Psyllid ID: psy8670
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| 193709215 | 621 | PREDICTED: probable maltase H [Acyrthosi | 0.549 | 0.198 | 0.653 | 2e-43 | |
| 328702366 | 573 | PREDICTED: maltase 2-like [Acyrthosiphon | 0.531 | 0.207 | 0.633 | 2e-42 | |
| 158299642 | 683 | AGAP008965-PA [Anopheles gambiae str. PE | 0.526 | 0.172 | 0.621 | 1e-40 | |
| 195116945 | 594 | GI24716 [Drosophila mojavensis] gi|19391 | 0.571 | 0.215 | 0.589 | 2e-40 | |
| 170055688 | 605 | alpha-glucosidase [Culex quinquefasciatu | 0.660 | 0.244 | 0.535 | 7e-40 | |
| 194861545 | 583 | GG23742 [Drosophila erecta] gi|190661671 | 0.535 | 0.205 | 0.619 | 2e-39 | |
| 312385458 | 809 | hypothetical protein AND_00763 [Anophele | 0.535 | 0.148 | 0.586 | 3e-39 | |
| 195053049 | 593 | GH13812 [Drosophila grimshawi] gi|193900 | 0.593 | 0.224 | 0.580 | 6e-39 | |
| 157126493 | 601 | alpha-amylase [Aedes aegypti] gi|1088732 | 0.558 | 0.207 | 0.604 | 7e-39 | |
| 332018170 | 567 | Alpha-glucosidase [Acromyrmex echinatior | 0.638 | 0.252 | 0.54 | 8e-39 |
| >gi|193709215|ref|XP_001943317.1| PREDICTED: probable maltase H [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 181 bits (458), Expect = 2e-43, Method: Compositional matrix adjust.
Identities = 81/124 (65%), Positives = 105/124 (84%), Gaps = 1/124 (0%)
Query: 32 QEPLEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPM 91
++ LEWW+T+V+Y +YPRSFKDSNGDG+GDLKG IE+ EH D+GV VW+SPIFKSPM
Sbjct: 29 EKSLEWWKTAVYYQVYPRSFKDSNGDGIGDLKG-IEEKAEHFKDIGVDCVWLSPIFKSPM 87
Query: 92 ADFGYDISDYLSFEPLFGDLKDFETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLANI 151
ADFGYDISDY +P++G + DF +L+++L +LGIKI+LDFVPNH+S++HEWFKKS+ I
Sbjct: 88 ADFGYDISDYNMIDPVYGTMDDFISLQKKLQSLGIKIILDFVPNHSSDEHEWFKKSVDKI 147
Query: 152 PPYK 155
PYK
Sbjct: 148 MPYK 151
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328702366|ref|XP_001943582.2| PREDICTED: maltase 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|158299642|ref|XP_319713.4| AGAP008965-PA [Anopheles gambiae str. PEST] gi|157013615|gb|EAA14849.4| AGAP008965-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195116945|ref|XP_002003011.1| GI24716 [Drosophila mojavensis] gi|193913586|gb|EDW12453.1| GI24716 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|170055688|ref|XP_001863693.1| alpha-glucosidase [Culex quinquefasciatus] gi|167875568|gb|EDS38951.1| alpha-glucosidase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|194861545|ref|XP_001969804.1| GG23742 [Drosophila erecta] gi|190661671|gb|EDV58863.1| GG23742 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|312385458|gb|EFR29953.1| hypothetical protein AND_00763 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|195053049|ref|XP_001993444.1| GH13812 [Drosophila grimshawi] gi|193900503|gb|EDV99369.1| GH13812 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|157126493|ref|XP_001660907.1| alpha-amylase [Aedes aegypti] gi|108873258|gb|EAT37483.1| AAEL010532-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332018170|gb|EGI58776.1| Alpha-glucosidase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| FB|FBgn0032382 | 583 | Mal-B2 "Maltase B2" [Drosophil | 0.535 | 0.205 | 0.611 | 5.3e-40 | |
| FB|FBgn0050359 | 630 | Mal-A5 "Maltase A5" [Drosophil | 0.535 | 0.190 | 0.603 | 2e-38 | |
| FB|FBgn0033297 | 588 | Mal-A8 "Maltase A8" [Drosophil | 0.531 | 0.202 | 0.608 | 2.6e-38 | |
| FB|FBgn0033294 | 579 | Mal-A4 "Maltase A4" [Drosophil | 0.526 | 0.203 | 0.588 | 2.5e-37 | |
| FB|FBgn0032381 | 584 | Mal-B1 "Maltase B1" [Drosophil | 0.526 | 0.202 | 0.554 | 2.8e-37 | |
| FB|FBgn0002570 | 577 | Mal-A1 "Maltase A1" [Drosophil | 0.531 | 0.206 | 0.55 | 2.9e-36 | |
| FB|FBgn0002571 | 574 | Mal-A3 "Maltase A3" [Drosophil | 0.562 | 0.219 | 0.543 | 6.1e-36 | |
| FB|FBgn0050360 | 601 | Mal-A6 "Maltase A6" [Drosophil | 0.660 | 0.246 | 0.461 | 2.8e-35 | |
| TIGR_CMR|SO_2213 | 540 | SO_2213 "oligo-1,6-glucosidase | 0.5 | 0.207 | 0.584 | 1.1e-34 | |
| UNIPROTKB|O53198 | 546 | aglA "Probable alpha-glucosida | 0.535 | 0.219 | 0.544 | 1.5e-34 |
| FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 426 (155.0 bits), Expect = 5.3e-40, P = 5.3e-40
Identities = 74/121 (61%), Positives = 95/121 (78%)
Query: 35 LEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADF 94
++WW +VFY +YPRSFKDSNGDG+GDLKG+ KL +L D G+ A W+SPIF+SPM DF
Sbjct: 32 IDWWPHTVFYQIYPRSFKDSNGDGIGDLKGITSKL-RYLADTGITATWLSPIFQSPMIDF 90
Query: 95 GYDISDYLSFEPLFGDLKDFETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLANIPPY 154
GYDISDY + +P +G ++DFE L + LGIK++LDFVPNH+S+QHEWFKKS A P Y
Sbjct: 91 GYDISDYKAIQPEYGTMQDFEELIDTAFELGIKVVLDFVPNHSSDQHEWFKKSAAREPGY 150
Query: 155 K 155
+
Sbjct: 151 E 151
|
|
| FB|FBgn0050359 Mal-A5 "Maltase A5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2213 SO_2213 "oligo-1,6-glucosidase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O53198 aglA "Probable alpha-glucosidase AglA (Maltase) (Glucoinvertase) (Glucosidosucrase) (Maltase-glucoamylase) (Lysosomal alpha-glucosidase) (Acid maltase)" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| cd11328 | 470 | cd11328, AmyAc_maltase, Alpha amylase catalytic do | 9e-74 | |
| cd11333 | 428 | cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca | 8e-64 | |
| cd11331 | 450 | cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly | 2e-62 | |
| cd11330 | 472 | cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d | 2e-61 | |
| cd11359 | 456 | cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom | 1e-59 | |
| cd11332 | 481 | cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti | 7e-57 | |
| TIGR02403 | 543 | TIGR02403, trehalose_treC, alpha,alpha-phosphotreh | 2e-53 | |
| cd11334 | 447 | cd11334, AmyAc_TreS, Alpha amylase catalytic domai | 2e-48 | |
| cd11316 | 403 | cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic | 4e-47 | |
| cd11348 | 429 | cd11348, AmyAc_2, Alpha amylase catalytic domain f | 7e-43 | |
| PRK10933 | 551 | PRK10933, PRK10933, trehalose-6-phosphate hydrolas | 2e-41 | |
| COG0366 | 505 | COG0366, AmyA, Glycosidases [Carbohydrate transpor | 1e-40 | |
| TIGR02456 | 539 | TIGR02456, treS_nterm, trehalose synthase | 2e-39 | |
| smart00642 | 166 | smart00642, Aamy, Alpha-amylase domain | 3e-39 | |
| pfam00128 | 314 | pfam00128, Alpha-amylase, Alpha amylase, catalytic | 1e-38 | |
| cd00551 | 260 | cd00551, AmyAc_family, Alpha amylase catalytic dom | 1e-30 | |
| cd11338 | 389 | cd11338, AmyAc_CMD, Alpha amylase catalytic domain | 8e-29 | |
| cd11333 | 428 | cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca | 4e-27 | |
| cd11313 | 336 | cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly | 5e-26 | |
| cd11331 | 450 | cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly | 1e-24 | |
| PRK10785 | 598 | PRK10785, PRK10785, maltodextrin glucosidase; Prov | 7e-23 | |
| cd11324 | 536 | cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt | 1e-22 | |
| cd11359 | 456 | cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom | 2e-22 | |
| cd11330 | 472 | cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d | 5e-22 | |
| TIGR02403 | 543 | TIGR02403, trehalose_treC, alpha,alpha-phosphotreh | 3e-21 | |
| cd11332 | 481 | cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti | 8e-21 | |
| cd11320 | 389 | cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase | 9e-21 | |
| pfam00128 | 314 | pfam00128, Alpha-amylase, Alpha amylase, catalytic | 5e-20 | |
| cd11340 | 407 | cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal | 2e-19 | |
| cd11339 | 344 | cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal | 3e-18 | |
| cd11337 | 328 | cd11337, AmyAc_CMD_like, Alpha amylase catalytic d | 6e-17 | |
| cd11334 | 447 | cd11334, AmyAc_TreS, Alpha amylase catalytic domai | 7e-17 | |
| cd11316 | 403 | cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic | 8e-17 | |
| COG0366 | 505 | COG0366, AmyA, Glycosidases [Carbohydrate transpor | 9e-17 | |
| cd11353 | 366 | cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase cat | 6e-16 | |
| cd11348 | 429 | cd11348, AmyAc_2, Alpha amylase catalytic domain f | 7e-16 | |
| cd11352 | 443 | cd11352, AmyAc_5, Alpha amylase catalytic domain f | 3e-15 | |
| PRK10933 | 551 | PRK10933, PRK10933, trehalose-6-phosphate hydrolas | 4e-14 | |
| cd11336 | 660 | cd11336, AmyAc_MTSase, Alpha amylase catalytic dom | 4e-14 | |
| PRK14507 | 1693 | PRK14507, PRK14507, putative bifunctional 4-alpha- | 5e-13 | |
| smart00642 | 166 | smart00642, Aamy, Alpha-amylase domain | 6e-13 | |
| PRK14510 | 1221 | PRK14510, PRK14510, putative bifunctional 4-alpha- | 8e-13 | |
| TIGR02456 | 539 | TIGR02456, treS_nterm, trehalose synthase | 9e-13 | |
| cd11354 | 357 | cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt | 5e-12 | |
| cd11343 | 445 | cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a | 5e-12 | |
| PRK14511 | 879 | PRK14511, PRK14511, maltooligosyl trehalose syntha | 1e-11 | |
| PRK09505 | 683 | PRK09505, malS, alpha-amylase; Reviewed | 2e-11 | |
| COG3280 | 889 | COG3280, TreY, Maltooligosyl trehalose synthase [C | 2e-11 | |
| TIGR02401 | 825 | TIGR02401, trehalose_TreY, malto-oligosyltrehalose | 3e-11 | |
| cd11338 | 389 | cd11338, AmyAc_CMD, Alpha amylase catalytic domain | 3e-10 | |
| cd11347 | 391 | cd11347, AmyAc_1, Alpha amylase catalytic domain f | 7e-10 | |
| cd11329 | 477 | cd11329, AmyAc_maltase-like, Alpha amylase catalyt | 1e-09 | |
| cd11356 | 458 | cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha | 2e-09 | |
| cd11350 | 390 | cd11350, AmyAc_4, Alpha amylase catalytic domain f | 3e-09 | |
| cd11345 | 326 | cd11345, AmyAc_SLC3A2, Alpha amylase catalytic dom | 5e-09 | |
| cd11355 | 433 | cd11355, AmyAc_Sucrose_phosphorylase, Alpha amylas | 2e-08 | |
| cd11319 | 375 | cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d | 3e-08 | |
| PRK10785 | 598 | PRK10785, PRK10785, maltodextrin glucosidase; Prov | 4e-08 | |
| cd11325 | 436 | cd11325, AmyAc_GTHase, Alpha amylase catalytic dom | 8e-08 | |
| PRK09441 | 479 | PRK09441, PRK09441, cytoplasmic alpha-amylase; Rev | 8e-08 | |
| cd11324 | 536 | cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt | 1e-07 | |
| cd11349 | 456 | cd11349, AmyAc_3, Alpha amylase catalytic domain f | 1e-07 | |
| COG0296 | 628 | COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ | 1e-07 | |
| PRK12313 | 633 | PRK12313, PRK12313, glycogen branching enzyme; Pro | 2e-07 | |
| TIGR02100 | 688 | TIGR02100, glgX_debranch, glycogen debranching enz | 3e-07 | |
| TIGR03852 | 470 | TIGR03852, sucrose_gtfA, sucrose phosphorylase | 5e-07 | |
| TIGR02402 | 544 | TIGR02402, trehalose_TreZ, malto-oligosyltrehalose | 7e-07 | |
| cd11322 | 402 | cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom | 3e-06 | |
| cd11336 | 660 | cd11336, AmyAc_MTSase, Alpha amylase catalytic dom | 5e-06 | |
| cd11340 | 407 | cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal | 6e-06 | |
| cd11335 | 538 | cd11335, AmyAc_MTase_N, Alpha amylase catalytic do | 6e-06 | |
| cd11315 | 352 | cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic | 6e-06 | |
| cd00551 | 260 | cd00551, AmyAc_family, Alpha amylase catalytic dom | 2e-05 | |
| PRK14511 | 879 | PRK14511, PRK14511, maltooligosyl trehalose syntha | 2e-05 | |
| cd11346 | 347 | cd11346, AmyAc_plant_IsoA, Alpha amylase catalytic | 2e-05 | |
| cd11320 | 389 | cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase | 3e-05 | |
| cd11337 | 328 | cd11337, AmyAc_CMD_like, Alpha amylase catalytic d | 3e-05 | |
| cd11318 | 391 | cd11318, AmyAc_bac_fung_AmyA, Alpha amylase cataly | 5e-05 | |
| cd11339 | 344 | cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal | 7e-05 | |
| cd11326 | 433 | cd11326, AmyAc_Glg_debranch, Alpha amylase catalyt | 7e-05 | |
| cd11343 | 445 | cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a | 1e-04 | |
| TIGR02401 | 825 | TIGR02401, trehalose_TreY, malto-oligosyltrehalose | 1e-04 | |
| cd11329 | 477 | cd11329, AmyAc_maltase-like, Alpha amylase catalyt | 1e-04 | |
| PRK14705 | 1224 | PRK14705, PRK14705, glycogen branching enzyme; Pro | 1e-04 | |
| COG3280 | 889 | COG3280, TreY, Maltooligosyl trehalose synthase [C | 2e-04 | |
| cd11356 | 458 | cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha | 2e-04 | |
| cd11314 | 302 | cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase | 2e-04 | |
| COG1523 | 697 | COG1523, PulA, Type II secretory pathway, pullulan | 3e-04 | |
| TIGR01515 | 618 | TIGR01515, branching_enzym, alpha-1,4-glucan:alpha | 4e-04 | |
| PRK13840 | 495 | PRK13840, PRK13840, sucrose phosphorylase; Provisi | 6e-04 | |
| cd11354 | 357 | cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt | 8e-04 | |
| PRK14706 | 639 | PRK14706, PRK14706, glycogen branching enzyme; Pro | 8e-04 | |
| cd11352 | 443 | cd11352, AmyAc_5, Alpha amylase catalytic domain f | 9e-04 | |
| cd11353 | 366 | cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase cat | 0.001 | |
| cd11344 | 355 | cd11344, AmyAc_GlgE_like, Alpha amylase catalytic | 0.002 | |
| PRK14507 | 1693 | PRK14507, PRK14507, putative bifunctional 4-alpha- | 0.004 |
| >gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins | Back alignment and domain information |
|---|
Score = 230 bits (589), Expect = 9e-74
Identities = 71/122 (58%), Positives = 96/122 (78%), Gaps = 1/122 (0%)
Query: 34 PLEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMAD 93
+WW+ +VFY +YPRSFKDS+GDG+GDLKG+ EKL + D+G+ A+W+SPIFKSPM D
Sbjct: 1 DKDWWENAVFYQIYPRSFKDSDGDGIGDLKGITEKLD-YFKDIGIDAIWLSPIFKSPMVD 59
Query: 94 FGYDISDYLSFEPLFGDLKDFETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLANIPP 153
FGYDISD+ +P+FG ++DFE L LG+K++LDFVPNH+S++HEWF+KS+ P
Sbjct: 60 FGYDISDFTDIDPIFGTMEDFEELIAEAKKLGLKVILDFVPNHSSDEHEWFQKSVKRDEP 119
Query: 154 YK 155
YK
Sbjct: 120 YK 121
|
Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470 |
| >gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family | Back alignment and domain information |
|---|
| >gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase | Back alignment and domain information |
|---|
| >gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200490 cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase catalytic domain found in eukaryotic and bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200475 cd11336, AmyAc_MTSase, Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase) | Back alignment and domain information |
|---|
| >gnl|CDD|237737 PRK14507, PRK14507, putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|237739 PRK14510, PRK14510, putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|237740 PRK14511, PRK14511, maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225819 COG3280, TreY, Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233849 TIGR02401, trehalose_TreY, malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200485 cd11347, AmyAc_1, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase | Back alignment and domain information |
|---|
| >gnl|CDD|200493 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200483 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic domain found in solute carrier family 3 member 2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200492 cd11355, AmyAc_Sucrose_phosphorylase, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|236518 PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase | Back alignment and domain information |
|---|
| >gnl|CDD|200487 cd11349, AmyAc_3, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131155 TIGR02100, glgX_debranch, glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >gnl|CDD|163564 TIGR03852, sucrose_gtfA, sucrose phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|233850 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) | Back alignment and domain information |
|---|
| >gnl|CDD|200475 cd11336, AmyAc_MTSase, Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase) | Back alignment and domain information |
|---|
| >gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200474 cd11335, AmyAc_MTase_N, Alpha amylase catalytic domain found in maltosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family | Back alignment and domain information |
|---|
| >gnl|CDD|237740 PRK14511, PRK14511, maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200484 cd11346, AmyAc_plant_IsoA, Alpha amylase catalytic domain family found in plant isoamylases | Back alignment and domain information |
|---|
| >gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200457 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase catalytic domain found in bacterial and fungal Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200465 cd11326, AmyAc_Glg_debranch, Alpha amylase catalytic domain found in glycogen debranching enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|233849 TIGR02401, trehalose_TreY, malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase | Back alignment and domain information |
|---|
| >gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225819 COG3280, TreY, Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200493 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237528 PRK13840, PRK13840, sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200490 cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase catalytic domain found in eukaryotic and bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200482 cd11344, AmyAc_GlgE_like, Alpha amylase catalytic domain found in GlgE-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237737 PRK14507, PRK14507, putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 100.0 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 100.0 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 100.0 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 100.0 | |
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 99.98 | |
| KOG0471|consensus | 545 | 99.97 | ||
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 99.97 | |
| PRK13840 | 495 | sucrose phosphorylase; Provisional | 99.97 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 99.96 | |
| TIGR03852 | 470 | sucrose_gtfA sucrose phosphorylase. In the forward | 99.96 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 99.95 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 99.95 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 99.95 | |
| TIGR02455 | 688 | TreS_stutzeri trehalose synthase, Pseudomonas stut | 99.94 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 99.94 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 99.94 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 99.94 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 99.94 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 99.92 | |
| PLN02960 | 897 | alpha-amylase | 99.92 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 99.92 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 99.92 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 99.92 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 99.92 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 99.92 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 99.91 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 99.91 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 99.9 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 99.9 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 99.9 | |
| PLN02361 | 401 | alpha-amylase | 99.89 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 99.89 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 99.88 | |
| PLN02784 | 894 | alpha-amylase | 99.88 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 99.87 | |
| COG1523 | 697 | PulA Type II secretory pathway, pullulanase PulA a | 99.87 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 99.85 | |
| COG3280 | 889 | TreY Maltooligosyl trehalose synthase [Carbohydrat | 99.83 | |
| KOG0470|consensus | 757 | 99.81 | ||
| TIGR01531 | 1464 | glyc_debranch glycogen debranching enzymye. glycog | 99.74 | |
| PF14701 | 423 | hDGE_amylase: glucanotransferase domain of human g | 99.47 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 99.31 | |
| KOG2212|consensus | 504 | 99.15 | ||
| TIGR03852 | 470 | sucrose_gtfA sucrose phosphorylase. In the forward | 98.9 | |
| KOG3625|consensus | 1521 | 98.87 | ||
| PRK13840 | 495 | sucrose phosphorylase; Provisional | 98.76 | |
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 98.57 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 98.55 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 98.48 | |
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 98.45 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 98.39 | |
| TIGR02455 | 688 | TreS_stutzeri trehalose synthase, Pseudomonas stut | 98.37 | |
| PF02324 | 809 | Glyco_hydro_70: Glycosyl hydrolase family 70; Inte | 98.3 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 98.2 | |
| KOG0471|consensus | 545 | 98.15 | ||
| PF14872 | 811 | GHL5: Hypothetical glycoside hydrolase 5 | 98.03 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 97.99 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 97.9 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 97.85 | |
| COG3280 | 889 | TreY Maltooligosyl trehalose synthase [Carbohydrat | 97.5 | |
| PF14871 | 132 | GHL6: Hypothetical glycosyl hydrolase 6 | 97.47 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 97.33 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 97.29 | |
| TIGR01531 | 1464 | glyc_debranch glycogen debranching enzymye. glycog | 96.93 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 96.91 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 96.84 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 96.66 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 96.56 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 96.54 | |
| PF14488 | 166 | DUF4434: Domain of unknown function (DUF4434) | 96.3 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.28 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.27 | |
| PLN02361 | 401 | alpha-amylase | 95.94 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 95.91 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 95.62 | |
| COG1649 | 418 | Uncharacterized protein conserved in bacteria [Fun | 95.52 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 95.52 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 95.15 | |
| PLN02960 | 897 | alpha-amylase | 95.03 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 94.84 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 94.57 | |
| PRK14508 | 497 | 4-alpha-glucanotransferase; Provisional | 94.49 | |
| PLN02784 | 894 | alpha-amylase | 94.46 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 94.06 | |
| PLN02635 | 538 | disproportionating enzyme | 93.9 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 93.77 | |
| cd06592 | 303 | GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact | 93.69 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 93.6 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 93.44 | |
| PF02446 | 496 | Glyco_hydro_77: 4-alpha-glucanotransferase; InterP | 93.38 | |
| PF02065 | 394 | Melibiase: Melibiase; InterPro: IPR000111 O-Glycos | 93.23 | |
| PRK09936 | 296 | hypothetical protein; Provisional | 93.12 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 93.09 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 93.0 | |
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 92.99 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 92.53 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 92.46 | |
| PF05913 | 357 | DUF871: Bacterial protein of unknown function (DUF | 92.15 | |
| PRK11052 | 695 | malQ 4-alpha-glucanotransferase; Provisional | 92.01 | |
| PLN03236 | 745 | 4-alpha-glucanotransferase; Provisional | 91.87 | |
| cd06568 | 329 | GH20_SpHex_like A subgroup of the Glycosyl hydrola | 91.32 | |
| COG3589 | 360 | Uncharacterized conserved protein [Function unknow | 91.15 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 90.76 | |
| cd06562 | 348 | GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c | 89.48 | |
| cd06569 | 445 | GH20_Sm-chitobiase-like The chitobiase of Serratia | 89.02 | |
| PF14701 | 423 | hDGE_amylase: glucanotransferase domain of human g | 88.94 | |
| cd06565 | 301 | GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) | 88.5 | |
| PF03198 | 314 | Glyco_hydro_72: Glucanosyltransferase; InterPro: I | 88.13 | |
| PF00728 | 351 | Glyco_hydro_20: Glycosyl hydrolase family 20, cata | 87.26 | |
| TIGR03849 | 237 | arch_ComA phosphosulfolactate synthase. This model | 86.94 | |
| PF01120 | 346 | Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 | 86.55 | |
| cd02742 | 303 | GH20_hexosaminidase Beta-N-acetylhexosaminidases o | 86.33 | |
| PLN03059 | 840 | beta-galactosidase; Provisional | 86.0 | |
| smart00812 | 384 | Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro | 85.82 | |
| PF13204 | 289 | DUF4038: Protein of unknown function (DUF4038); PD | 85.08 | |
| cd06591 | 319 | GH31_xylosidase_XylS XylS is a glycosyl hydrolase | 84.88 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 84.55 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 84.15 | |
| cd06563 | 357 | GH20_chitobiase-like The chitobiase of Serratia ma | 83.99 | |
| PRK08208 | 430 | coproporphyrinogen III oxidase; Validated | 83.81 | |
| PLN02849 | 503 | beta-glucosidase | 83.57 | |
| TIGR00539 | 360 | hemN_rel putative oxygen-independent coproporphyri | 83.28 | |
| PRK05628 | 375 | coproporphyrinogen III oxidase; Validated | 83.24 | |
| PF10566 | 273 | Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: | 82.52 | |
| PRK10426 | 635 | alpha-glucosidase; Provisional | 82.22 | |
| PRK07094 | 323 | biotin synthase; Provisional | 82.2 | |
| COG2730 | 407 | BglC Endoglucanase [Carbohydrate transport and met | 81.6 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 81.58 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 81.41 | |
| PRK01060 | 281 | endonuclease IV; Provisional | 81.01 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 80.69 | |
| TIGR00217 | 513 | malQ 4-alpha-glucanotransferase. This enzyme is kn | 80.56 | |
| PRK08207 | 488 | coproporphyrinogen III oxidase; Provisional | 80.48 | |
| cd06570 | 311 | GH20_chitobiase-like_1 A functionally uncharacteri | 80.32 | |
| cd06564 | 326 | GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( | 80.19 |
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-38 Score=296.33 Aligned_cols=159 Identities=36% Similarity=0.778 Sum_probs=142.1
Q ss_pred CCccCCCceEEEEecccccCcCCCCCCCHHHHHHHHHHHHHHcCCCeEEEcCcccCCCCCCCCCccCCCCcCCCCCCHHH
Q psy8670 34 PLEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADFGYDISDYLSFEPLFGDLKD 113 (224)
Q Consensus 34 ~~~w~~~~viY~i~~~~f~~~~~~~~g~l~~~~~~l~~~l~~lG~~~i~l~Pi~~~~~~~~gY~~~d~~~v~~~~G~~~~ 113 (224)
.+.||+++|||||++++|.++++++.|+|+|++++| +||++||||+|||+|+++++..++||++.||++|||+|||+++
T Consensus 4 ~~~W~~~~v~Yqi~~~~f~d~~~~~~Gdl~gi~~~l-dyl~~lGv~~i~l~P~~~~~~~~~gY~~~d~~~id~~~Gt~~d 82 (551)
T PRK10933 4 LPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTQRL-DYLQKLGVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDD 82 (551)
T ss_pred cchhhhcCeEEEEEchHhhcCCCCCCcCHHHHHHhh-HHHHhCCCCEEEECCCCCCCCCCCCCCcccCCCcCcccCCHHH
Confidence 467999999999999999999999999999999999 9999999999999999998877799999999999999999999
Q ss_pred HHHHHHHHHHcCCEEEEecCCCCCCccchhHHhhhcCCCCccccccchhcccCCC------------------cceeecc
Q psy8670 114 FETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLANIPPYKCASLLARLHDLGV------------------GAVWISP 175 (224)
Q Consensus 114 ~~~lv~~~h~~gi~vilD~v~nh~~~~~~w~~~~~~~~~~~~~~f~w~~~~~lG~------------------~~~w~~p 175 (224)
|++||++||++||+||+|+|+||+|.+|+||+++....++|.+||+|.+..+... ...|+..
T Consensus 83 ~~~lv~~~h~~gi~vilD~V~NH~s~~~~wf~~~~~~~~~y~d~y~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~y~~ 162 (551)
T PRK10933 83 FDELVAQAKSRGIRIILDMVFNHTSTQHAWFREALNKESPYRQFYIWRDGEPETPPNNWRSKFGGSAWRWHAESEQYYLH 162 (551)
T ss_pred HHHHHHHHHHCCCEEEEEECCCCccCchhHHHhhcCCCCCCcCceEecCCCCCCCCCcccccCCCccccccCCCCceEee
Confidence 9999999999999999999999999999999999877889999999876321110 1234455
Q ss_pred cccCCCCCCCCcchhhHH
Q psy8670 176 IFKSPMADFGYDISDYLR 193 (224)
Q Consensus 176 ~f~~~~~dlny~n~d~~~ 193 (224)
.|...++|+|++||++++
T Consensus 163 ~f~~~~pdLn~~np~V~~ 180 (551)
T PRK10933 163 LFAPEQADLNWENPAVRA 180 (551)
T ss_pred cccccCCccCCCCHHHHH
Confidence 566678999999999876
|
|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0471|consensus | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK13840 sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03852 sucrose_gtfA sucrose phosphorylase | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0470|consensus | Back alignment and domain information |
|---|
| >TIGR01531 glyc_debranch glycogen debranching enzymye | Back alignment and domain information |
|---|
| >PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >KOG2212|consensus | Back alignment and domain information |
|---|
| >TIGR03852 sucrose_gtfA sucrose phosphorylase | Back alignment and domain information |
|---|
| >KOG3625|consensus | Back alignment and domain information |
|---|
| >PRK13840 sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type | Back alignment and domain information |
|---|
| >PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0471|consensus | Back alignment and domain information |
|---|
| >PF14872 GHL5: Hypothetical glycoside hydrolase 5 | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14871 GHL6: Hypothetical glycosyl hydrolase 6 | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01531 glyc_debranch glycogen debranching enzymye | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >PF14488 DUF4434: Domain of unknown function (DUF4434) | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG1649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >PRK14508 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PLN02635 disproportionating enzyme | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09936 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea | Back alignment and domain information |
|---|
| >PRK11052 malQ 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03236 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) | Back alignment and domain information |
|---|
| >COG3589 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme | Back alignment and domain information |
|---|
| >cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins | Back alignment and domain information |
|---|
| >PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane | Back alignment and domain information |
|---|
| >PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 | Back alignment and domain information |
|---|
| >TIGR03849 arch_ComA phosphosulfolactate synthase | Back alignment and domain information |
|---|
| >PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >PLN03059 beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >smart00812 Alpha_L_fucos Alpha-L-fucosidase | Back alignment and domain information |
|---|
| >PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D | Back alignment and domain information |
|---|
| >cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >PRK08208 coproporphyrinogen III oxidase; Validated | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase | Back alignment and domain information |
|---|
| >PRK05628 coproporphyrinogen III oxidase; Validated | Back alignment and domain information |
|---|
| >PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10426 alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PRK07094 biotin synthase; Provisional | Back alignment and domain information |
|---|
| >COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >PRK01060 endonuclease IV; Provisional | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >TIGR00217 malQ 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PRK08207 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 224 | ||||
| 4gin_A | 584 | Crystal Structure Of The Mutb R284c Mutant From Cry | 3e-32 | ||
| 4gin_A | 584 | Crystal Structure Of The Mutb R284c Mutant From Cry | 2e-09 | ||
| 2pwf_A | 556 | Crystal Structure Of The Mutb D200a Mutant In Compl | 4e-32 | ||
| 2pwf_A | 556 | Crystal Structure Of The Mutb D200a Mutant In Compl | 2e-09 | ||
| 2pwe_A | 556 | Crystal Structure Of The Mutb E254q Mutant In Compl | 4e-32 | ||
| 2pwe_A | 556 | Crystal Structure Of The Mutb E254q Mutant In Compl | 2e-09 | ||
| 1zja_A | 557 | Crystal Structure Of The Trehalulose Synthase Mutb | 4e-32 | ||
| 1zja_A | 557 | Crystal Structure Of The Trehalulose Synthase Mutb | 2e-09 | ||
| 4h2c_A | 557 | Trehalulose Synthase Mutb R284c Mutant Length = 557 | 4e-32 | ||
| 4h2c_A | 557 | Trehalulose Synthase Mutb R284c Mutant Length = 557 | 2e-09 | ||
| 4gi6_A | 557 | Crystal Structure Of The Mutb F164l Mutant In Compl | 4e-32 | ||
| 4gi6_A | 557 | Crystal Structure Of The Mutb F164l Mutant In Compl | 2e-09 | ||
| 2pwg_A | 556 | Crystal Structure Of The Trehalulose Synthase Mutb | 4e-32 | ||
| 2pwg_A | 556 | Crystal Structure Of The Trehalulose Synthase Mutb | 2e-09 | ||
| 2ze0_A | 555 | Alpha-glucosidase Gsj Length = 555 | 3e-31 | ||
| 2ze0_A | 555 | Alpha-glucosidase Gsj Length = 555 | 3e-09 | ||
| 1uok_A | 558 | Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas | 4e-30 | ||
| 1uok_A | 558 | Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas | 1e-09 | ||
| 4aie_A | 549 | Structure Of Glucan-1,6-Alpha-Glucosidase From Lact | 4e-30 | ||
| 4aie_A | 549 | Structure Of Glucan-1,6-Alpha-Glucosidase From Lact | 5e-10 | ||
| 3gbd_A | 558 | Crystal Structure Of The Isomaltulose Synthase Smua | 1e-29 | ||
| 3gbd_A | 558 | Crystal Structure Of The Isomaltulose Synthase Smua | 3e-08 | ||
| 1m53_A | 570 | Crystal Structure Of Isomaltulose Synthase (Pali) F | 2e-29 | ||
| 1m53_A | 570 | Crystal Structure Of Isomaltulose Synthase (Pali) F | 9e-08 | ||
| 3a47_A | 589 | Crystal Structure Of Isomaltase From Saccharomyces | 3e-29 | ||
| 3a47_A | 589 | Crystal Structure Of Isomaltase From Saccharomyces | 2e-09 | ||
| 3axh_A | 589 | Crystal Structure Of Isomaltase In Complex With Iso | 3e-29 | ||
| 3axh_A | 589 | Crystal Structure Of Isomaltase In Complex With Iso | 2e-09 | ||
| 2zic_A | 543 | Crystal Structure Of Streptococcus Mutans Dextran G | 5e-29 | ||
| 2zic_A | 543 | Crystal Structure Of Streptococcus Mutans Dextran G | 3e-09 | ||
| 2zid_A | 543 | Crystal Structure Of Dextran Glucosidase E236q Comp | 5e-29 | ||
| 2zid_A | 543 | Crystal Structure Of Dextran Glucosidase E236q Comp | 3e-09 | ||
| 1wza_A | 488 | Crystal Structure Of Alpha-Amylase From H.Orenii Le | 1e-25 | ||
| 1wza_A | 488 | Crystal Structure Of Alpha-Amylase From H.Orenii Le | 3e-06 | ||
| 3k8l_A | 669 | Crystal Structure Of Susg-D498n Mutant With Maltohe | 3e-21 | ||
| 3k8l_A | 669 | Crystal Structure Of Susg-D498n Mutant With Maltohe | 2e-05 | ||
| 3k8k_A | 669 | Crystal Structure Of Susg Length = 669 | 3e-21 | ||
| 3k8k_A | 669 | Crystal Structure Of Susg Length = 669 | 3e-05 | ||
| 1lwh_A | 441 | Crystal Structure Of T. Maritima 4-Alpha-Glucanotra | 3e-19 | ||
| 1g1y_A | 585 | Crystal Structure Of Alpha-Amylase Ii (Tvaii) From | 7e-17 | ||
| 1wzk_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T | 7e-17 | ||
| 1wzl_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T | 7e-17 | ||
| 1jl8_A | 585 | Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoact | 7e-17 | ||
| 1bvz_A | 585 | Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vul | 7e-17 | ||
| 1wzm_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (t | 7e-17 | ||
| 1vfm_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 7e-17 | ||
| 1jf5_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 7e-17 | ||
| 1jf6_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 8e-17 | ||
| 1jgi_A | 628 | Crystal Structure Of The Active Site Mutant Glu328g | 6e-15 | ||
| 1jgi_A | 628 | Crystal Structure Of The Active Site Mutant Glu328g | 3e-04 | ||
| 1mvy_A | 628 | Amylosucrase Mutant E328q Co-Crystallized With Malt | 7e-15 | ||
| 1mvy_A | 628 | Amylosucrase Mutant E328q Co-Crystallized With Malt | 3e-04 | ||
| 1gvi_A | 588 | Thermus Maltogenic Amylase In Complex With Beta-Cd | 2e-14 | ||
| 1sma_A | 588 | Crystal Structure Of A Maltogenic Amylase Length = | 2e-14 | ||
| 4fls_A | 628 | Crystal Structure Of Amylosucrase Inactive Double M | 2e-14 | ||
| 4flo_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 2e-14 | ||
| 1g5a_A | 628 | Amylosucrase From Neisseria Polysaccharea Length = | 2e-14 | ||
| 4flr_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 2e-14 | ||
| 3ueq_A | 632 | Crystal Structure Of Amylosucrase From Neisseria Po | 2e-14 | ||
| 4flq_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 2e-14 | ||
| 1j0j_A | 588 | Crystal Structure Of Neopullulanase E357q Complex W | 6e-14 | ||
| 1j0h_A | 588 | Crystal Structure Of Bacillus Stearothermophilus Ne | 6e-14 | ||
| 1ea9_C | 583 | Cyclomaltodextrinase Length = 583 | 2e-13 | ||
| 4aee_A | 696 | Crystal Structure Of Maltogenic Amylase From S.Mari | 9e-13 | ||
| 1cyg_A | 680 | Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgt | 4e-12 | ||
| 3ucq_A | 655 | Crystal Structure Of Amylosucrase From Deinococcus | 1e-11 | ||
| 6cgt_A | 684 | Hoxa Complex Of Cyclodextrin Glycosyltransferase Mu | 3e-11 | ||
| 1cgu_A | 684 | Catalytic Center Of Cyclodextrin Glycosyltransferas | 3e-11 | ||
| 1cgt_A | 684 | Structure Of Cyclodextrin Glycosyltransferase Refin | 3e-11 | ||
| 8cgt_A | 684 | Structure Of Cyclodextrin Glycosyltransferase Compl | 3e-11 | ||
| 4cgt_A | 678 | Deletion Mutant Delta(145-150), F151d Of Cyclodextr | 4e-11 | ||
| 2wpg_A | 637 | Sucrose Hydrolase Length = 637 | 6e-11 | ||
| 1izk_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-amylase 1 Mut | 7e-11 | ||
| 1uh2_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-AmylaseMALTO- | 7e-11 | ||
| 2d0f_A | 637 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 7e-11 | ||
| 1izj_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase 1 Mut | 7e-11 | ||
| 1ji1_A | 637 | Crystal Structure Analysis Of Thermoactinomyces Vul | 7e-11 | ||
| 3czk_A | 644 | Crystal Structure Analysis Of Sucrose Hydrolase(Suh | 8e-11 | ||
| 3cze_A | 644 | Crystal Structure Analysis Of Sucrose Hydrolase (Su | 8e-11 | ||
| 1qho_A | 686 | Five-Domain Alpha-Amylase From Bacillus Stearotherm | 1e-10 | ||
| 2wc7_A | 488 | Crystal Structure Of Nostoc Punctiforme Debranching | 1e-10 | ||
| 3dhu_A | 449 | Crystal Structure Of An Alpha-Amylase From Lactobac | 3e-10 | ||
| 4aef_A | 645 | The Crystal Structure Of Thermostable Amylase From | 6e-10 | ||
| 1a47_A | 683 | Cgtase From Thermoanaerobacterium Thermosulfurigene | 1e-09 | ||
| 1tcm_A | 686 | Cyclodextrin Glycosyltransferase W616a Mutant From | 1e-09 | ||
| 1uks_A | 686 | Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN | 1e-09 | ||
| 1d7f_A | 686 | Crystal Structure Of Asparagine 233-Replaced Cyclod | 1e-09 | ||
| 1cxk_A | 686 | Complex Between A Maltononaose Substrate And Bacill | 1e-09 | ||
| 1cgw_A | 686 | Site Directed Mutations Of The Active Site Residue | 1e-09 | ||
| 1v3k_A | 686 | Crystal Structure Of F283y Mutant Cyclodextrin Glyc | 1e-09 | ||
| 1v3j_A | 686 | Crystal Structure Of F283l Mutant Cyclodextrin Glyc | 2e-09 | ||
| 1eo5_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 2e-09 | ||
| 1kck_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 2e-09 | ||
| 1cgx_A | 686 | Site Directed Mutations Of The Active Site Residue | 2e-09 | ||
| 1pam_A | 686 | Cyclodextrin Glucanotransferase Length = 686 | 2e-09 | ||
| 1cdg_A | 686 | Nucleotide Sequence And X-Ray Structure Of Cyclodex | 2e-09 | ||
| 1kcl_A | 686 | Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl | 2e-09 | ||
| 1cgv_A | 686 | Site Directed Mutations Of The Active Site Residue | 2e-09 | ||
| 1cxl_A | 686 | Complex Between A Covalent Intermediate And Bacillu | 2e-09 | ||
| 1cgy_A | 686 | Site Directed Mutations Of The Active Site Residue | 2e-09 | ||
| 1pez_A | 686 | Bacillus Circulans Strain 251 Mutant A230v Length = | 2e-09 | ||
| 1dtu_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 2e-09 | ||
| 1pj9_A | 686 | Bacillus Circulans Strain 251 Loop Mutant 183-195 L | 2e-09 | ||
| 2z1k_A | 475 | Crystal Structure Of Ttha1563 From Thermus Thermoph | 3e-09 | ||
| 3bmv_A | 683 | Cyclodextrin Glycosyl Transferase From Thermoanerob | 3e-09 | ||
| 1ot2_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 6e-09 | ||
| 1ukt_A | 686 | Crystal Structure Of Y100l Mutant Cyclodextrin Gluc | 7e-09 | ||
| 1ot1_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 1e-08 | ||
| 2dh3_A | 424 | Crystal Structure Of Human Ed-4f2hc Length = 424 | 2e-08 | ||
| 2dh2_A | 424 | Crystal Structure Of Human Ed-4f2hc Length = 424 | 3e-08 | ||
| 1iv8_A | 720 | Crystal Structure Of Maltooligosyl Trehalose Syntha | 8e-07 | ||
| 2taa_A | 478 | Structure And Possible Catalytic Residues Of Taka-A | 5e-06 | ||
| 4gkl_A | 422 | Crystal Structure Of A Noncanonic Maltogenic Alpha- | 8e-06 | ||
| 2guy_A | 478 | Orthorhombic Crystal Structure (Space Group P21212) | 1e-05 | ||
| 3vgg_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 1e-05 | ||
| 3vge_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 1e-05 | ||
| 3vgd_A | 558 | Ctystal Structure Of Glycosyltrehalose Trehalohydro | 2e-05 | ||
| 1eha_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 2e-05 | ||
| 1eh9_A | 558 | Crystal Structure Of Sulfolobus Solfataricus Glycos | 2e-05 | ||
| 3hje_A | 704 | Crystal Structure Of Sulfolobus Tokodaii Hypothetic | 3e-05 | ||
| 3k1d_A | 722 | Crystal Structure Of Glycogen Branching Enzyme Syno | 5e-05 | ||
| 2aaa_A | 484 | Calcium Binding In Alpha-Amylases: An X-Ray Diffrac | 2e-04 | ||
| 3qgv_A | 435 | Crystal Structure Of A Thermostable Amylase Variant | 3e-04 | ||
| 2bhy_A | 602 | Crystal Structure Of Deinococcus Radiodurans Maltoo | 3e-04 | ||
| 3m07_A | 618 | 1.4 Angstrom Resolution Crystal Structure Of Putati | 3e-04 | ||
| 3ede_A | 601 | Structural Base For Cyclodextrin Hydrolysis Length | 3e-04 | ||
| 3edf_A | 601 | Structural Base For Cyclodextrin Hydrolysis Length | 3e-04 | ||
| 3edd_A | 601 | Structural Base For Cyclodextrin Hydrolysis Length | 3e-04 | ||
| 1mwo_A | 435 | Crystal Structure Analysis Of The Hyperthermostable | 5e-04 | ||
| 2bhu_A | 602 | Crystal Structure Of Deinococcus Radiodurans Maltoo | 5e-04 | ||
| 3aml_A | 755 | Structure Of The Starch Branching Enzyme I (Bei) Fr | 6e-04 | ||
| 3amk_A | 702 | Structure Of The Starch Branching Enzyme I (Bei) Fr | 7e-04 | ||
| 1h3g_A | 601 | Cyclomaltodextrinase From Flavobacterium Sp. No. 92 | 9e-04 |
| >pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 | Back alignment and structure |
|
| >pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 | Back alignment and structure |
| >pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 | Back alignment and structure |
| >pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 | Back alignment and structure |
| >pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 | Back alignment and structure |
| >pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 | Back alignment and structure |
| >pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 | Back alignment and structure |
| >pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 | Back alignment and structure |
| >pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 | Back alignment and structure |
| >pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 | Back alignment and structure |
| >pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 | Back alignment and structure |
| >pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 | Back alignment and structure |
| >pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 | Back alignment and structure |
| >pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 | Back alignment and structure |
| >pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 | Back alignment and structure |
| >pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 | Back alignment and structure |
| >pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 | Back alignment and structure |
| >pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 | Back alignment and structure |
| >pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 | Back alignment and structure |
| >pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 | Back alignment and structure |
| >pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 | Back alignment and structure |
| >pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 | Back alignment and structure |
| >pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 | Back alignment and structure |
| >pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 | Back alignment and structure |
| >pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 | Back alignment and structure |
| >pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 | Back alignment and structure |
| >pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 | Back alignment and structure |
| >pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 | Back alignment and structure |
| >pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 | Back alignment and structure |
| >pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 | Back alignment and structure |
| >pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 | Back alignment and structure |
| >pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 | Back alignment and structure |
| >pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 | Back alignment and structure |
| >pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 | Back alignment and structure |
| >pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 | Back alignment and structure |
| >pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 | Back alignment and structure |
| >pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 | Back alignment and structure |
| >pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 | Back alignment and structure |
| >pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 | Back alignment and structure |
| >pdb|1G1Y|A Chain A, Crystal Structure Of Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R-47 And Beta-Cyclodextrin Complex Length = 585 | Back alignment and structure |
| >pdb|1WZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt D465n Length = 585 | Back alignment and structure |
| >pdb|1WZL|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt R469l Length = 585 | Back alignment and structure |
| >pdb|1JL8|A Chain A, Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoactinomyces Vulgaris R-47 With Beta-Cyclodextrin Based On A Co- Crystallization With Methyl Beta-Cyclodextrin Length = 585 | Back alignment and structure |
| >pdb|1BVZ|A Chain A, Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R- 47 Length = 585 | Back alignment and structure |
| >pdb|1WZM|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (tva Ii) Mutatnt R469k Length = 585 | Back alignment and structure |
| >pdb|1VFM|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2ALPHA-Cyclodextrin Complex Length = 585 | Back alignment and structure |
| >pdb|1JF5|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2 Mutant F286a Length = 585 | Back alignment and structure |
| >pdb|1JF6|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase Mutant F286y Length = 585 | Back alignment and structure |
| >pdb|1JGI|A Chain A, Crystal Structure Of The Active Site Mutant Glu328gln Of Amylosucrase From Neisseria Polysaccharea In Complex With The Natural Substrate Sucrose Length = 628 | Back alignment and structure |
| >pdb|1JGI|A Chain A, Crystal Structure Of The Active Site Mutant Glu328gln Of Amylosucrase From Neisseria Polysaccharea In Complex With The Natural Substrate Sucrose Length = 628 | Back alignment and structure |
| >pdb|1MVY|A Chain A, Amylosucrase Mutant E328q Co-Crystallized With Maltoheptaose. Length = 628 | Back alignment and structure |
| >pdb|1MVY|A Chain A, Amylosucrase Mutant E328q Co-Crystallized With Maltoheptaose. Length = 628 | Back alignment and structure |
| >pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 | Back alignment and structure |
| >pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 | Back alignment and structure |
| >pdb|4FLS|A Chain A, Crystal Structure Of Amylosucrase Inactive Double Mutant F290k-E328q From Neisseria Polysaccharea In Complex With Sucrose Length = 628 | Back alignment and structure |
| >pdb|4FLO|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290c From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|1G5A|A Chain A, Amylosucrase From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|4FLR|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290l From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|3UEQ|A Chain A, Crystal Structure Of Amylosucrase From Neisseria Polysaccharea In Complex With Turanose Length = 632 | Back alignment and structure |
| >pdb|4FLQ|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290i From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 | Back alignment and structure |
| >pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 | Back alignment and structure |
| >pdb|1EA9|C Chain C, Cyclomaltodextrinase Length = 583 | Back alignment and structure |
| >pdb|4AEE|A Chain A, Crystal Structure Of Maltogenic Amylase From S.Marinus Length = 696 | Back alignment and structure |
| >pdb|1CYG|A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) Length = 680 | Back alignment and structure |
| >pdb|3UCQ|A Chain A, Crystal Structure Of Amylosucrase From Deinococcus Geothermalis Length = 655 | Back alignment and structure |
| >pdb|6CGT|A Chain A, Hoxa Complex Of Cyclodextrin Glycosyltransferase Mutant Length = 684 | Back alignment and structure |
| >pdb|1CGU|A Chain A, Catalytic Center Of Cyclodextrin Glycosyltransferase Derived From X-Ray Structure Analysis Combined With Site- Directed Mutagenesis Length = 684 | Back alignment and structure |
| >pdb|1CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Refined At 2.0 Angstroms Resolution Length = 684 | Back alignment and structure |
| >pdb|8CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Complexed With A Thio-Maltohexaose Length = 684 | Back alignment and structure |
| >pdb|4CGT|A Chain A, Deletion Mutant Delta(145-150), F151d Of Cyclodextrin Glycosyltransferase Length = 678 | Back alignment and structure |
| >pdb|2WPG|A Chain A, Sucrose Hydrolase Length = 637 | Back alignment and structure |
| >pdb|1IZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase 1 Mutant Enzyme W398v Length = 637 | Back alignment and structure |
| >pdb|1UH2|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-AmylaseMALTO-Hexaose Complex Length = 637 | Back alignment and structure |
| >pdb|2D0F|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 1 (Tvai) Mutant D356n Complexed With P2, A Pullulan Model Oligosaccharide Length = 637 | Back alignment and structure |
| >pdb|1IZJ|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase 1 Mutant Enzyme F313a Length = 637 | Back alignment and structure |
| >pdb|1JI1|A Chain A, Crystal Structure Analysis Of Thermoactinomyces Vulgaris R- 47 Alpha-amylase 1 Length = 637 | Back alignment and structure |
| >pdb|3CZK|A Chain A, Crystal Structure Analysis Of Sucrose Hydrolase(Suh) E322q- Sucrose Complex Length = 644 | Back alignment and structure |
| >pdb|3CZE|A Chain A, Crystal Structure Analysis Of Sucrose Hydrolase (Suh)- Tris Complex Length = 644 | Back alignment and structure |
| >pdb|1QHO|A Chain A, Five-Domain Alpha-Amylase From Bacillus Stearothermophilus, MaltoseACARBOSE COMPLEX Length = 686 | Back alignment and structure |
| >pdb|2WC7|A Chain A, Crystal Structure Of Nostoc Punctiforme Debranching Enzyme( Npde)(Acarbose Soaked) Length = 488 | Back alignment and structure |
| >pdb|3DHU|A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum Length = 449 | Back alignment and structure |
| >pdb|4AEF|A Chain A, The Crystal Structure Of Thermostable Amylase From The Pyrococcus Length = 645 | Back alignment and structure |
| >pdb|1A47|A Chain A, Cgtase From Thermoanaerobacterium Thermosulfurigenes Em1 In Complex With A Maltohexaose Inhibitor Length = 683 | Back alignment and structure |
| >pdb|1TCM|A Chain A, Cyclodextrin Glycosyltransferase W616a Mutant From Bacillus Circulans Strain 251 Length = 686 | Back alignment and structure |
| >pdb|1UKS|A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose Length = 686 | Back alignment and structure |
| >pdb|1D7F|A Chain A, Crystal Structure Of Asparagine 233-Replaced Cyclodextrin Glucanotransferase From Alkalophilic Bacillus Sp. 1011 Determined At 1.9 A Resolution Length = 686 | Back alignment and structure |
| >pdb|1CXK|A Chain A, Complex Between A Maltononaose Substrate And Bacillus Circulans Strain 251 Cgtase E257qD229N Length = 686 | Back alignment and structure |
| >pdb|1CGW|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1V3K|A Chain A, Crystal Structure Of F283y Mutant Cyclodextrin Glycosyltransferase Length = 686 | Back alignment and structure |
| >pdb|1V3J|A Chain A, Crystal Structure Of F283l Mutant Cyclodextrin Glycosyltransferase Length = 686 | Back alignment and structure |
| >pdb|1EO5|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase In Complex With Maltoheptaose Length = 686 | Back alignment and structure |
| >pdb|1KCK|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant N193g Length = 686 | Back alignment and structure |
| >pdb|1CGX|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1PAM|A Chain A, Cyclodextrin Glucanotransferase Length = 686 | Back alignment and structure |
| >pdb|1CDG|A Chain A, Nucleotide Sequence And X-Ray Structure Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 In A Maltose-Dependent Crystal Form Length = 686 | Back alignment and structure |
| >pdb|1KCL|A Chain A, Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl Transferase Mutant G179l Length = 686 | Back alignment and structure |
| >pdb|1CGV|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1CXL|A Chain A, Complex Between A Covalent Intermediate And Bacillus Circulans Strain 251 Cgtase E257q Length = 686 | Back alignment and structure |
| >pdb|1CGY|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1PEZ|A Chain A, Bacillus Circulans Strain 251 Mutant A230v Length = 686 | Back alignment and structure |
| >pdb|1DTU|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase: A Mutant Y89dS146P COMPLEXED TO AN Hexasaccharide Inhibitor Length = 686 | Back alignment and structure |
| >pdb|1PJ9|A Chain A, Bacillus Circulans Strain 251 Loop Mutant 183-195 Length = 686 | Back alignment and structure |
| >pdb|2Z1K|A Chain A, Crystal Structure Of Ttha1563 From Thermus Thermophilus Hb8 Length = 475 | Back alignment and structure |
| >pdb|3BMV|A Chain A, Cyclodextrin Glycosyl Transferase From Thermoanerobacterium Thermosulfurigenes Em1 Mutant S77p Length = 683 | Back alignment and structure |
| >pdb|1OT2|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135n Length = 686 | Back alignment and structure |
| >pdb|1UKT|A Chain A, Crystal Structure Of Y100l Mutant Cyclodextrin Glucanotransferase Compexed With An Acarbose Length = 686 | Back alignment and structure |
| >pdb|1OT1|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135a Length = 686 | Back alignment and structure |
| >pdb|2DH3|A Chain A, Crystal Structure Of Human Ed-4f2hc Length = 424 | Back alignment and structure |
| >pdb|2DH2|A Chain A, Crystal Structure Of Human Ed-4f2hc Length = 424 | Back alignment and structure |
| >pdb|1IV8|A Chain A, Crystal Structure Of Maltooligosyl Trehalose Synthase Length = 720 | Back alignment and structure |
| >pdb|2TAA|A Chain A, Structure And Possible Catalytic Residues Of Taka-Amylase A Length = 478 | Back alignment and structure |
| >pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana Length = 422 | Back alignment and structure |
| >pdb|2GUY|A Chain A, Orthorhombic Crystal Structure (Space Group P21212) Of Aspergillus Niger Alpha-Amylase At 1.6 A Resolution Length = 478 | Back alignment and structure |
| >pdb|3VGG|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (E283q) Complexed With Maltoheptaose Length = 558 | Back alignment and structure |
| >pdb|3VGE|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (D252s) Length = 558 | Back alignment and structure |
| >pdb|3VGD|A Chain A, Ctystal Structure Of Glycosyltrehalose Trehalohydrolase (D252e) Length = 558 | Back alignment and structure |
| >pdb|1EHA|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase From Sulfolobus Solfataricus Length = 558 | Back alignment and structure |
| >pdb|1EH9|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Glycosyltrehalose Trehalohydrolase Length = 558 | Back alignment and structure |
| >pdb|3HJE|A Chain A, Crystal Structure Of Sulfolobus Tokodaii Hypothetical Maltooligosyl Trehalose Synthase Length = 704 | Back alignment and structure |
| >pdb|3K1D|A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H37rv Length = 722 | Back alignment and structure |
| >pdb|2AAA|A Chain A, Calcium Binding In Alpha-Amylases: An X-Ray Diffraction Study At 2.1 Angstroms Resolution Of Two Enzymes From Aspergillus Length = 484 | Back alignment and structure |
| >pdb|3QGV|A Chain A, Crystal Structure Of A Thermostable Amylase Variant Length = 435 | Back alignment and structure |
| >pdb|2BHY|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase In Complex With Trehalose Length = 602 | Back alignment and structure |
| >pdb|3M07|A Chain A, 1.4 Angstrom Resolution Crystal Structure Of Putative Alpha Amylase From Salmonella Typhimurium Length = 618 | Back alignment and structure |
| >pdb|3EDE|A Chain A, Structural Base For Cyclodextrin Hydrolysis Length = 601 | Back alignment and structure |
| >pdb|3EDF|A Chain A, Structural Base For Cyclodextrin Hydrolysis Length = 601 | Back alignment and structure |
| >pdb|3EDD|A Chain A, Structural Base For Cyclodextrin Hydrolysis Length = 601 | Back alignment and structure |
| >pdb|1MWO|A Chain A, Crystal Structure Analysis Of The Hyperthermostable Pyrocoocus Woesei Alpha-Amylase Length = 435 | Back alignment and structure |
| >pdb|2BHU|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase Length = 602 | Back alignment and structure |
| >pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 755 | Back alignment and structure |
| >pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 702 | Back alignment and structure |
| >pdb|1H3G|A Chain A, Cyclomaltodextrinase From Flavobacterium Sp. No. 92: From Dna Sequence To Protein Structure Length = 601 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 1e-65 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 8e-27 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 2e-65 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 1e-26 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 2e-65 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 1e-26 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 3e-65 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 1e-26 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 5e-65 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 2e-26 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 6e-65 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 2e-26 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 4e-64 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 2e-63 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 8e-62 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 1e-52 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 3e-18 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 2e-44 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 7e-44 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 1e-43 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 2e-42 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 2e-42 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 2e-41 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 9e-40 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 1e-37 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 3e-37 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 3e-37 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 2e-36 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 5e-36 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 2e-13 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 7e-36 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 2e-34 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 2e-34 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 5e-13 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 1e-33 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 3e-12 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 2e-33 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 3e-32 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 2e-12 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 6e-32 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 1e-12 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 7e-31 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 4e-10 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 2e-30 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 1e-04 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 1e-29 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 4e-29 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 3e-28 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 8e-15 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 2e-27 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 8e-27 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 3e-26 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 6e-26 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 3e-24 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 6e-24 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 1e-21 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 6e-09 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 2e-19 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 8e-07 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 7e-19 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 8e-14 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 1e-13 | |
| 1hx0_A | 496 | Alpha amylase (PPA); inhibitor, carbohydrate, panc | 2e-11 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 5e-08 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 1e-07 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 1e-06 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 2e-06 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 5e-06 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 3e-05 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 7e-05 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 2e-04 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 3e-04 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 7e-04 |
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 | Back alignment and structure |
|---|
Score = 210 bits (538), Expect = 1e-65
Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)
Query: 36 EWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADFG 95
WW + Y +YP+SF D+NGDG+GDLKG+ KL +L LGV A+W+SP++ SPM D G
Sbjct: 4 HWWHKATVYQIYPKSFMDTNGDGIGDLKGITSKLD-YLQKLGVMAIWLSPVYDSPMDDNG 62
Query: 96 YDISDYLSFEPLFGDLKDFETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLAN 150
YDI++Y + +FG++ D + L + GIKI++D V NHTS++H WF ++ +
Sbjct: 63 YDIANYEAIADIFGNMADMDNLLTQAKMRGIKIIMDLVVNHTSDEHAWFIEAREH 117
|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Length = 471 | Back alignment and structure |
|---|
| >1hx0_A Alpha amylase (PPA); inhibitor, carbohydrate, pancreas, hydrolase; HET: GLC AC1 BGC MAL; 1.38A {Sus scrofa} SCOP: b.71.1.1 c.1.8.1 PDB: 1wo2_A* 1ua3_A* 1kxq_A 1kxt_A 1kxv_A 1jfh_A* 1vah_A* 1ppi_A* 3l2m_A* 3l2l_A* 1dhk_A* 1ose_A* 1pig_A* 1pif_A* 1bvn_P 3oli_A* 3old_A* 3olg_A* 3ole_A* 3ij8_A* ... Length = 496 | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Length = 718 | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 750 | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Length = 877 | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Length = 657 | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 100.0 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 100.0 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 100.0 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 100.0 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 100.0 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 100.0 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 100.0 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 100.0 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 100.0 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 100.0 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 100.0 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 100.0 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 100.0 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 100.0 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 100.0 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 100.0 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 100.0 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 100.0 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 100.0 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 100.0 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 100.0 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 100.0 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 99.98 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 99.98 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 99.97 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 99.97 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 99.97 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 99.97 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 99.97 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 99.96 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 99.96 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 99.96 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 99.96 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 99.96 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 99.96 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 99.95 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 99.95 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 99.95 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 99.95 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 99.95 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 99.95 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 99.95 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 99.95 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 99.94 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 99.94 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 99.94 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 99.94 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 99.94 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 99.94 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 99.94 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 99.94 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 99.94 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 99.94 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 99.93 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 99.93 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 99.93 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 99.93 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 99.92 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 99.92 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 99.92 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 99.91 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 99.91 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 99.91 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 99.9 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 99.9 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 99.89 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 98.71 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 98.55 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 98.55 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 98.54 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 98.46 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 98.45 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 98.45 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 98.44 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 98.41 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 98.38 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 98.38 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 98.37 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 98.34 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 98.21 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 98.2 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 98.19 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 98.17 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 98.14 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 98.1 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 98.09 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 98.04 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 98.0 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 97.88 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 97.82 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 97.68 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 97.55 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 97.38 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 97.36 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 97.32 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 97.32 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 97.3 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 97.3 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 97.19 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 97.17 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 97.16 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 97.15 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 97.15 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 97.13 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 97.12 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 97.1 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 97.08 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 97.07 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 97.06 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 97.03 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 97.01 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 96.99 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 96.99 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 96.95 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 96.85 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 96.77 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 96.76 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 96.67 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 96.64 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 96.6 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 96.56 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 96.48 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 96.45 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 96.28 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 96.23 | |
| 2xn2_A | 732 | Alpha-galactosidase; hydrolase, glycosidase; HET: | 96.19 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 96.09 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 96.09 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 96.07 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 95.91 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 95.85 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 95.77 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 95.58 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 95.56 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 95.39 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 95.3 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 95.22 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 95.17 | |
| 1zy9_A | 564 | Alpha-galactosidase; TM1192, struc genomics, joint | 95.15 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 95.08 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 94.99 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 94.99 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 94.92 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 94.85 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 94.84 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 94.81 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 94.72 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 94.62 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 94.52 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 94.46 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 94.45 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 94.42 | |
| 1esw_A | 500 | Amylomaltase; (beta,alpha)8-barrel, glucanotransfe | 94.37 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 94.32 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 94.32 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 94.24 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 94.19 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 94.14 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 94.08 | |
| 1tz7_A | 505 | 4-alpha-glucanotransferase; (beta, alpha)8- barrel | 94.04 | |
| 1x1n_A | 524 | 4-alpha-glucanotransferase; disproportionating enz | 93.97 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 93.8 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 93.75 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 93.75 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 93.68 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 93.63 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 93.48 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 93.44 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 93.2 | |
| 1x7f_A | 385 | Outer surface protein; structural genomics, unknow | 93.16 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 93.13 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 93.11 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 93.1 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 93.05 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 92.79 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 92.58 | |
| 4fnq_A | 729 | Alpha-galactosidase AGAB; glycoside hydrolase, hyd | 92.45 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 92.41 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 92.27 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 92.2 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 91.82 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 91.65 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 91.59 | |
| 2ki0_A | 36 | DS119; beta-alpha-beta, de novo protein; NMR {Synt | 91.31 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 91.05 | |
| 2p0o_A | 372 | Hypothetical protein DUF871; structural genomics, | 90.88 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 88.72 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 88.66 | |
| 1now_A | 507 | Beta-hexosaminidase beta chain; (beta/alpha)8-barr | 88.52 | |
| 2gjx_A | 507 | Beta-hexosaminidase alpha chain; beta-hexosaminida | 88.35 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 88.06 | |
| 3gyc_A | 393 | Putative glycoside hydrolase; YP_001304622.1, stru | 88.05 | |
| 4h41_A | 340 | Putative alpha-L-fucosidase; hydrolase, carbohydra | 87.86 | |
| 2f2h_A | 773 | Putative family 31 glucosidase YICI; BETA8alpha8 b | 87.47 | |
| 3can_A | 182 | Pyruvate-formate lyase-activating enzyme; structur | 87.17 | |
| 1jak_A | 512 | Beta-N-acetylhexosaminidase; glycoside hydrolase, | 86.61 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 86.48 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 86.33 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 86.04 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 85.73 | |
| 3a24_A | 641 | Alpha-galactosidase; glycoside hydrolase family 97 | 85.68 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 84.87 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 84.38 | |
| 2wvv_A | 450 | Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly | 83.97 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 83.53 | |
| 1qwg_A | 251 | PSL synthase;, (2R)-phospho-3-sulfolactate synthas | 83.23 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 82.92 | |
| 2zxd_A | 455 | Alpha-L-fucosidase, putative; TIM barrel, hydrolas | 82.17 | |
| 3lmz_A | 257 | Putative sugar isomerase; structural genomics, joi | 82.16 | |
| 1yht_A | 367 | DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact | 81.64 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 80.98 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 80.7 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 80.47 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 80.19 | |
| 2d73_A | 738 | Alpha-glucosidase SUSB; glycoside hydrolase family | 80.1 |
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.6e-42 Score=317.19 Aligned_cols=159 Identities=36% Similarity=0.765 Sum_probs=144.4
Q ss_pred CCccCCCceEEEEecccccCcCCCCCCCHHHHHHHHHHHHHHcCCCeEEEcCcccCCCCCCCCCccCCCCcCCCCCCHHH
Q psy8670 34 PLEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADFGYDISDYLSFEPLFGDLKD 113 (224)
Q Consensus 34 ~~~w~~~~viY~i~~~~f~~~~~~~~g~l~~~~~~l~~~l~~lG~~~i~l~Pi~~~~~~~~gY~~~d~~~v~~~~G~~~~ 113 (224)
.++||+++||||||+++|+++++++.|||+|++++| +|||+||||+|||+||++++..++||++.||++|||+|||++|
T Consensus 3 ~~~Ww~~~viYei~~~~F~d~~~dg~Gdl~Gi~~kL-dYLk~LGvt~I~L~Pi~~~~~~~~GYd~~dy~~vdp~~Gt~~d 81 (549)
T 4aie_A 3 SASWWKNAVVYQVYPKSFQDSNGDGIGDLQGIISRL-DYLEKLGIDAIWLSPVYQSPGVDNGYDISDYEAIDPQYGTMAD 81 (549)
T ss_dssp -CCGGGSCCEEEECGGGTCCSSSSSSCCHHHHHTTH-HHHHHHTCSEEEECCCEECCCTTTTSSCSEEEEECTTTCCHHH
T ss_pred CchhhccCeEEEEEcchhcCCCCCCCcCHHHHHHhh-HHHHHCCCCEEEeCCCcCCCCCCCCcCccCCCCcCcccCCHHH
Confidence 468999999999999999999999999999999999 9999999999999999999888899999999999999999999
Q ss_pred HHHHHHHHHHcCCEEEEecCCCCCCccchhHHhhhcC-CCCccccccchhcccCC------------------Ccceeec
Q psy8670 114 FETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLAN-IPPYKCASLLARLHDLG------------------VGAVWIS 174 (224)
Q Consensus 114 ~~~lv~~~h~~gi~vilD~v~nh~~~~~~w~~~~~~~-~~~~~~~f~w~~~~~lG------------------~~~~w~~ 174 (224)
|++||++||++||+||+|+|+||||.+|+||++...+ ..+|.+||+|.+..... ..+.++.
T Consensus 82 fk~Lv~~aH~~Gi~VilD~V~NHts~~~~wf~~~~~~~~~~~~~~y~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 161 (549)
T 4aie_A 82 MDELISKAKEHHIKIVMDLVVNHTSDQHKWFVEAKKGKDNQYRDYYIWRDPVDEHEPNDLKSAFSGSAWKYDERSGQYYL 161 (549)
T ss_dssp HHHHHHHHHHTTCEEEEEECCSBCCTTSHHHHHHTTCTTSTTGGGBCEECCBTTBCSSCCBCTTSSBSEEEETTTTEEEE
T ss_pred HHHHHHHHHHCCCEEEEEECccCCcCCcchhhhhhhcccccccccccccCCcccCCCCCcccccCCCcccccccCCceEe
Confidence 9999999999999999999999999999999999876 67899999987643211 1345666
Q ss_pred ccccCCCCCCCCcchhhHH
Q psy8670 175 PIFKSPMADFGYDISDYLR 193 (224)
Q Consensus 175 p~f~~~~~dlny~n~d~~~ 193 (224)
..|...++|+|+.||++++
T Consensus 162 ~~f~~~~~dln~~np~v~~ 180 (549)
T 4aie_A 162 HFFADQQPDLNWQNTELRQ 180 (549)
T ss_dssp CSSCTTSCBBCTTCHHHHH
T ss_pred cccCCCCCccccCCHHHHH
Confidence 6778889999999999876
|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >2ki0_A DS119; beta-alpha-beta, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* | Back alignment and structure |
|---|
| >2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* | Back alignment and structure |
|---|
| >3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* | Back alignment and structure |
|---|
| >3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 | Back alignment and structure |
|---|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 224 | ||||
| d1m53a2 | 478 | c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle | 2e-42 | |
| d1m53a2 | 478 | c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle | 8e-11 | |
| d1uoka2 | 479 | c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus | 9e-42 | |
| d1uoka2 | 479 | c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus | 1e-09 | |
| d1g5aa2 | 554 | c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc | 6e-36 | |
| d1wzaa2 | 409 | c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth | 8e-35 | |
| d1wzaa2 | 409 | c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth | 6e-08 | |
| d1iv8a2 | 653 | c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase | 2e-34 | |
| d1lwha2 | 391 | c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther | 4e-34 | |
| d1lwha2 | 391 | c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther | 1e-06 | |
| d1gjwa2 | 572 | c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga | 8e-30 | |
| d1gjwa2 | 572 | c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga | 8e-07 | |
| d1eh9a3 | 400 | c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol | 2e-27 | |
| d1h3ga3 | 422 | c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d | 3e-27 | |
| d1h3ga3 | 422 | c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d | 7e-08 | |
| d1bf2a3 | 475 | c.1.8.1 (A:163-637) Isoamylase, central domain {Ps | 5e-27 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 5e-26 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 1e-11 | |
| d1ht6a2 | 347 | c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor | 3e-25 | |
| d1ht6a2 | 347 | c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor | 7e-08 | |
| d1j0ha3 | 382 | c.1.8.1 (A:124-505) Neopullulanase, central domain | 1e-24 | |
| d1j0ha3 | 382 | c.1.8.1 (A:124-505) Neopullulanase, central domain | 1e-04 | |
| d2guya2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 1e-24 | |
| d2guya2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 5e-06 | |
| d1m7xa3 | 396 | c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz | 1e-23 | |
| d1m7xa3 | 396 | c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz | 9e-06 | |
| d1e43a2 | 393 | c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera | 2e-23 | |
| d3bmva4 | 406 | c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase | 2e-23 | |
| d3bmva4 | 406 | c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase | 1e-04 | |
| d1wzla3 | 382 | c.1.8.1 (A:121-502) Maltogenic amylase, central do | 2e-23 | |
| d1wzla3 | 382 | c.1.8.1 (A:121-502) Maltogenic amylase, central do | 2e-04 | |
| d1ud2a2 | 390 | c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu | 3e-23 | |
| d1ud2a2 | 390 | c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu | 1e-09 | |
| d1ji1a3 | 432 | c.1.8.1 (A:123-554) Maltogenic amylase, central do | 5e-23 | |
| d2d3na2 | 394 | c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu | 6e-23 | |
| d2d3na2 | 394 | c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu | 9e-10 | |
| d1qhoa4 | 407 | c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase | 2e-22 | |
| d1qhoa4 | 407 | c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase | 7e-05 | |
| d1ea9c3 | 382 | c.1.8.1 (C:122-503) Maltogenic amylase, central do | 3e-22 | |
| d1ea9c3 | 382 | c.1.8.1 (C:122-503) Maltogenic amylase, central do | 3e-04 | |
| d2aaaa2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 3e-22 | |
| d2aaaa2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 8e-04 | |
| d2bhua3 | 420 | c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro | 5e-22 | |
| d2bhua3 | 420 | c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro | 3e-05 | |
| d1mxga2 | 361 | c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo | 4e-21 | |
| d1mxga2 | 361 | c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo | 3e-09 | |
| d2fhfa5 | 563 | c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p | 5e-21 | |
| d2fhfa5 | 563 | c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p | 0.002 | |
| d1gcya2 | 357 | c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m | 2e-20 | |
| d1gcya2 | 357 | c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m | 1e-08 | |
| d1hvxa2 | 393 | c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu | 7e-20 | |
| d1jaea2 | 378 | c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea | 1e-19 | |
| d1jaea2 | 378 | c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea | 1e-08 | |
| d1ua7a2 | 344 | c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu | 2e-18 | |
| d1ua7a2 | 344 | c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu | 1e-06 | |
| d1g94a2 | 354 | c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa | 1e-17 | |
| d1g94a2 | 354 | c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa | 1e-06 | |
| d1hx0a2 | 403 | c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s | 2e-17 | |
| d1hx0a2 | 403 | c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s | 3e-06 |
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Isomaltulose synthase PalI species: Klebsiella sp., lx3 [TaxId: 576]
Score = 147 bits (370), Expect = 2e-42
Identities = 53/115 (46%), Positives = 82/115 (71%), Gaps = 1/115 (0%)
Query: 36 EWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADFG 95
WW+ +VFY +YPRSFKD+N DG+GD++G+IEKL +L LG+ A+WI+P + SP D G
Sbjct: 4 AWWKEAVFYQIYPRSFKDTNDDGIGDIRGIIEKLD-YLKSLGIDAIWINPHYDSPNTDNG 62
Query: 96 YDISDYLSFEPLFGDLKDFETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLAN 150
YDIS+Y +G ++DF++L + +++++D V NHTS+QH WF +S ++
Sbjct: 63 YDISNYRQIMKEYGTMEDFDSLVAEMKKRNMRLMIDVVINHTSDQHPWFIQSKSD 117
|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 100.0 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 100.0 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 100.0 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 100.0 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 100.0 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 100.0 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 100.0 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 100.0 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 100.0 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 100.0 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 100.0 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 100.0 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 100.0 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 100.0 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 100.0 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 100.0 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 100.0 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 99.98 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 99.98 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 99.97 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 99.97 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 99.97 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 99.96 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 99.95 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 99.94 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 99.94 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 99.94 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 99.93 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 99.93 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 99.93 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 99.92 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 99.91 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 99.91 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 98.86 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 98.78 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 98.65 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 98.39 | |
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 98.37 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 98.17 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 98.12 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 98.1 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 98.08 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 97.96 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 97.93 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 97.92 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 97.92 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 97.88 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 97.87 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 97.87 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 97.85 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 97.81 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 97.81 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 97.77 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 97.73 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 97.67 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 97.65 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 97.62 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 97.62 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 97.55 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 97.4 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 97.38 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 97.37 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 97.31 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 97.13 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 97.11 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 96.83 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 96.8 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 96.54 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 96.5 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 96.37 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 96.3 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 96.07 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 96.04 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 96.02 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 95.92 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 95.74 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 95.68 | |
| d1eswa_ | 500 | Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} | 95.39 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 95.33 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 95.26 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 95.15 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 95.14 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 95.02 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 94.9 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 94.54 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 94.49 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 94.06 | |
| d1tz7a1 | 485 | Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] | 94.01 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 93.98 | |
| d1x1na1 | 523 | Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax | 93.78 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 93.68 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 92.82 | |
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 92.38 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 91.93 | |
| d2gjxa1 | 362 | beta-hexosaminidase A {Human (Homo sapiens) [TaxId | 91.33 | |
| d1nowa1 | 353 | beta-hexosaminidase B {Human (Homo sapiens) [TaxId | 90.89 | |
| d1qbaa3 | 443 | Bacterial chitobiase (beta-N-acetylhexosaminidase) | 90.28 | |
| d1yhta1 | 344 | Dispersin B, DspB {Actinobacillus actinomycetemcom | 90.07 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 87.38 | |
| d1hl9a2 | 350 | Putative alpha-L-fucosidase, catalytic domain {The | 86.71 | |
| d1jaka1 | 356 | beta-N-acetylhexosaminidase {Streptomyces plicatus | 86.07 | |
| d2je8a5 | 348 | Five-domain beta-mannosidase, domain 3 {Bacteroide | 81.39 |
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Isomaltulose synthase PalI species: Klebsiella sp., lx3 [TaxId: 576]
Probab=100.00 E-value=9.1e-40 Score=293.64 Aligned_cols=159 Identities=37% Similarity=0.756 Sum_probs=141.5
Q ss_pred CCccCCCceEEEEecccccCcCCCCCCCHHHHHHHHHHHHHHcCCCeEEEcCcccCCCCCCCCCccCCCCcCCCCCCHHH
Q psy8670 34 PLEWWQTSVFYHLYPRSFKDSNGDGVGDLKGMIEKLPEHLHDLGVGAVWISPIFKSPMADFGYDISDYLSFEPLFGDLKD 113 (224)
Q Consensus 34 ~~~w~~~~viY~i~~~~f~~~~~~~~g~l~~~~~~l~~~l~~lG~~~i~l~Pi~~~~~~~~gY~~~d~~~v~~~~G~~~~ 113 (224)
.|+||+++|||||++++|+++++++.|||+|++++| +|||+||||+|||+||++++..+|||++.||++|||+|||++|
T Consensus 2 ~P~W~~~~viYei~~~~F~d~~~~~~Gd~~Gi~~kL-dyLk~LGv~~I~L~Pi~~~~~~~~GY~~~d~~~vd~~~Gt~~d 80 (478)
T d1m53a2 2 YPAWWKEAVFYQIYPRSFKDTNDDGIGDIRGIIEKL-DYLKSLGIDAIWINPHYDSPNTDNGYDISNYRQIMKEYGTMED 80 (478)
T ss_dssp CCCHHHHCCEEEECGGGTCCSSSSSSCCHHHHHHTH-HHHHHHTCCEEEECCCEECCCTTTTSSCSEEEEECGGGCCHHH
T ss_pred CCcccccCeEEEEecchhcCCCCCCccCHHHHHHhh-HHHHHcCCCEEEECCCCCCCCCCCCcCccCCCCcCcccCCHHH
Confidence 589999999999999999999999999999999999 9999999999999999999878899999999999999999999
Q ss_pred HHHHHHHHHHcCCEEEEecCCCCCCccchhHHhhhcC-CCCccccccchhcccCCC------------------cceeec
Q psy8670 114 FETLKERLHALGIKILLDFVPNHTSNQHEWFKKSLAN-IPPYKCASLLARLHDLGV------------------GAVWIS 174 (224)
Q Consensus 114 ~~~lv~~~h~~gi~vilD~v~nh~~~~~~w~~~~~~~-~~~~~~~f~w~~~~~lG~------------------~~~w~~ 174 (224)
|++||++||++||+||+|+|+||++.+|+||+..... ..++.++|.|.++..... ...++.
T Consensus 81 f~~Lv~~aH~~Gi~VilD~V~NH~~~~~~~f~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (478)
T d1m53a2 81 FDSLVAEMKKRNMRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDNQPPNNYPSFFGGSAWQKDAKSGQYYL 160 (478)
T ss_dssp HHHHHHHHHHTTCEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCSSSSCSSCCBCTTSSBSEEECTTTCCEEE
T ss_pred HHHHHHHHHHCCCEEEeccccccccccCchhhhcccCCCCCccccccccCCCcCCCCccccccCCCCccccccccCcccc
Confidence 9999999999999999999999999999999988754 678888888877543211 223344
Q ss_pred ccccCCCCCCCCcchhhHH
Q psy8670 175 PIFKSPMADFGYDISDYLR 193 (224)
Q Consensus 175 p~f~~~~~dlny~n~d~~~ 193 (224)
..|...++++|+.++++++
T Consensus 161 ~~~~~~~~dln~~~~~V~~ 179 (478)
T d1m53a2 161 HYFARQQPDLNWDNPKVRE 179 (478)
T ss_dssp CSSCTTCCBBCTTSHHHHH
T ss_pred cCcCCCCCcccchhHHHHH
Confidence 4566678999999999876
|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|