Alpha Chain | 8e-10 | ||
| 1fy1_A | 225 | [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P | 8e-10 | ||
| 1op2_A | 234 | Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak | 1e-09 | ||
| 1hne_E | 218 | Structure Of Human Neutrophil Elastase In Complex W | 2e-09 | ||
| 1ppg_E | 218 | The Refined 2.3 Angstroms Crystal Structure Of Huma | 3e-09 | ||
| 1ppf_E | 218 | X-Ray Crystal Structure Of The Complex Of Human Leu | 3e-09 | ||
| 4f4o_C | 347 | Structure Of The Haptoglobin-Haemoglobin Complex Le | 4e-09 | ||
| 3s69_A | 234 | Crystal Structure Of Saxthrombin Length = 234 | 4e-09 | ||
| 1b0f_A | 218 | Crystal Structure Of Human Neutrophil Elastase With | 5e-09 | ||
| 1fuj_A | 221 | Pr3 (Myeloblastin) Length = 221 | 7e-09 | ||
| 2rg3_A | 218 | Covalent Complex Structure Of Elastase Length = 218 | 8e-09 | ||
| 1aks_A | 125 | Crystal Structure Of The First Active Autolysate Fo | 9e-09 | ||
| 2rdl_A | 226 | Hamster Chymase 2 Length = 226 | 1e-08 | ||
| 1uhb_B | 98 | Crystal Structure Of Porcine Alpha Trypsin Bound Wi | 2e-08 | ||
| 1uhb_B | 98 | Crystal Structure Of Porcine Alpha Trypsin Bound Wi | 2e-08 | ||
| 3h7t_A | 235 | Crystal Structure Of Scabies Mite Inactivated Prote | 2e-08 | ||
| 1si5_H | 240 | Protease-Like Domain From 2-Chain Hepatocyte Growth | 5e-08 | ||
| 1shy_A | 234 | The Crystal Structure Of Hgf Beta-Chain In Complex | 5e-08 | ||
| 1ept_C | 98 | Refined 1.8 Angstroms Resolution Crystal Structure | 6e-08 | ||
| 1ept_C | 98 | Refined 1.8 Angstroms Resolution Crystal Structure | 6e-08 | ||
| 2ok5_A | 752 | Human Complement Factor B Length = 752 | 1e-07 | ||
| 2xwb_F | 732 | Crystal Structure Of Complement C3b In Complex With | 1e-07 | ||
| 3hrz_D | 741 | Cobra Venom Factor (Cvf) In Complex With Human Fact | 1e-07 | ||
| 1rrk_A | 497 | Crystal Structure Analysis Of The Bb Segment Of Fac | 1e-07 | ||
| 2win_I | 507 | C3 Convertase (C3bbb) Stabilized By Scin Length = 5 | 1e-07 | ||
| 1dle_A | 298 | Factor B Serine Protease Domain Length = 298 | 1e-07 | ||
| 3h7o_A | 228 | Crystal Structure Of Scabies Mite Inactivated Prote | 5e-07 | ||
| 1bbr_E | 109 | The Structure Of Residues 7-16 Of The A Alpha Chain | 7e-07 | ||
| 1hyl_A | 230 | The 1.8 A Structure Of Collagenase From Hypoderma L | 1e-06 | ||
| 2pks_C | 102 | Thrombin In Complex With Inhibitor Length = 102 | 1e-06 | ||
| 2pks_C | 102 | Thrombin In Complex With Inhibitor Length = 102 | 1e-06 | ||
| 2hnt_F | 105 | Crystallographic Structure Of Human Gamma-Thrombin | 1e-06 | ||
| 2hnt_F | 105 | Crystallographic Structure Of Human Gamma-Thrombin | 1e-06 | ||
| 2kai_B | 152 | Refined 2.5 Angstroms X-Ray Crystal Structure Of Th | 2e-06 | ||
| 2kai_B | 152 | Refined 2.5 Angstroms X-Ray Crystal Structure Of Th | 1e-05 | ||
| 1kdq_B | 99 | Crystal Structure Analysis Of The Mutant S189d Rat | 2e-05 | ||
| 1kdq_B | 99 | Crystal Structure Analysis Of The Mutant S189d Rat | 2e-05 | ||
| 2kai_A | 80 | Refined 2.5 Angstroms X-Ray Crystal Structure Of Th | 2e-05 | ||
| 2jet_C | 99 | Crystal Structure Of A Trypsin-Like Mutant (S189d, | 2e-05 | ||
| 2jet_C | 99 | Crystal Structure Of A Trypsin-Like Mutant (S189d, | 2e-05 | ||
| 2i6q_A | 517 | Complement Component C2a Length = 517 | 2e-05 | ||
| 2odp_A | 509 | Complement Component C2a, The Catalytic Fragment Of | 2e-05 | ||
| 1afq_C | 96 | Crystal Structure Of Bovine Gamma-Chymotrypsin Comp | 2e-04 | ||
| 1afq_C | 96 | Crystal Structure Of Bovine Gamma-Chymotrypsin Comp | 2e-04 | ||
| 1mtn_C | 97 | Bovine Alpha-Chymotrypsin:bpti Crystallization Leng | 2e-04 | ||
| 1mtn_C | 97 | Bovine Alpha-Chymotrypsin:bpti Crystallization Leng | 2e-04 | ||
| 3h5c_B | 317 | X-Ray Structure Of Protein Z-Protein Z Inhibitor Co | 3e-04 | ||
| 2hnt_C | 70 | Crystallographic Structure Of Human Gamma-Thrombin | 3e-04 | ||
| 3f1s_B | 283 | Crystal Structure Of Protein Z Complexed With Prote | 4e-04 |
| >pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 | Back alignment and structure |
|
| >pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 | Back alignment and structure |
| >pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 | Back alignment and structure |
| >pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 | Back alignment and structure |
| >pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 | Back alignment and structure |
| >pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 | Back alignment and structure |
| >pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 | Back alignment and structure |
| >pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 | Back alignment and structure |
| >pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 | Back alignment and structure |
| >pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 | Back alignment and structure |
| >pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 | Back alignment and structure |
| >pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 | Back alignment and structure |
| >pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 | Back alignment and structure |
| >pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 | Back alignment and structure |
| >pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 | Back alignment and structure |
| >pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 | Back alignment and structure |
| >pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 | Back alignment and structure |
| >pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 | Back alignment and structure |
| >pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 | Back alignment and structure |
| >pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 | Back alignment and structure |
| >pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 | Back alignment and structure |
| >pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 | Back alignment and structure |
| >pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 | Back alignment and structure |
| >pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 | Back alignment and structure |
| >pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 | Back alignment and structure |
| >pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 | Back alignment and structure |
| >pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 | Back alignment and structure |
| >pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 | Back alignment and structure |
| >pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 | Back alignment and structure |
| >pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 | Back alignment and structure |
| >pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 | Back alignment and structure |
| >pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 | Back alignment and structure |
| >pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 | Back alignment and structure |
| >pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 | Back alignment and structure |
| >pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 | Back alignment and structure |
| >pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 | Back alignment and structure |
| >pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 | Back alignment and structure |
| >pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 | Back alignment and structure |
| >pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 | Back alignment and structure |
| >pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 | Back alignment and structure |
| >pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 | Back alignment and structure |
| >pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 | Back alignment and structure |
| >pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 | Back alignment and structure |
| >pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 | Back alignment and structure |
| >pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 | Back alignment and structure |
| >pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 | Back alignment and structure |
| >pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 | Back alignment and structure |
| >pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 | Back alignment and structure |
| >pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 | Back alignment and structure |
| >pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 | Back alignment and structure |
| >pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 | Back alignment and structure |
| >pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 | Back alignment and structure |
| >pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 | Back alignment and structure |
| >pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 | Back alignment and structure |
| >pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 | Back alignment and structure |
| >pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 | Back alignment and structure |
| >pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 | Back alignment and structure |
| >pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 | Back alignment and structure |
| >pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 | Back alignment and structure |
| >pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 | Back alignment and structure |
| >pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 | Back alignment and structure |
| >pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 | Back alignment and structure |
| >pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 | Back alignment and structure |
| >pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 | Back alignment and structure |
| >pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 | Back alignment and structure |
| >pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 | Back alignment and structure |
| >pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 | Back alignment and structure |
| >pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 | Back alignment and structure |
| >pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 | Back alignment and structure |
| >pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 | Back alignment and structure |
| >pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 | Back alignment and structure |
| >pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 | Back alignment and structure |
| >pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 | Back alignment and structure |
| >pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 | Back alignment and structure |
| >pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 | Back alignment and structure |
| >pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 | Back alignment and structure |
| >pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 | Back alignment and structure |
| >pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 | Back alignment and structure |
| >pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 | Back alignment and structure |
| >pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 | Back alignment and structure |
| >pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 | Back alignment and structure |
| >pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 | Back alignment and structure |
| >pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 | Back alignment and structure |
| >pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 | Back alignment and structure |
| >pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 | Back alignment and structure |
| >pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 | Back alignment and structure |
| >pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 | Back alignment and structure |
| >pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 | Back alignment and structure |
| >pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 | Back alignment and structure |
| >pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 | Back alignment and structure |
| >pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 | Back alignment and structure |
| >pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 | Back alignment and structure |
| >pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 | Back alignment and structure |
| >pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 | Back alignment and structure |
| >pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 | Back alignment and structure |
| >pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 | Back alignment and structure |
| >pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 | Back alignment and structure |
| >pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 | Back alignment and structure |
| >pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 | Back alignment and structure |
| >pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 | Back alignment and structure |
| >pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 | Back alignment and structure |
| >pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 | Back alignment and structure |
| >pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 | Back alignment and structure |
| >pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 | Back alignment and structure |
| >pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 | Back alignment and structure |
| >pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 | Back alignment and structure |
| >pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 | Back alignment and structure |
| >pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 | Back alignment and structure |
| >pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 | Back alignment and structure |
| >pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 | Back alignment and structure |
| >pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 | Back alignment and structure |
| >pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 | Back alignment and structure |
| >pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 | Back alignment and structure |
| >pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 | Back alignment and structure |
| >pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 | Back alignment and structure |
| >pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 | Back alignment and structure |
| >pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 | Back alignment and structure |
| >pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 | Back alignment and structure |
| >pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 | Back alignment and structure |
| >pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 | Back alignment and structure |
| >pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 | Back alignment and structure |
| >pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 | Back alignment and structure |
| >pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 | Back alignment and structure |
| >pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 | Back alignment and structure |
| >pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 | Back alignment and structure |
| >pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 | Back alignment and structure |
| >pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 | Back alignment and structure |
| >pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 | Back alignment and structure |
| >pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 | Back alignment and structure |
| >pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 | Back alignment and structure |
| >pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 | Back alignment and structure |
| >pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 | Back alignment and structure |
| >pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 | Back alignment and structure |
| >pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 | Back alignment and structure |
| >pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 | Back alignment and structure |
| >pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 | Back alignment and structure |
| >pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 | Back alignment and structure |
| >pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 | Back alignment and structure |
| >pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 | Back alignment and structure |
| >pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 | Back alignment and structure |
| >pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 | Back alignment and structure |
| >pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 | Back alignment and structure |
| >pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 | Back alignment and structure |
| >pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 | Back alignment and structure |
| >pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 | Back alignment and structure |
| >pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 | Back alignment and structure |
| >pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 | Back alignment and structure |
| >pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 | Back alignment and structure |
| >pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 | Back alignment and structure |
| >pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 | Back alignment and structure |
| >pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 | Back alignment and structure |
| >pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 | Back alignment and structure |
| >pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 | Back alignment and structure |
| >pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 | Back alignment and structure |
| >pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 | Back alignment and structure |
| >pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 | Back alignment and structure |
| >pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 | Back alignment and structure |
| >pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 | Back alignment and structure |
| >pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 | Back alignment and structure |
| >pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 | Back alignment and structure |
| >pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 | Back alignment and structure |
| >pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 | Back alignment and structure |
| >pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 | Back alignment and structure |
| >pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 | Back alignment and structure |
| >pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 | Back alignment and structure |
| >pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 | Back alignment and structure |
| >pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 | Back alignment and structure |
| >pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 | Back alignment and structure |
| >pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 | Back alignment and structure |
| >pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 | Back alignment and structure |
| >pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 | Back alignment and structure |
| >pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 | Back alignment and structure |
| >pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 | Back alignment and structure |
| >pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 | Back alignment and structure |
| >pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 | Back alignment and structure |
| >pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 | Back alignment and structure |
| >pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 | Back alignment and structure |
| >pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 | Back alignment and structure |
| >pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 | Back alignment and structure |
| >pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 | Back alignment and structure |
| >pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 | Back alignment and structure |
| >pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 | Back alignment and structure |
| >pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 | Back alignment and structure |
| >pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 | Back alignment and structure |
| >pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 | Back alignment and structure |
| >pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 | Back alignment and structure |
| >pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 | Back alignment and structure |
| >pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 | Back alignment and structure |
| >pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 | Back alignment and structure |
| >pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 | Back alignment and structure |
| >pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 | Back alignment and structure |
| >pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 | Back alignment and structure |
| >pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 | Back alignment and structure |
| >pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 | Back alignment and structure |
| >pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 | Back alignment and structure |
| >pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 | Back alignment and structure |
| >pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 | Back alignment and structure |
| >pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 | Back alignment and structure |
| >pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 | Back alignment and structure |
| >pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 | Back alignment and structure |
| >pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 | Back alignment and structure |
| >pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 | Back alignment and structure |
| >pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 | Back alignment and structure |
| >pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 | Back alignment and structure |
| >pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 | Back alignment and structure |
| >pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 | Back alignment and structure |
| >pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 | Back alignment and structure |
| >pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 | Back alignment and structure |
| >pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 | Back alignment and structure |
| >pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 | Back alignment and structure |
| >pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 | Back alignment and structure |
| >pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 | Back alignment and structure |
| >pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 | Back alignment and structure |
| >pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 | Back alignment and structure |
| >pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 | Back alignment and structure |
| >pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 | Back alignment and structure |
| >pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 | Back alignment and structure |
| >pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 | Back alignment and structure |
| >pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 | Back alignment and structure |
| >pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 | Back alignment and structure |
| >pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 | Back alignment and structure |
| >pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 | Back alignment and structure |
| >pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 | Back alignment and structure |
| >pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 | Back alignment and structure |
| >pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 | Back alignment and structure |
| >pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 | Back alignment and structure |
| >pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 | Back alignment and structure |
| >pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 | Back alignment and structure |
| >pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 | Back alignment and structure |
| >pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 | Back alignment and structure |
| >pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 | Back alignment and structure |
| >pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 | Back alignment and structure |
| >pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 | Back alignment and structure |
| >pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 | Back alignment and structure |
| >pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 | Back alignment and structure |
| >pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 | Back alignment and structure |
| >pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 | Back alignment and structure |
| >pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 | Back alignment and structure |
| >pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 | Back alignment and structure |
| >pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 | Back alignment and structure |
| >pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 | Back alignment and structure |
| >pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 | Back alignment and structure |
| >pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 | Back alignment and structure |
| >pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 | Back alignment and structure |
| >pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 | Back alignment and structure |
| >pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 | Back alignment and structure |
| >pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 | Back alignment and structure |
| >pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 | Back alignment and structure |
| >pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 | Back alignment and structure |
| >pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 | Back alignment and structure |
| >pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 | Back alignment and structure |
| >pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 | Back alignment and structure |
| >pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 | Back alignment and structure |
| >pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 | Back alignment and structure |
| >pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 | Back alignment and structure |
| >pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 | Back alignment and structure |
| >pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 | Back alignment and structure |
| >pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 | Back alignment and structure |
| >pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 | Back alignment and structure |
| >pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 | Back alignment and structure |
| >pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 | Back alignment and structure |
| >pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 | Back alignment and structure |
| >pdb|1KYN|B Chain B, Cathepsin-G Length = 235 | Back alignment and structure |
| >pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 | Back alignment and structure |
| >pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 | Back alignment and structure |
| >pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 | Back alignment and structure |
| >pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 | Back alignment and structure |
| >pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 | Back alignment and structure |
| >pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 | Back alignment and structure |
| >pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 | Back alignment and structure |
| >pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 | Back alignment and structure |
| >pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 | Back alignment and structure |
| >pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 | Back alignment and structure |
| >pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 | Back alignment and structure |
| >pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 | Back alignment and structure |
| >pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 | Back alignment and structure |
| >pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 | Back alignment and structure |
| >pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 | Back alignment and structure |
| >pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 | Back alignment and structure |
| >pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 | Back alignment and structure |
| >pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 | Back alignment and structure |
| >pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 | Back alignment and structure |
| >pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 | Back alignment and structure |
| >pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 | Back alignment and structure |
| >pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 | Back alignment and structure |
| >pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 | Back alignment and structure |
| >pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 | Back alignment and structure |
| >pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 | Back alignment and structure |
| >pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 | Back alignment and structure |
| >pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 | Back alignment and structure |
| >pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 | Back alignment and structure |
| >pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 | Back alignment and structure |
| >pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 | Back alignment and structure |
| >pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 | Back alignment and structure |
| >pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 | Back alignment and structure |
| >pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 | Back alignment and structure |
| >pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 | Back alignment and structure |
| >pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 | Back alignment and structure |
| >pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 | Back alignment and structure |
| >pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 | Back alignment and structure |
| >pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 | Back alignment and structure |
| >pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 | Back alignment and structure |
| >pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 | Back alignment and structure |
| >pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 | Back alignment and structure |
| >pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 | Back alignment and structure |
| >pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 | Back alignment and structure |
| >pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 | Back alignment and structure |
| >pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 | Back alignment and structure |
| >pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 | Back alignment and structure |
| >pdb|1RRK|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Length = 497 | Back alignment and structure |
| >pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 | Back alignment and structure |
| >pdb|1DLE|A Chain A, Factor B Serine Protease Domain Length = 298 | Back alignment and structure |
| >pdb|3H7O|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-I1 (Smipp-S-I1) Length = 228 | Back alignment and structure |
| >pdb|1BBR|E Chain E, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 109 | Back alignment and structure |
| >pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 | Back alignment and structure |
| >pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 | Back alignment and structure |
| >pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 | Back alignment and structure |
| >pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 | Back alignment and structure |
| >pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 | Back alignment and structure |
| >pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 | Back alignment and structure |
| >pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 | Back alignment and structure |
| >pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 | Back alignment and structure |
| >pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 | Back alignment and structure |
| >pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 | Back alignment and structure |
| >pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 | Back alignment and structure |
| >pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 | Back alignment and structure |
| >pdb|2I6Q|A Chain A, Complement Component C2a Length = 517 | Back alignment and structure |
| >pdb|2ODP|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5- Convertase Of Human Complement Length = 509 | Back alignment and structure |
| >pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 | Back alignment and structure |
| >pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 | Back alignment and structure |
| >pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 | Back alignment and structure |
| >pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 | Back alignment and structure |
| >pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 | Back alignment and structure |
| >pdb|2HNT|C Chain C, Crystallographic Structure Of Human Gamma-Thrombin Length = 70 | Back alignment and structure |
| >pdb|3F1S|B Chain B, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 283 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 | Back alignment and structure |
|---|
Score = 238 bits (610), Expect = 6e-79
Identities = 65/194 (33%), Positives = 101/194 (52%), Gaps = 21/194 (10%)
Query: 101 IVGGNVTKLHEFPWIAALTKKGKFYCGATLIAKRHVLTAAHCIEG--VNPKEIKVTLGEH 158
IVGG+ K +PW+ L + CGA+L++ +++AAHC+ G + P + LG H
Sbjct: 1 IVGGSDAKEGAWPWVVGLYYDDRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAILGLH 60
Query: 159 DRLSKNESVPVIIRKVKRAIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLPGNS- 217
+ S S + R + + +P ++ +NDIA++ +E V++ I P LP +
Sbjct: 61 MK-SNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNY-TDYIQPISLPEENQ 118
Query: 218 ---------------LDERKPTANSLRKVEVPILSEEECKSAGYSASRITNNMLCAGYAE 262
+ + TA+ L++ +VP+LS E C+ IT NM+CAGY E
Sbjct: 119 VFPPGRNCSIAGWGTVVYQGTTADILQEADVPLLSNERCQQQ-MPEYNITENMICAGYEE 177
Query: 263 GKRDSCQGDSGGPL 276
G DSCQGDSGGPL
Sbjct: 178 GGIDSCQGDSGGPL 191
|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Length = 268 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 302 | |||
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 100.0 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 100.0 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 100.0 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 100.0 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 100.0 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 100.0 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 100.0 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 100.0 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 100.0 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 100.0 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 100.0 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 100.0 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 100.0 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 100.0 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 100.0 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 100.0 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 100.0 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 100.0 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 100.0 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 100.0 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 100.0 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 100.0 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 100.0 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 100.0 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 100.0 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 100.0 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 100.0 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 100.0 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 100.0 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 100.0 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 100.0 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 100.0 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 100.0 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 100.0 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 100.0 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 100.0 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 100.0 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 100.0 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 100.0 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 100.0 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 100.0 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 100.0 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 100.0 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 100.0 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 100.0 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 100.0 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 100.0 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 100.0 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 100.0 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 100.0 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 100.0 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 100.0 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 100.0 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 100.0 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 100.0 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 100.0 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 100.0 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 100.0 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 100.0 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 100.0 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 100.0 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 100.0 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 100.0 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 100.0 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 100.0 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 100.0 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 100.0 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 100.0 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 100.0 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 100.0 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 100.0 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 100.0 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 100.0 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 100.0 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 100.0 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 100.0 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 100.0 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 100.0 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 100.0 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 100.0 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 100.0 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 100.0 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 100.0 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 100.0 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 100.0 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 100.0 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 100.0 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 100.0 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 100.0 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 100.0 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 100.0 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 100.0 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.97 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 99.97 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.96 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 99.92 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.91 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.91 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.9 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 99.9 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.9 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.89 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.88 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.87 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 99.86 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 99.75 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.71 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.68 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.67 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.67 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.67 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.67 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.67 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.66 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.66 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.65 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.65 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.65 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.65 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.65 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.65 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.65 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.65 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.65 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.64 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.64 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.64 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.64 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.64 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.64 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.63 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.63 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.63 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.63 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.63 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.63 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.63 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.63 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.63 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.63 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.63 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.63 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.63 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.62 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.62 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 99.62 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.62 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.62 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.62 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.62 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.62 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.62 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.62 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.62 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.61 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.61 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.61 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.61 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.6 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.6 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.6 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.6 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.6 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.6 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.6 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.59 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.59 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.59 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.59 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.58 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.58 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.58 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 99.58 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.58 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.58 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.57 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 99.57 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.57 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.57 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.56 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 99.56 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.56 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.56 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.55 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 99.55 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 99.54 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.54 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.53 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 99.53 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 99.53 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.53 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.52 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.51 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 99.51 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.48 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.48 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.48 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.48 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 99.47 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.46 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.45 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.4 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.4 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.39 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.38 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.37 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.36 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.32 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.29 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 99.16 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.11 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.09 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.08 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.03 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.92 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 98.84 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 98.81 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.81 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 98.8 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.67 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 98.57 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 98.44 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 98.27 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 98.17 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 98.15 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 98.03 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 97.81 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 97.69 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 97.66 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 97.62 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.56 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 97.54 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 97.21 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 97.21 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 97.05 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 95.93 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 95.9 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 95.78 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 95.52 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 95.24 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 95.01 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 94.06 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 93.14 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 90.83 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 90.64 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 89.74 | |
| 3h09_A | 989 | IGA1 protease, immunoglobulin A1 protease; serine | 89.31 | |
| 3syj_A | 1011 | Adhesion and penetration protein autotransporter; | 89.24 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 89.08 | |
| 3sze_A | 968 | Serine protease ESPP; parallel beta-helix, hydrola | 88.04 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 86.07 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 85.87 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 84.86 |
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-43 Score=302.86 Aligned_cols=195 Identities=31% Similarity=0.526 Sum_probs=158.4
Q ss_pred ecCCeecccccchhHHhhhcc------CeeeeeEEEeeCCEEEecccccCCC-CCceEEEEEcccccccCCC---CCceE
Q psy8651 101 IVGGNVTKLHEFPWIAALTKK------GKFYCGATLIAKRHVLTAAHCIEGV-NPKEIKVTLGEHDRLSKNE---SVPVI 170 (302)
Q Consensus 101 i~~g~~~~~~~~pwi~~l~~~------~~~~C~GsLI~~~~VLTaAhC~~~~-~~~~~~v~~g~~~~~~~~~---~~~~~ 170 (302)
|++|..+..++|||++.+... ..++|+|+||+++||||||||+... ....+.|++|.++...... ....+
T Consensus 1 IvgG~~a~~~~~Pw~v~l~~~~~~~~~~~~~CgGsLIs~~~VLTAAHC~~~~~~~~~~~v~~G~~~~~~~~~~~~~~~~~ 80 (290)
T 1fiw_A 1 IIGGQDAAHGAWPWMVSLQIFTYHNNRRYHVCGGSLLNSQWLLTAAHCFRIKKKVTDWRLIFGAKEVEWGTNKPVKPPLQ 80 (290)
T ss_dssp CBSCEECCTTSSTTEEEEEEEETTTTEEEEEEEEEEEETTEEEECGGGGSSCCSGGGEEEEESCSBCCTTCCSCCCTTCE
T ss_pred CCCCEECCCCCCCcEEEEEEeccCCCccceEEEEEEeeCCEEEECHHhCCCCCCCcceEEEecceEEeccCCCcCCCCce
Confidence 578999999999999998641 3589999999999999999999643 3457899999887642221 12357
Q ss_pred EEeEeEEEeCCCCCCCCCCCCeEEEEEcCCCcCCCCceeeeeeCCCCCC-----------------CC-CccCcCceEEE
Q psy8651 171 IRKVKRAIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLPGNSLD-----------------ER-KPTANSLRKVE 232 (302)
Q Consensus 171 ~~~v~~i~~hp~y~~~~~~~DiALl~L~~~~~~~~~~v~picl~~~~~~-----------------~~-~~~~~~l~~~~ 232 (302)
.+.|+++++||+|+.....||||||||++|+.|++ +|+|||||..... .. ...+..|+++.
T Consensus 81 ~~~V~~i~~Hp~y~~~~~~nDIALl~L~~~v~~~~-~v~PicLp~~~~~~~~~~~~~~v~GWG~~~~~~~~~~~~L~~~~ 159 (290)
T 1fiw_A 81 ERYVEKIIIHEKYSASSEANDIALMKITPPVTCGH-FIGPGCLPQFRAGPPRVPQTCWVAGWGFLQENARRTSPMLQEAR 159 (290)
T ss_dssp EEEEEEEEECTTCBTTTTBTCCEEEEEESCCCCBT-TBCCCBCCCTTCCSCCSSCEEEEEESCCSSTTCSSCCSBCEEEE
T ss_pred EEEEEEEEECCCCCCCCCCCCEEEEEECCccccCC-ccccccCCCccccCcCCCCeEEEEEeccCCCCCCCCCceeeEEE
Confidence 88999999999999989999999999999999998 9999999964321 01 12356799999
Q ss_pred eeeeCHHhHhccCCCCCCCCCCeEEeeeCCCCCCCCCCCCCCceEEEecCCCceeEEEEEEeeeee
Q psy8651 233 VPILSEEECKSAGYSASRITNNMLCAGYAEGKRDSCQGDSGGPLQIAVARPGKMEATLSKVVSRVQ 298 (302)
Q Consensus 233 ~~~~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gDsGgPL~~~~~~~g~~~~~l~GI~S~~~ 298 (302)
+++++.++|+..+.....+.+.||||+...++.++|+|||||||+|.. ....+|+|+||+|||.
T Consensus 160 v~i~~~~~C~~~~~~~~~i~~~~iCag~~~~~~~~C~GDSGGPLv~~~--~~~~~~~l~GIvS~g~ 223 (290)
T 1fiw_A 160 VDLIDLGLCNSTRWYNGRIRSTNVCAGYPEGKIDTCQGDSGGPLMCKD--SAENSYVVVGITSWGV 223 (290)
T ss_dssp EEEECHHHHTSTTTTTTCCCTTEEEEECTTCSSBCCTTCTTCEEEEEC--SSSSCEEEEEEEEECS
T ss_pred EEEecHHHhccccccCCcCCCCEEEEecCCCCCeeCCCCCchheEEEE--CCCCCEEEEEEEEECC
Confidence 999999999876433456889999999766778999999999999987 3334679999999984
|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 302 | ||||
| g2pka.1 | 232 | b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T | 1e-38 | |
| g2pka.1 | 232 | b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T | 4e-14 | |
| d1z8ga1 | 255 | b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum | 6e-38 | |
| d1z8ga1 | 255 | b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum | 9e-12 | |
| d1hj8a_ | 222 | b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon | 5e-37 | |
| d1hj8a_ | 222 | b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon | 5e-11 | |
| d2f91a1 | 237 | b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c | 9e-36 | |
| d2f91a1 | 237 | b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c | 2e-11 | |
| d1ao5a_ | 237 | b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) | 9e-36 | |
| d1ao5a_ | 237 | b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) | 1e-09 | |
| d1npma_ | 225 | b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax | 7e-34 | |
| d1npma_ | 225 | b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax | 8e-12 | |
| d1ekbb_ | 235 | b.47.1.2 (B:) Enteropeptidase (enterokinase light | 8e-34 | |
| d1ekbb_ | 235 | b.47.1.2 (B:) Enteropeptidase (enterokinase light | 8e-08 | |
| d1xx9a_ | 237 | b.47.1.2 (A:) Coagulation factor XI {Human (Homo s | 9e-34 | |
| d1xx9a_ | 237 | b.47.1.2 (A:) Coagulation factor XI {Human (Homo s | 2e-12 | |
| d1eaxa_ | 241 | b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien | 1e-33 | |
| d1eaxa_ | 241 | b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien | 3e-06 | |
| d1mzaa_ | 240 | b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta | 2e-33 | |
| d1mzaa_ | 240 | b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta | 4e-08 | |
| d1j16a_ | 223 | b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu | 1e-32 | |
| d1j16a_ | 223 | b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu | 3e-09 | |
| d1orfa_ | 232 | b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta | 1e-32 | |
| d1orfa_ | 232 | b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta | 5e-09 | |
| d1sgfa_ | 228 | b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus | 1e-32 | |
| d1sgfa_ | 228 | b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus | 1e-06 | |
| d1gdna_ | 224 | b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo | 2e-32 | |
| d1gdna_ | 224 | b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo | 5e-07 | |
| d1lo6a_ | 221 | b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ | 9e-32 | |
| d1lo6a_ | 221 | b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ | 7e-08 | |
| d1rfna_ | 235 | b.47.1.2 (A:) Coagulation factor IXa, protease dom | 4e-31 | |
| d1rfna_ | 235 | b.47.1.2 (A:) Coagulation factor IXa, protease dom | 7e-06 | |
| d1pytd_ | 251 | b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co | 2e-30 | |
| d1pytd_ | 251 | b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co | 8e-09 | |
| d1tona_ | 235 | b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 | 2e-30 | |
| d1tona_ | 235 | b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 | 6e-08 | |
| d1rrka1 | 287 | b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens | 3e-30 | |
| d1rrka1 | 287 | b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens | 3e-08 | |
| d1rjxb_ | 247 | b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum | 4e-30 | |
| d1rjxb_ | 247 | b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum | 1e-07 | |
| g1fiw.1 | 274 | b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) | 7e-30 | |
| g1fiw.1 | 274 | b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) | 3e-07 | |
| g1gg6.1 | 238 | b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge | 2e-29 | |
| g1gg6.1 | 238 | b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge | 3e-06 | |
| d1azza_ | 226 | b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd | 2e-29 | |
| d1azza_ | 226 | b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd | 8e-05 | |
| d1fxya_ | 228 | b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer | 2e-29 | |
| d1fxya_ | 228 | b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer | 3e-07 | |
| g1rtf.1 | 260 | b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti | 3e-29 | |
| g1rtf.1 | 260 | b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti | 1e-05 | |
| g1gj7.1 | 256 | b.47.1.2 (A:,B:) Urokinase-type plasminogen activa | 6e-29 | |
| g1gj7.1 | 256 | b.47.1.2 (A:,B:) Urokinase-type plasminogen activa | 6e-09 | |
| d2fpza1 | 243 | b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap | 9e-29 | |
| d2fpza1 | 243 | b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap | 2e-07 | |
| d1gvkb_ | 240 | b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 | 3e-28 | |
| d1gvkb_ | 240 | b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 | 7e-07 | |
| d1hj9a_ | 223 | b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax | 1e-27 | |
| d1hj9a_ | 223 | b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax | 3e-06 | |
| g1h8d.1 | 289 | b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T | 2e-27 | |
| g1h8d.1 | 289 | b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T | 1e-04 | |
| d1gvza_ | 237 | b.47.1.2 (A:) Prostate specific antigen (PSA kalli | 2e-27 | |
| d3rp2a_ | 224 | b.47.1.2 (A:) Chymase II (mast cell proteinase II) | 3e-27 | |
| d3rp2a_ | 224 | b.47.1.2 (A:) Chymase II (mast cell proteinase II) | 1e-06 | |
| d1bioa_ | 228 | b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI | 4e-27 | |
| d1bioa_ | 228 | b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI | 3e-04 | |
| d1si5h_ | 234 | b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human | 2e-26 | |
| d2qy0b1 | 240 | b.47.1.2 (B:447-686) Complement C1R protease, cata | 3e-26 | |
| d2qy0b1 | 240 | b.47.1.2 (B:447-686) Complement C1R protease, cata | 0.004 | |
| d2p3ub1 | 233 | b.47.1.2 (B:16-243) Coagulation factor Xa, proteas | 8e-26 | |
| d1elta_ | 236 | b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI | 3e-25 | |
| d1elta_ | 236 | b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI | 2e-04 | |
| d1brup_ | 241 | b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 | 2e-24 | |
| d1brup_ | 241 | b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 | 2e-05 | |
| d1fi8a_ | 227 | b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) | 2e-24 | |
| d1fi8a_ | 227 | b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) | 3e-06 | |
| d1op0a_ | 234 | b.47.1.2 (A:) Venom serine protease {Hundred-pace | 3e-24 | |
| d1fona_ | 232 | b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III | 4e-24 | |
| d1fona_ | 232 | b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III | 0.002 | |
| d1autc_ | 240 | b.47.1.2 (C:) Activated protein c (autoprothrombin | 9e-24 | |
| d1m9ua_ | 241 | b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax | 2e-23 | |
| d2bz6h1 | 254 | b.47.1.2 (H:16-257) Coagulation factor VIIa {Human | 2e-23 | |
| d1elva1 | 259 | b.47.1.2 (A:410-668) Complement C1S protease, cata | 2e-23 | |
| d1eufa_ | 224 | b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: | 3e-23 | |
| d1arba_ | 263 | b.47.1.1 (A:) Achromobacter protease {Achromobacte | 7e-23 | |
| d1arba_ | 263 | b.47.1.1 (A:) Achromobacter protease {Achromobacte | 3e-05 | |
| d1eq9a_ | 222 | b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re | 7e-23 | |
| d1os8a_ | 223 | b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai | 8e-23 | |
| d1fq3a_ | 227 | b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta | 1e-22 | |
| d1fq3a_ | 227 | b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta | 0.002 | |
| d2z7fe1 | 218 | b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) | 3e-22 | |
| d1nn6a_ | 224 | b.47.1.2 (A:) Chymase (mast cell protease I) {Huma | 3e-22 | |
| d1nn6a_ | 224 | b.47.1.2 (A:) Chymase (mast cell protease I) {Huma | 6e-04 | |
| d1q3xa1 | 242 | b.47.1.2 (A:445-686) Mannan-binding lectin serine | 9e-22 | |
| d1a7sa_ | 225 | b.47.1.2 (A:) Heparin binding protein, HBP {Human | 2e-20 | |
| d1t32a1 | 224 | b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie | 1e-19 | |
| d1fuja_ | 221 | b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie | 1e-19 | |
| d1p3ca_ | 215 | b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int | 1e-17 | |
| d2hlca_ | 230 | b.47.1.2 (A:) HL collagenase {Common cattle grub ( | 9e-17 | |
| d2o8la1 | 216 | b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur | 4e-11 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 9e-08 | |
| d1hpga_ | 187 | b.47.1.1 (A:) Glutamic acid-specific protease {Str | 3e-06 | |
| d1hpga_ | 187 | b.47.1.1 (A:) Glutamic acid-specific protease {Str | 0.004 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 2e-05 |
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 302 | |||
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 100.0 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 100.0 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 100.0 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 100.0 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 100.0 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 100.0 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 100.0 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 100.0 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 100.0 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 100.0 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 100.0 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 100.0 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 100.0 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 100.0 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 100.0 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 100.0 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 100.0 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 100.0 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 100.0 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 100.0 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 100.0 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 100.0 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 100.0 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 100.0 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 100.0 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 100.0 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 100.0 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 100.0 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 100.0 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 100.0 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 100.0 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 100.0 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 100.0 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 100.0 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 100.0 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 100.0 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 100.0 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 100.0 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 100.0 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 99.89 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.79 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.53 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.5 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.48 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.27 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.23 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 99.22 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 99.21 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.21 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.19 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 99.18 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.17 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.16 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.14 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 99.14 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 99.11 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 99.11 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 99.1 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 99.06 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.04 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.01 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 99.0 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 98.99 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 98.98 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 98.96 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 98.93 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 98.92 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 98.92 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 98.91 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 98.9 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 98.89 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 98.86 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 98.86 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 98.86 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 98.85 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 98.83 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 98.83 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 98.82 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 98.81 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 98.81 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 98.8 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 98.79 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 98.78 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 98.74 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 98.72 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 98.72 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 98.69 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 98.65 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 98.64 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 98.57 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 98.5 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.5 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 98.45 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 98.39 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 98.13 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 98.1 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 98.05 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 97.96 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 97.89 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 97.76 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 97.73 | |
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 97.6 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 97.27 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 96.46 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 96.07 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 89.08 |
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Eukaryotic proteases domain: Matriptase MTSP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.4e-37 Score=258.13 Aligned_cols=192 Identities=35% Similarity=0.597 Sum_probs=159.1
Q ss_pred ecCCeecccccchhHHhhhcc-CeeeeeEEEeeCCEEEecccccCCC------CCceEEEEEcccccccCCCCCceEEEe
Q psy8651 101 IVGGNVTKLHEFPWIAALTKK-GKFYCGATLIAKRHVLTAAHCIEGV------NPKEIKVTLGEHDRLSKNESVPVIIRK 173 (302)
Q Consensus 101 i~~g~~~~~~~~pwi~~l~~~-~~~~C~GsLI~~~~VLTaAhC~~~~------~~~~~~v~~g~~~~~~~~~~~~~~~~~ 173 (302)
|++|..+..++|||++.+... ..++|+||||+++||||||||+... ....+.+..+..+...... ...+.+.
T Consensus 1 i~gG~~a~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaA~Cv~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~ 79 (241)
T d1eaxa_ 1 VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSA-PGVQERR 79 (241)
T ss_dssp CBSCEECCTTSSTTEEEEEETTTEEEEEEEECSSSEEEECGGGGCCBTTBCTTCGGGEEEEESCCBTTCTTS-TTCEEEE
T ss_pred CCCCEECCCCCCCcEEEEEECCCCEEEEEEEEcCCEEEECeeeeecCCceeeeccceeeEEeeeeecccccC-CCcEEEE
Confidence 578999999999999998654 5679999999999999999999542 2345677777766553333 3378899
Q ss_pred EeEEEeCCCCCCCCCCCCeEEEEEcCCCcCCCCceeeeeeCCCCCC----------------CCCccCcCceEEEeeeeC
Q psy8651 174 VKRAIRHPDFSLSNFNNDIALLEMESGVDFEAPQIHPACLPGNSLD----------------ERKPTANSLRKVEVPILS 237 (302)
Q Consensus 174 v~~i~~hp~y~~~~~~~DiALl~L~~~~~~~~~~v~picl~~~~~~----------------~~~~~~~~l~~~~~~~~~ 237 (302)
|+++++||+|+.....||||||||++|+.+.. .++|||||..... ........|+...+++++
T Consensus 80 v~~i~~Hp~y~~~~~~~diAll~L~~~~~~~~-~~~~i~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~ 158 (241)
T d1eaxa_ 80 LKRIISHPFFNDFTFDYDIALLELEKPAEYSS-MVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIN 158 (241)
T ss_dssp EEEEEECTTCCTTTCTTCCEEEEESSCCCCBT-TBCCCBCCCTTCCCCTTCEEEEEESSBSSTTSCBCSBCEEEEEEECC
T ss_pred EEEEEECCcccccccCCcccccccCCceecCc-ccceeeccccccccccceeEEEeccCCccccccccccceEEEEEEeC
Confidence 99999999999999999999999999999988 9999999965432 233456678999999999
Q ss_pred HHhHhccCCCCCCCCCCeEEeeeCCCCCCCCCCCCCCceEEEecCCCceeEEEEEEeeeeee
Q psy8651 238 EEECKSAGYSASRITNNMLCAGYAEGKRDSCQGDSGGPLQIAVARPGKMEATLSKVVSRVQE 299 (302)
Q Consensus 238 ~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gDsGgPL~~~~~~~g~~~~~l~GI~S~~~~ 299 (302)
.+.|+..+ ...+...++|++...+..+.|.||+||||++.. .+| +|+|+||+|++..
T Consensus 159 ~~~C~~~~--~~~~~~~~~c~~~~~~~~~~c~gd~G~pl~~~~-~~g--~~~L~Gi~s~~~~ 215 (241)
T d1eaxa_ 159 QTTCENLL--PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVE-ADG--RIFQAGVVSWGDG 215 (241)
T ss_dssp HHHHHHHS--TTTCCTTEEEEECTTCSSBCCTTCTTCEEEEEC-TTS--CEEEEEEEEECSS
T ss_pred HHHHHHHh--CccccCccceeccCCCCcccccCcccceeEEEc-CCC--eEEEEEEEEECCC
Confidence 99999987 556788999998777778999999999999976 233 5799999999753
|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|