Psyllid ID: psy8713
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| 194384502 | 273 | unnamed protein product [Homo sapiens] | 0.715 | 0.809 | 0.447 | 4e-55 | |
| 496317 | 344 | Sarcophaga pro-cathepsin B [Sarcophaga p | 0.553 | 0.497 | 0.538 | 9e-54 | |
| 347972086 | 337 | AGAP004533-PA [Anopheles gambiae str. PE | 0.527 | 0.483 | 0.544 | 3e-53 | |
| 47217183 | 351 | unnamed protein product [Tetraodon nigro | 0.673 | 0.592 | 0.414 | 4e-53 | |
| 125981197 | 338 | GA10694 [Drosophila pseudoobscura pseudo | 0.553 | 0.505 | 0.547 | 7e-53 | |
| 312374701 | 335 | hypothetical protein AND_15621 [Anophele | 0.527 | 0.486 | 0.534 | 1e-51 | |
| 195438776 | 340 | GK16352 [Drosophila willistoni] gi|19416 | 0.553 | 0.502 | 0.542 | 1e-51 | |
| 195058549 | 340 | GH17748 [Drosophila grimshawi] gi|193896 | 0.734 | 0.667 | 0.395 | 2e-51 | |
| 14141821 | 340 | probable cathepsin B-like cysteine prote | 0.540 | 0.491 | 0.524 | 4e-51 | |
| 91078958 | 334 | PREDICTED: similar to cathepsin b [Tribo | 0.537 | 0.497 | 0.521 | 5e-51 |
| >gi|194384502|dbj|BAG59411.1| unnamed protein product [Homo sapiens] | Back alignment and taxonomy information |
|---|
Score = 221 bits (563), Expect = 4e-55, Method: Compositional matrix adjust.
Identities = 120/268 (44%), Positives = 160/268 (59%), Gaps = 47/268 (17%)
Query: 44 NSLSNIPRAHLKSWMGVHPDYNLPANRLPELIGYSEVDEDLPANFDSRTKWPNCPTIREI 103
++ N+ ++LK G L + P+ + ++E D LPA+FD+R +WP CPTI+EI
Sbjct: 45 HNFYNVDMSYLKRLCGTF----LGGPKPPQRVMFTE-DLKLPASFDAREQWPQCPTIKEI 99
Query: 104 RDQGSCGSCWGCRPYEIAPCEH--HVNGTRPSCDASKGHTPKCVRECQENYDVPYKKDLN 161
RDQGSCGSCW E HVNG+RP C +G TPKC + C+ Y YK+D +
Sbjct: 100 RDQGSCGSCWAFGAVEAISDRICIHVNGSRPPC-TGEGDTPKCSKICEPGYSPTYKQDKH 158
Query: 162 FGAKSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRFFVPGNETTAMSLIKWTI 221
+G SYSVS++EK IM EIY++GPVEGAF+V+ D +LYKSG +
Sbjct: 159 YGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVY----------------- 201
Query: 222 RDNTSQLGAEGAFTVFDDLILYKSGKALGGHAIRILGWGEDEKSKEKYWLIANSWNTDWG 281
+ +G+ +GGHAIRILGWG + + YWL+ANSWNTDWG
Sbjct: 202 --------------------QHVTGEMMGGHAIRILGWGVENGT--PYWLVANSWNTDWG 239
Query: 282 DNGLFKILRGKDECGIESSITAGVPKLD 309
DNG FKILRG+D CGIES + AG+P+ D
Sbjct: 240 DNGFFKILRGQDHCGIESEVVAGIPRTD 267
|
Source: Homo sapiens Species: Homo sapiens Genus: Homo Family: Hominidae Order: Primates Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|496317|dbj|BAA04103.1| Sarcophaga pro-cathepsin B [Sarcophaga peregrina] | Back alignment and taxonomy information |
|---|
| >gi|347972086|ref|XP_313835.5| AGAP004533-PA [Anopheles gambiae str. PEST] gi|333469165|gb|EAA09183.5| AGAP004533-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|47217183|emb|CAG11019.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|125981197|ref|XP_001354605.1| GA10694 [Drosophila pseudoobscura pseudoobscura] gi|54642915|gb|EAL31659.1| GA10694 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|312374701|gb|EFR22198.1| hypothetical protein AND_15621 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|195438776|ref|XP_002067308.1| GK16352 [Drosophila willistoni] gi|194163393|gb|EDW78294.1| GK16352 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195058549|ref|XP_001995463.1| GH17748 [Drosophila grimshawi] gi|193896249|gb|EDV95115.1| GH17748 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|14141821|gb|AAK07477.2|AF329480_1 probable cathepsin B-like cysteine proteinase precursor [Glossina morsitans morsitans] gi|289743431|gb|ADD20463.1| putative cathepsin B-like cysteine proteinase precursor [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|91078958|ref|XP_974220.1| PREDICTED: similar to cathepsin b [Tribolium castaneum] gi|270004841|gb|EFA01289.1| cathepsin B precursor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| FB|FBgn0030521 | 340 | CtsB1 "Cathepsin B1" [Drosophi | 0.394 | 0.358 | 0.539 | 3.8e-30 | |
| UNIPROTKB|F1N9D7 | 340 | CTSB "Cathepsin B" [Gallus gal | 0.411 | 0.373 | 0.461 | 2e-45 | |
| UNIPROTKB|E2R6Q7 | 339 | CTSB "Uncharacterized protein" | 0.359 | 0.327 | 0.530 | 8.6e-45 | |
| UNIPROTKB|A1E295 | 335 | CTSB "Cathepsin B" [Sus scrofa | 0.359 | 0.331 | 0.521 | 1.4e-44 | |
| UNIPROTKB|P07858 | 339 | CTSB "Cathepsin B" [Homo sapie | 0.359 | 0.327 | 0.513 | 1.8e-44 | |
| UNIPROTKB|P43233 | 340 | CTSB "Cathepsin B" [Gallus gal | 0.411 | 0.373 | 0.453 | 2.9e-44 | |
| ZFIN|ZDB-GENE-040426-2650 | 330 | ctsba "cathepsin B, a" [Danio | 0.288 | 0.269 | 0.573 | 5.2e-43 | |
| UNIPROTKB|Q6IN22 | 339 | Ctsb "Cathepsin B" [Rattus nor | 0.414 | 0.377 | 0.466 | 2.2e-27 | |
| RGD|621509 | 339 | Ctsb "cathepsin B" [Rattus nor | 0.414 | 0.377 | 0.466 | 2.2e-27 | |
| ZFIN|ZDB-GENE-070323-1 | 326 | ctsbb "capthepsin B, b" [Danio | 0.359 | 0.340 | 0.504 | 2.5e-39 |
| FB|FBgn0030521 CtsB1 "Cathepsin B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 333 (122.3 bits), Expect = 3.8e-30, P = 3.8e-30
Identities = 68/126 (53%), Positives = 82/126 (65%)
Query: 99 TIREIRDQGSCGSCWGCRPYEIAPCEHHVNGTRPSCDASKGHTPKCVRECQENYDVPYKK 158
T + I G GS GCRPYEI+PCEHHVNGTRP C A G TPKC CQ Y V Y K
Sbjct: 169 TRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPC-AHGGRTPKCSHVCQSGYTVDYAK 227
Query: 159 DLNFGAKSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRF-FVPGNETT--AMS 215
D +FG+KSYSV N + I +EI +GPVEGAFTV++DLILYK G + G E A+
Sbjct: 228 DKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKELGGHAIR 287
Query: 216 LIKWTI 221
++ W +
Sbjct: 288 ILGWGV 293
|
|
| UNIPROTKB|F1N9D7 CTSB "Cathepsin B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1E295 CTSB "Cathepsin B" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07858 CTSB "Cathepsin B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43233 CTSB "Cathepsin B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2650 ctsba "cathepsin B, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IN22 Ctsb "Cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|621509 Ctsb "cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070323-1 ctsbb "capthepsin B, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-71 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 1e-29 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 2e-29 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-21 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 3e-21 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 1e-17 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 3e-16 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 3e-13 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 7e-10 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 1e-08 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-08 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 6e-07 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 7e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 1e-06 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 2e-06 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 6e-06 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 3e-04 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 5e-04 |
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
Score = 220 bits (563), Expect = 2e-71
Identities = 100/282 (35%), Positives = 128/282 (45%), Gaps = 108/282 (38%)
Query: 85 PANFDSRTKWPNCPTIREIRDQGS------------------------------------ 108
P +FD+R KWPNC +I EIRDQG+
Sbjct: 1 PESFDAREKWPNCISIGEIRDQGNCGSCWAFSAVEAFSDRLCIQSNGKENVLLSAQDLLS 60
Query: 109 -CGSC------------W-----------GCRPYEIAPCEHHVNGTRPSCDASKGHTPKC 144
C C W GC+PY I PC HH G P C TP C
Sbjct: 61 CCSGCGDGCNGGYPDAAWKYLTTTGVVTGGCQPYTIPPCGHHPEGPPPCCG-----TPYC 115
Query: 145 VRECQENYDVPYKKDLNFGAKSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRF 204
+CQ+ + Y++D + G +YSV S+E IMKEI +GPV+ AFTV++D + YKSG
Sbjct: 116 TPKCQDGCEKTYEEDKHKGKSAYSVPSDETDIMKEIMTNGPVQAAFTVYEDFLYYKSG-- 173
Query: 205 FVPGNETTAMSLIKWTIRDNTSQLGAEGAFTVFDDLILYK--SGKALGGHAIRILGWGED 262
+Y+ SGK LGGHA++I+GWG +
Sbjct: 174 -------------------------------------VYQHTSGKQLGGHAVKIIGWGVE 196
Query: 263 EKSKEKYWLIANSWNTDWGDNGLFKILRGKDECGIESSITAG 304
YWL ANSW TDWG+NG F+ILRG +ECGIES + AG
Sbjct: 197 NG--VPYWLAANSWGTDWGENGYFRILRGSNECGIESEVVAG 236
|
Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236 |
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| KOG1544|consensus | 470 | 100.0 | ||
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.97 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.86 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.55 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.64 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 96.4 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 95.85 | |
| KOG1543|consensus | 325 | 94.22 | ||
| PF08127 | 41 | Propeptide_C1: Peptidase family C1 propeptide; Int | 93.63 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 93.08 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 90.55 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 87.46 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 84.23 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 81.65 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 80.78 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 80.21 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-51 Score=378.72 Aligned_cols=219 Identities=25% Similarity=0.512 Sum_probs=167.1
Q ss_pred CCCCCcccccccCCCCcHHHHHHHhCCCCCCCCCCCCCCcc-ccc-CCCCCCCCCceecCCCCCCCCCCccccCccCCCC
Q psy8713 34 GAYGSKQAEKNSLSNIPRAHLKSWMGVHPDYNLPANRLPEL-IGY-SEVDEDLPANFDSRTKWPNCPTIREIRDQGSCGS 111 (309)
Q Consensus 34 ~~~~s~~~g~Nf~~~~~~e~~~~~lg~~~~~~~~~~~~~~~-~~~-~~~~~~lP~~~DwR~~~~~cg~vtpVkdQg~CGS 111 (309)
++.+|-..|+|+|+|+++|||+++++...... . +.+.. ... .....+||++||||++ |+||||||||+|||
T Consensus 108 ~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~--~-~~~~~~~~~~~~~~~~lP~~fDWR~k----gaVTpVKnQG~CGS 180 (372)
T KOG1542|consen 108 NDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRG--S-KLPGDAAEAPIEPGESLPESFDWRDK----GAVTPVKNQGMCGS 180 (372)
T ss_pred cCccccccCccchhhcCHHHHHHHhhcccccc--c-cCccccccCcCCCCCCCCcccchhcc----CCccccccCCcCcc
Confidence 44579999999999999999888765543321 0 11111 111 2347789999999999 99999999999999
Q ss_pred Cc--------------------CCCccccCCCCCCCCCCCCCCCCCCC-------------------CCccccc-ccccC
Q psy8713 112 CW--------------------GCRPYEIAPCEHHVNGTRPSCDASKG-------------------HTPKCVR-ECQEN 151 (309)
Q Consensus 112 CW--------------------~cs~~~~~~C~~~~~g~~~~C~~~~~-------------------~~~~~~~-~c~~~ 151 (309)
|| +.|.|++.+|+.-+ ..|+++.. |+..-.+ .|...
T Consensus 181 CWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d----~gC~GGl~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~ 256 (372)
T KOG1542|consen 181 CWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCD----NGCNGGLMDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFD 256 (372)
T ss_pred hhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcC----CcCCCCChhHHHHHHHHhCCccccccCCccccCCCccccc
Confidence 99 66788899997643 34777653 3332222 33211
Q ss_pred cccccccccccee-eeeeecchHHHHHHHHHhcCCEEEEEecccccccCCCceEeCCCCcchhhhhhhhhhcccCcccCc
Q psy8713 152 YDVPYKKDLNFGA-KSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRFFVPGNETTAMSLIKWTIRDNTSQLGA 230 (309)
Q Consensus 152 ~~~~~~~~~~~~~-~~~~v~~~~~~ik~~l~~~GPv~v~~~~~~~f~~Y~sGiy~~~~~~~~~~~~~~~~i~~~~~~~~~ 230 (309)
. .+....+ ..+.++.||++|.+.|.++|||+|+|++ ..++.|.+||...-
T Consensus 257 ~-----~~~~v~I~~f~~l~~nE~~ia~wLv~~GPi~vgiNa-~~mQ~YrgGV~~P~----------------------- 307 (372)
T KOG1542|consen 257 K-----SKIVVSIKDFSMLSNNEDQIAAWLVTFGPLSVGINA-KPMQFYRGGVSCPS----------------------- 307 (372)
T ss_pred h-----hhceEEEeccEecCCCHHHHHHHHHhcCCeEEEEch-HHHHHhcccccCCC-----------------------
Confidence 1 1112222 3345677999999999999999999997 57899999999831
Q ss_pred CCcceeccccccccCCCccCCceEEEEEeeccCCC-CccEEEEEcCCCCCCCCCceEEEEccCCccccCcceEEEe
Q psy8713 231 EGAFTVFDDLILYKSGKALGGHAIRILGWGEDEKS-KEKYWLIANSWNTDWGDNGLFKILRGKDECGIESSITAGV 305 (309)
Q Consensus 231 ~~~~~~~~~~~~~~~~~~~~~HaV~iVGyg~~~~~-g~~YWiikNSWG~~WG~~Gy~~i~~g~n~cgi~~~~~~~~ 305 (309)
...|++..++|||+|||||.. . .++|||||||||++|||+|||||.||.|.|||++++++++
T Consensus 308 -----------~~~Cs~~~~~HaVLlvGyG~~--g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~ 370 (372)
T KOG1542|consen 308 -----------KYICSPKLLNHAVLLVGYGSS--GYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAA 370 (372)
T ss_pred -----------cccCCccccCceEEEEeecCC--CCCCceEEEECCccccccccceEEEeccccccccccchhhhh
Confidence 047988889999999999988 5 8999999999999999999999999999999999998765
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 309 | ||||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 9e-50 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 1e-49 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 2e-49 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-49 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 2e-49 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 2e-49 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 3e-49 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 4e-49 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 3e-48 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 5e-47 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 6e-47 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 6e-47 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 9e-37 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 7e-26 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 7e-26 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 8e-26 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 2e-17 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 2e-15 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 6e-12 | ||
| 1huc_A | 47 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 6e-10 | ||
| 1sp4_A | 48 | Crystal Structure Of Ns-134 In Complex With Bovine | 7e-10 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 3e-08 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 7e-08 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 1e-07 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 2e-07 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 2e-07 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 6e-07 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 6e-07 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 3e-06 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 6e-06 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 8e-06 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 8e-06 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 9e-06 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 1e-05 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 2e-05 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 2e-05 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 2e-05 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-05 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 2e-05 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-05 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-05 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 2e-05 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 3e-05 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-05 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 3e-05 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 4e-05 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 5e-05 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 5e-05 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 6e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 9e-05 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 1e-04 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-04 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-04 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 2e-04 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 2e-04 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-04 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-04 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 2e-04 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 2e-04 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 3e-04 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 3e-04 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 3e-04 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 3e-04 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 4e-04 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 5e-04 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 7e-04 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 7e-04 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 8e-04 |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
|
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1HUC|A Chain A, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 47 | Back alignment and structure |
| >pdb|1SP4|A Chain A, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 48 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 1e-80 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 1e-08 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 7e-72 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 1e-16 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 1e-09 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 4e-71 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 4e-15 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 9e-10 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 6e-70 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 6e-15 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 5e-10 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 5e-58 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 1e-07 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 5e-55 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 3e-05 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 2e-29 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 2e-15 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 7e-14 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 1e-12 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 3e-12 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 7e-12 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 7e-04 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 8e-12 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 2e-04 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 6e-11 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 2e-10 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 4e-10 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 8e-10 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 1e-09 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 1e-09 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-09 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 2e-09 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 2e-09 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 3e-09 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 3e-04 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 4e-09 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 4e-09 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 7e-04 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 5e-09 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 6e-09 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 6e-09 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 9e-09 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 9e-09 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 1e-08 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 2e-04 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 2e-08 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 2e-08 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 2e-08 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 3e-08 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 4e-08 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 6e-04 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 4e-08 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 5e-08 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 7e-08 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 7e-05 |
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
Score = 246 bits (630), Expect = 1e-80
Identities = 94/330 (28%), Positives = 121/330 (36%), Gaps = 105/330 (31%)
Query: 40 QAEKNS-LSNIPRAHLKSWMGVHPDYNLPANRLPELIGYSEVDEDLPANFDSRTKWPNCP 98
+A+ + + NI K GV N + E LP++FDS WPNCP
Sbjct: 27 KAKYDGVMQNITLREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCP 86
Query: 99 TIREIRDQGSCGSCW-------------------------------------GC------ 115
TI +I DQ +CGSCW GC
Sbjct: 87 TIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPD 146
Query: 116 ----------------RPYEIAPCEHHVNGTR--PSCDASKGHTPKCVRECQENYDVPYK 157
+PY C HH P C TPKC C +
Sbjct: 147 RAWAYFSSTGLVSDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCDYTCDDPT---IP 203
Query: 158 KDLNFGAKSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRFFVPGNETTAMSLI 217
SY++ E M+E++ GP E AF V++D I Y SG
Sbjct: 204 VVNYRSWTSYAL-QGEDDYMRELFFRGPFEVAFDVYEDFIAYNSG--------------- 247
Query: 218 KWTIRDNTSQLGAEGAFTVFDDLILYKSGKALGGHAIRILGWGEDEKSKEKYWLIANSWN 277
V+ SG+ LGGHA+R++GWG YW IANSWN
Sbjct: 248 ------------------VYHH----VSGQYLGGHAVRLVGWGTSN--GVPYWKIANSWN 283
Query: 278 TDWGDNGLFKILRGKDECGIESSITAGVPK 307
T+WG +G F I RG ECGIE +AG+P
Sbjct: 284 TEWGMDGYFLIRRGSSECGIEDGGSAGIPL 313
|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.92 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.91 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.66 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 97.65 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 97.08 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 96.75 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 93.52 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 91.29 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 90.71 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 90.52 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 88.68 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 87.7 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 87.69 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 87.66 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 87.25 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 86.62 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 86.27 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 86.23 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 86.2 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 86.09 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 85.69 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 85.25 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 85.2 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 85.16 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 84.67 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 84.27 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 84.24 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 84.22 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 84.22 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 84.08 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 83.86 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 83.6 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 83.13 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 82.81 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 82.81 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 82.76 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 82.5 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 82.03 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 81.23 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 80.02 |
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.8e-57 Score=423.57 Aligned_cols=240 Identities=48% Similarity=0.933 Sum_probs=185.9
Q ss_pred HHHHHHHhccccCCCCCCcccccccCCCCcHHHHHHHhCCCCCCCCCCCCCCcccccCCCCCCCCCceecCCCCCCCCCC
Q psy8713 21 AWRYWVKSGIVSGGAYGSKQAEKNSLSNIPRAHLKSWMGVHPDYNLPANRLPELIGYSEVDEDLPANFDSRTKWPNCPTI 100 (309)
Q Consensus 21 a~~~~~~~~~~~~~~~~s~~~g~Nf~~~~~~e~~~~~lg~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~~cg~v 100 (309)
.=++|.++|-. + .+|++|+| |+++++||++++||.++... . .+..... ....+||++||||++||+|+.|
T Consensus 11 ~~~~i~~~N~~---~-~~~~~~~n-f~~~~~e~~~~~lg~~~~~~--~--~~~~~~~-~~~~~lP~s~DwR~~~~~c~~v 80 (317)
T 3pbh_A 11 SDELVNYVNKR---N-TTWQAGHN-FYNVDMSYLKRLCGTFLGGP--K--PPQRVMF-TEDLKLPASFDAREQWPQCPTI 80 (317)
T ss_dssp CHHHHHHHHHH---T-CSEEECCC-CSSCCHHHHHHTCCBCTTCC--C--CSEEECC-CSCCCCCSSEEHHHHCTTCGGG
T ss_pred cHHHHHHHHCC---C-CCeEEeec-cccCCHHHHHHHcCCCCCcc--c--cCccccc-ccccCCCCCEechhccCCCCCc
Confidence 34677777732 3 48999999 77999999999999876541 1 1222211 1246899999999999999999
Q ss_pred ccccCccCCCCCc----------------------CCCccccCCC---------CCCC----------CC--------CC
Q psy8713 101 REIRDQGSCGSCW----------------------GCRPYEIAPC---------EHHV----------NG--------TR 131 (309)
Q Consensus 101 tpVkdQg~CGSCW----------------------~cs~~~~~~C---------~~~~----------~g--------~~ 131 (309)
+||||||.||||| ..|++++.+| .++. +| ..
T Consensus 81 tpVkdQg~CGSCWAFsa~~ale~~~~i~~~~~~~~~LSeq~LvdC~~~~~~~GC~GG~~~~A~~yi~~~Gi~te~~Y~~~ 160 (317)
T 3pbh_A 81 KEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESH 160 (317)
T ss_dssp TCCCBCCSSCCHHHHHHHHHHHHHHHHHTTTSCCCCBCHHHHHHHSCTTTBCGGGCBCHHHHHHHHHHTCEEBBCSTTCC
T ss_pred CCccccCCccchHHHHHHHHHHHHHHHHhCCCCcccCCHHHHHHhccccCCCCCCCCCHHHHHHHHHHhCCCcchhccCC
Confidence 9999999999999 2334444444 3321 00 01
Q ss_pred CCCCCCC------------------CCCcccccccccCccccccccccceeeeeeecchHHHHHHHHHhcCCEEEEEecc
Q psy8713 132 PSCDASK------------------GHTPKCVRECQENYDVPYKKDLNFGAKSYSVSSNEKSIMKEIYEHGPVEGAFTVF 193 (309)
Q Consensus 132 ~~C~~~~------------------~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~v~~~~~~ik~~l~~~GPv~v~~~~~ 193 (309)
..|.++. .+.+.|...|...+...+..+..+....|.++.++++||++|+++|||+|+|.++
T Consensus 161 ~~c~PY~~~~c~~~~~~~~~~C~~~~~~~~c~~~c~~~~~~~~~~~~~~~~~~~~v~~~e~~i~~~i~~~GPV~v~i~~~ 240 (317)
T 3pbh_A 161 VGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVY 240 (317)
T ss_dssp CBSSCCCSCCCCCCCTTCCSCCCSCCCCCCCCCSCCSSCCSCGGGSEECBCCCEEECSCHHHHHHHHHHHCCEEEEEEEE
T ss_pred CCCcCcccCcccccccCcCCCCCCcCCCCcccccccCCCccceeeeeeeeeecccCCcHHHHHHHHHHHCCCEEEEEEec
Confidence 1222322 1233444556655655666666676666788889999999999999999999999
Q ss_pred cccccCCCceEeCCCCcchhhhhhhhhhcccCcccCcCCcceeccccccccCCCccCCceEEEEEeeccCCCCccEEEEE
Q psy8713 194 DDLILYKSGRFFVPGNETTAMSLIKWTIRDNTSQLGAEGAFTVFDDLILYKSGKALGGHAIRILGWGEDEKSKEKYWLIA 273 (309)
Q Consensus 194 ~~f~~Y~sGiy~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HaV~iVGyg~~~~~g~~YWiik 273 (309)
++|++|++|||. ..|+...++|||+|||||++ ++++|||||
T Consensus 241 ~~f~~Y~~GVy~-------------------------------------~~~~~~~~~HaV~iVGyG~~--~g~~YWivk 281 (317)
T 3pbh_A 241 SDFLLYKSGVYQ-------------------------------------HVTGEMMGGHAIRILGWGVE--NGTPYWLVA 281 (317)
T ss_dssp GGGGGEEEEEEC-------------------------------------CCSCCEEEEEEEEEEEEEEE--TTEEEEEEE
T ss_pred ccccCCCCcEEc-------------------------------------cCCCCCCCCEEEEEEEEEEe--CCeeEEEEE
Confidence 999999999998 44666677999999999998 889999999
Q ss_pred cCCCCCCCCCceEEEEccCCccccCcceEEEeecCC
Q psy8713 274 NSWNTDWGDNGLFKILRGKDECGIESSITAGVPKLD 309 (309)
Q Consensus 274 NSWG~~WG~~Gy~~i~~g~n~cgi~~~~~~~~~~~~ 309 (309)
||||++|||+|||||+||.|+|||++.+++++|++|
T Consensus 282 NSWG~~WGe~GY~ri~rg~n~CgI~~~~~a~~p~~d 317 (317)
T 3pbh_A 282 NSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD 317 (317)
T ss_dssp CSBCTTSTBTTEEEEECSSCGGGTTTSCEECCBCCC
T ss_pred cCCCCCcCCCcEEEEEcCCCcccCCCceEeeecCCC
Confidence 999999999999999999999999999999999998
|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 309 | ||||
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-37 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 3e-31 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 6e-24 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 1e-23 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-22 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-22 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-21 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 4e-21 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 8e-21 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 4e-20 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-20 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 6e-20 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 6e-20 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 7e-20 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 8e-19 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-18 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 6e-18 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 7e-18 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 8e-18 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 1e-17 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 9e-05 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 0.002 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Score = 132 bits (332), Expect = 1e-37
Identities = 98/205 (47%), Positives = 124/205 (60%), Gaps = 40/205 (19%)
Query: 103 IRDQGSCGSCWGCRPYEIAPCEHHVNGTRPSCDASKGHTPKCVRECQENYDVPYKKDLNF 162
+ G S GCRPY I PCEHHVNG+RP C +G TPKC + C+ Y YK+D ++
Sbjct: 89 LVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCT-GEGDTPKCSKICEPGYSPTYKQDKHY 147
Query: 163 GAKSYSVSSNEKSIMKEIYEHGPVEGAFTVFDDLILYKSGRFFVPGNETTAMSLIKWTIR 222
G SYSVS++EK IM EIY++GPVEGAF+V+ D +LYKSG +
Sbjct: 148 GYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQ----------------- 190
Query: 223 DNTSQLGAEGAFTVFDDLILYKSGKALGGHAIRILGWGEDEKSKEKYWLIANSWNTDWGD 282
+ +G+ +GGHAIRILGWG + YWL+ANSWNTDWGD
Sbjct: 191 --------------------HVTGEMMGGHAIRILGWGVENG--TPYWLVANSWNTDWGD 228
Query: 283 NGLFKILRGKDECGIESSITAGVPK 307
NG FKILRG+D CGIES + AG+P+
Sbjct: 229 NGFFKILRGQDHCGIESEVVAGIPR 253
|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.93 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.59 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.3e-50 Score=372.42 Aligned_cols=238 Identities=20% Similarity=0.386 Sum_probs=174.7
Q ss_pred cchHHHHHHHHhccccCCCCCCcccccccCCCCcHHHHHHHhCCCCCCCCCCCCCCcccccCCCCCCCCCceecCCCCCC
Q psy8713 17 FPGMAWRYWVKSGIVSGGAYGSKQAEKNSLSNIPRAHLKSWMGVHPDYNLPANRLPELIGYSEVDEDLPANFDSRTKWPN 96 (309)
Q Consensus 17 ~~~~a~~~~~~~~~~~~~~~~s~~~g~Nf~~~~~~e~~~~~lg~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~~~~ 96 (309)
++..+.++|.+||.....+-.+|++|+|+|+|++.|||++++....... .............+||++||||++
T Consensus 34 iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~----~~~~~~~~~~~~~~lP~s~Dwr~~--- 106 (316)
T d1cs8a_ 34 VWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRK----PRKGKVFQEPLFYEAPRSVDWREK--- 106 (316)
T ss_dssp HHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCC----CSCCEECCCCTTCCCCSCEEGGGG---
T ss_pred HHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccc----cccCccccCcccccCCCceECCcC---
Confidence 4667788899999987766679999999999999999988887554331 111111222346789999999999
Q ss_pred CCCCccccCccCCCCCc--------------------CCCccccCCCCCCCCCCCCCCCCCC------------------
Q psy8713 97 CPTIREIRDQGSCGSCW--------------------GCRPYEIAPCEHHVNGTRPSCDASK------------------ 138 (309)
Q Consensus 97 cg~vtpVkdQg~CGSCW--------------------~cs~~~~~~C~~~~~g~~~~C~~~~------------------ 138 (309)
|+|+||||||.||||| ..|++++.+|.... ....|.++.
T Consensus 107 -g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~--~~~~c~gg~~~~a~~y~~~~g~~~~e~ 183 (316)
T d1cs8a_ 107 -GYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQ--GNEGCNGGLMDYAFQYVQDNGGLDSEE 183 (316)
T ss_dssp -TCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGG--TCCGGGCBCHHHHHHHHHHHTCEEBTT
T ss_pred -CcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccc--cCCCCCCCchHHHHHHHHhcCcccccc
Confidence 9999999999999999 45667777775421 122233322
Q ss_pred -CCCcccccccccCccccccccccceeee-eeecchHHHHHHHHHhcCCEEEEEecc-cccccCCCceEeCCCCcchhhh
Q psy8713 139 -GHTPKCVRECQENYDVPYKKDLNFGAKS-YSVSSNEKSIMKEIYEHGPVEGAFTVF-DDLILYKSGRFFVPGNETTAMS 215 (309)
Q Consensus 139 -~~~~~~~~~c~~~~~~~~~~~~~~~~~~-~~v~~~~~~ik~~l~~~GPv~v~~~~~-~~f~~Y~sGiy~~~~~~~~~~~ 215 (309)
+++..+...|...... ....... .....++++|+++|+++|||++++.+. .+|+.|.+|||..
T Consensus 184 ~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~l~~~l~~~gpv~v~i~~~~~~f~~y~~Gi~~~--------- 249 (316)
T d1cs8a_ 184 SYPYEATEESCKYNPKY-----SVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFE--------- 249 (316)
T ss_dssp TSCCCSSCCCCCCCGGG-----EEECCCCEEECCSCHHHHHHHHHHHCCEEEEECCCSHHHHTEEEEEECC---------
T ss_pred ccccccccccccccccc-----ccccccccccccCcHHHHHHHHHHhCCeEEEEEeccchhccccCCcccC---------
Confidence 2333333333221111 1111111 234568899999999999999999985 6799999999985
Q ss_pred hhhhhhcccCcccCcCCcceeccccccccCCCccCCceEEEEEeeccC--CCCccEEEEEcCCCCCCCCCceEEEEccC-
Q psy8713 216 LIKWTIRDNTSQLGAEGAFTVFDDLILYKSGKALGGHAIRILGWGEDE--KSKEKYWLIANSWNTDWGDNGLFKILRGK- 292 (309)
Q Consensus 216 ~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HaV~iVGyg~~~--~~g~~YWiikNSWG~~WG~~Gy~~i~~g~- 292 (309)
..|+...+||||+|||||.+. .++++|||||||||++|||+|||||+|+.
T Consensus 250 ---------------------------~~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~ 302 (316)
T d1cs8a_ 250 ---------------------------PDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRR 302 (316)
T ss_dssp ---------------------------TTCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSS
T ss_pred ---------------------------CCCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCC
Confidence 346666789999999999653 36889999999999999999999999986
Q ss_pred CccccCcceEEEe
Q psy8713 293 DECGIESSITAGV 305 (309)
Q Consensus 293 n~cgi~~~~~~~~ 305 (309)
|.|||++.+++++
T Consensus 303 n~CGI~~~~~yP~ 315 (316)
T d1cs8a_ 303 NHCGIASAASYPT 315 (316)
T ss_dssp SGGGTTTSCEEEC
T ss_pred CcCccCCeeeeee
Confidence 8999999987753
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|