Psyllid ID: psy8793


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
WHQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARNVLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISHYR
ccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHcccccccccccHHHHHcccccccccccccHHHHHcccccccccccccccHHcccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccccc
cHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccEcccccHHHccccccEccccccccccccccccEcccccccHHHHHHHHccccccccccHHcHHHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHcccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHH
whqgikqyqcsqcpkafnqkgnlkehfrihtgekpftcnicsrkfttySQVRRSSNTSARNVLKLStrkgtsrsISESIRernrspviyvaessplilRLGGILFIFTNLSGALVNAFyfgsggwwfksksshkiylghklhlkrhtgekphtcelcskgflsaesykchlrrhkgekpvtctfencTETFVESWAMRkhvrtchnkptvnrfpcdkcekvySCASSLTKHMkarlgrqpvscdichkefthpssvlyhkqsihnneifkctkcdKVFQHIQLLNRhqlvhmdtrpyqcpqcpmayktNISLSAHLMkhtgakpyVCEICNKVLTHRSSLISHYR
whqgikqyqcsqcpKAFNQKGNLKEHFRIHtgekpftcnicsRKFTtysqvrrssntsarnvlklstrkgtsrsisesirernrspviyvAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHlrrhkgekpvtctfeNCTETFVESWAMRKHVRtchnkptvnrfpcdkcEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRsslishyr
WHQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARNVLKLSTRKGTsrsisesirernrsPVIYVAESSPlilrlggilfifTNLSGALVNAFYfgsggwwfkskssHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISHYR
*********CSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYS*************************************VIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRS*******
WHQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARNVLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLI*HY*
WHQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTY***********RNVLK*****************RNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISHYR
****IKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARNVLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLI****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WHQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARNVLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFGSGGWWFKSKSSHKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISHYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query345 2.2.26 [Sep-21-2011]
P35789620 Zinc finger protein 93 OS yes N/A 0.950 0.529 0.340 4e-43
Q9P2J8865 Zinc finger protein 624 O no N/A 0.959 0.382 0.324 3e-41
Q6ZN57461 Zinc finger protein 2 hom no N/A 0.956 0.715 0.327 1e-40
Q14591655 Zinc finger protein 271 O no N/A 0.950 0.500 0.336 1e-40
Q9HCG1 818 Zinc finger protein 160 O no N/A 0.950 0.400 0.327 3e-40
Q5R8X1613 Zinc finger protein 665 O no N/A 0.950 0.535 0.327 4e-40
P08043459 Zinc finger protein 2 OS= no N/A 0.950 0.714 0.331 7e-40
Q8IYB9648 Zinc finger protein 595 O no N/A 0.878 0.467 0.328 9e-40
Q8C827 914 Zinc finger protein 62 OS no N/A 0.889 0.335 0.323 2e-39
Q3SYV7487 Zinc finger protein 345 O no N/A 0.959 0.679 0.318 2e-39
>sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 Back     alignment and function desciption
 Score =  175 bits (444), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 167/347 (48%), Gaps = 19/347 (5%)

Query: 2   HQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARN 61
           H G K Y+C +C KAFNQ   L +H +IHTGEKP+ C  C + F   S + +        
Sbjct: 251 HTGKKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYKCEECGKAFNQSSTLTKHKKIHTGE 310

Query: 62  VLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFG 121
              +    G +   S  +    R   I+  E  P      G  FI    S  L    +  
Sbjct: 311 KPYVCEECGKAFKYSRILTTHKR---IHTGEK-PYKCNKCGKAFI---ASSTLSRHEFIH 363

Query: 122 SGGWWFKSKSSHKIYLGHKL---HLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEK 178
            G   +K +   K ++   +   H + HTGEKP+ CE C K F  + +   H R H GEK
Sbjct: 364 MGKKHYKCEECGKAFIWSSVLTRHKRVHTGEKPYKCEECGKAFKYSSTLSSHKRSHTGEK 423

Query: 179 PVTCTFENCTETFVESWAMRKH-VRTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLG 237
           P  C  E C + FV S  + KH +     KP    + C++C K ++ +SSLTKH K   G
Sbjct: 424 PYKC--EECGKAFVASSTLSKHEIIHTGKKP----YKCEECGKAFNQSSSLTKHKKIHTG 477

Query: 238 RQPVSCDICHKEFTHPSSVLYHKQSIHNNE-IFKCTKCDKVFQHIQLLNRHQLVHMDTRP 296
            +P  C+ C K F   SS+  HK+ IH  E  +KC +C K F     L +H+ +H   +P
Sbjct: 478 EKPYKCEECGKAFNQSSSLTKHKK-IHTGEKPYKCEECGKAFNQSSTLIKHKKIHTREKP 536

Query: 297 YQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISH 343
           Y+C +C  A+  +  L+ H + HTG KPY C  C K   H ++L SH
Sbjct: 537 YKCEECGKAFHLSTHLTTHKILHTGEKPYRCRECGKAFNHSATLSSH 583




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=2 SV=3 Back     alignment and function description
>sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 Back     alignment and function description
>sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 Back     alignment and function description
>sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 Back     alignment and function description
>sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=2 SV=1 Back     alignment and function description
>sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
326666708 839 PREDICTED: zinc finger protein 135 [Dani 0.950 0.390 0.357 2e-44
326667255 908 PREDICTED: zinc finger protein 91-like [ 0.965 0.366 0.336 6e-43
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.950 0.235 0.336 8e-43
326681231 468 PREDICTED: zinc finger protein 271-like 0.933 0.688 0.362 1e-42
328711363 643 PREDICTED: zinc finger protein 845-like 0.947 0.508 0.318 1e-42
326666826434 PREDICTED: zinc finger protein 135-like 0.956 0.760 0.352 2e-42
326667224437 PREDICTED: zinc finger protein 135-like 0.950 0.750 0.350 3e-42
397522308 1103 PREDICTED: zinc finger protein 624-like 0.947 0.296 0.346 8e-42
260795613 583 hypothetical protein BRAFLDRAFT_65381 [B 0.971 0.574 0.317 8e-42
326667171 681 PREDICTED: zinc finger protein 850-like 0.953 0.483 0.337 2e-41
>gi|326666708|ref|XP_003198345.1| PREDICTED: zinc finger protein 135 [Danio rerio] Back     alignment and taxonomy information
 Score =  186 bits (471), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/347 (35%), Positives = 176/347 (50%), Gaps = 19/347 (5%)

Query: 2   HQGIKQYQCSQCPKAFNQKGNLKEHFRIHTGEKPFTCNICSRKFTTYSQVRRSSNTSARN 61
           H G K + C+QC K+FN+  +L +H RIHTGEKPFTC  C + F   S + + +      
Sbjct: 71  HTGEKPFTCTQCGKSFNRSEHLNDHMRIHTGEKPFTCIQCGKSFNCLSNLNKHTRIHTGK 130

Query: 62  VLKLSTRKGTSRSISESIRERNRSPVIYVAESSPLILRLGGILFIFTNLSGALVNAFYFG 121
                T+ G S S S S+   N+  +I+  E  P      G  FI    S +L       
Sbjct: 131 KPFTCTQCGNSFSCSSSL---NQHMMIHTGEK-PFTCTQCGKSFI---RSSSLKLHMRIH 183

Query: 122 SGGWWFKSKSSHKIYLGH---KLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEK 178
           +G   F      K ++     KLH++ HTG+KP TC  C K F  + S   H+R H GEK
Sbjct: 184 TGEKPFTCTQCGKSFIKSSSLKLHMRIHTGDKPFTCTQCGKSFSQSSSLNHHMRIHTGEK 243

Query: 179 PVTCTFENCTETFVESWAMRKHVRT-CHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLG 237
           P TCT   C + F++S ++  H+     ++P    F C +C K +SC+S L  H++   G
Sbjct: 244 PFTCT--QCGKNFIKSSSLNHHIGIHTGDRP----FTCTQCGKSFSCSSHLNHHIRIHTG 297

Query: 238 RQPVSCDICHKEFTHPSSVLYHKQSIHNNE-IFKCTKCDKVFQHIQLLNRHQLVHMDTRP 296
            +P +C  C K F+  SS L H   IH  E  F CT+C K F     LN H ++H   +P
Sbjct: 298 EKPFTCTQCGKSFS-CSSHLNHHMRIHTGEKPFTCTQCGKSFSRSSSLNIHMMIHTGEKP 356

Query: 297 YQCPQCPMAYKTNISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISH 343
           + C QC  ++  ++SL+ H M HTG KP+ C  C K  +  SSL  H
Sbjct: 357 FTCTQCGKSFNKSLSLNLHKMSHTGEKPFTCNQCGKSFSQSSSLNIH 403




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667255|ref|XP_003198540.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326681231|ref|XP_003201754.1| PREDICTED: zinc finger protein 271-like [Danio rerio] Back     alignment and taxonomy information
>gi|328711363|ref|XP_001946669.2| PREDICTED: zinc finger protein 845-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|326666826|ref|XP_003198388.1| PREDICTED: zinc finger protein 135-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667224|ref|XP_003198532.1| PREDICTED: zinc finger protein 135-like [Danio rerio] Back     alignment and taxonomy information
>gi|397522308|ref|XP_003831216.1| PREDICTED: zinc finger protein 624-like isoform 3 [Pan paniscus] Back     alignment and taxonomy information
>gi|260795613|ref|XP_002592799.1| hypothetical protein BRAFLDRAFT_65381 [Branchiostoma floridae] gi|229278023|gb|EEN48810.1| hypothetical protein BRAFLDRAFT_65381 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|326667171|ref|XP_003198510.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
ZFIN|ZDB-GENE-110913-144429 si:dkeyp-85d8.5 "si:dkeyp-85d8 0.588 0.473 0.398 1.8e-54
ZFIN|ZDB-GENE-110913-126346 si:dkeyp-4f2.5 "si:dkeyp-4f2.5 0.588 0.586 0.402 4.8e-54
ZFIN|ZDB-GENE-110914-67357 si:ch211-64i20.4 "si:ch211-64i 0.568 0.549 0.405 6.1e-54
ZFIN|ZDB-GENE-110914-127 580 si:dkey-54f18.1 "si:dkey-54f18 0.568 0.337 0.410 9.9e-54
ZFIN|ZDB-GENE-110913-155460 si:dkey-40n15.2 "si:dkey-40n15 0.568 0.426 0.391 9.9e-54
ZFIN|ZDB-GENE-110913-177400 si:ch211-223a21.6 "si:ch211-22 0.568 0.49 0.405 1.6e-53
ZFIN|ZDB-GENE-110913-159 733 si:ch211-197f20.2 "si:ch211-19 0.568 0.267 0.400 2.5e-53
UNIPROTKB|F1MRQ1560 F1MRQ1 "Uncharacterized protei 0.571 0.351 0.362 1.1e-52
UNIPROTKB|J9P3X3 703 LOC100684599 "Uncharacterized 0.568 0.278 0.391 1.1e-52
ZFIN|ZDB-GENE-110913-173819 si:dkey-78k22.1 "si:dkey-78k22 0.571 0.240 0.386 1.3e-52
ZFIN|ZDB-GENE-110913-144 si:dkeyp-85d8.5 "si:dkeyp-85d8.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 1.8e-54, Sum P(2) = 1.8e-54
 Identities = 86/216 (39%), Positives = 120/216 (55%)

Query:   133 HKIYLGHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFV 192
             H  +L   LH++ HTGEKP TC  C K F  + S   H++ H GEKP TCT   C ++F 
Sbjct:   161 HSSFLN--LHMRIHTGEKPLTCPQCGKSFSKSSSLYKHMKIHTGEKPFTCT--QCGKSFY 216

Query:   193 ESWAMRKHVRTCHN--KPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEF 250
             +S  ++KH+R  H   KP    F C +C K ++C+S L KHM    G +P +C  C K F
Sbjct:   217 DSSYLKKHIRI-HTGEKP----FTCAQCGKSFNCSSHLKKHMMIHTGEKPFTCTQCGKSF 271

Query:   251 THPSSVLYHKQSIHNNEI-FKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTN 309
             +  SS LY    IH  E  F CT+C K F H   LN+H ++H   +P+ CPQC  ++  +
Sbjct:   272 SKSSS-LYRHMRIHTGEKPFTCTQCGKSFSHSSSLNQHIMIHTGEKPFTCPQCGKSFIHS 330

Query:   310 ISLSAHLMKHTGAKPYVCEICNKVLTHRSSLISHYR 345
              +L+ H+  HTG KP+ C  C K  +  S L  H +
Sbjct:   331 SNLNLHMRIHTGEKPFTCSQCGKSFSTSSHLKQHMK 366


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110913-126 si:dkeyp-4f2.5 "si:dkeyp-4f2.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-67 si:ch211-64i20.4 "si:ch211-64i20.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-127 si:dkey-54f18.1 "si:dkey-54f18.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-155 si:dkey-40n15.2 "si:dkey-40n15.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-177 si:ch211-223a21.6 "si:ch211-223a21.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRQ1 F1MRQ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3X3 LOC100684599 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 37.4 bits (87), Expect = 3e-04
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 22 NLKEHFRIHTGEKPFTCNICSRKFTT 47
          NL+ H R HTGEKP+ C +C + F++
Sbjct: 1  NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
KOG1074|consensus 958 99.97
KOG2462|consensus279 99.96
KOG1074|consensus 958 99.95
KOG2462|consensus279 99.94
KOG3608|consensus467 99.94
KOG3623|consensus 1007 99.91
KOG3608|consensus 467 99.91
KOG3623|consensus1007 99.87
KOG3576|consensus267 99.71
KOG3576|consensus267 99.59
PLN03086567 PRLI-interacting factor K; Provisional 99.34
PLN03086567 PRLI-interacting factor K; Provisional 99.28
PHA00733128 hypothetical protein 99.22
PHA00733128 hypothetical protein 99.21
PHA0276855 hypothetical protein; Provisional 99.17
PHA0276855 hypothetical protein; Provisional 99.0
KOG3993|consensus500 98.87
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.87
KOG3993|consensus500 98.86
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.76
PHA0061644 hypothetical protein 98.71
PHA0061644 hypothetical protein 98.58
PHA0073279 hypothetical protein 98.5
PHA0073279 hypothetical protein 98.5
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.24
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.23
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.11
COG5189423 SFP1 Putative transcriptional repressor regulating 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.81
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.81
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.69
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.65
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.59
COG5189423 SFP1 Putative transcriptional repressor regulating 97.55
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.5
KOG2785|consensus390 97.33
smart0035526 ZnF_C2H2 zinc finger. 97.1
KOG2231|consensus 669 97.04
smart0035526 ZnF_C2H2 zinc finger. 97.03
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.91
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.89
PRK04860160 hypothetical protein; Provisional 96.89
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.89
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.87
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.82
COG5048467 FOG: Zn-finger [General function prediction only] 96.81
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.8
PRK04860160 hypothetical protein; Provisional 96.73
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.63
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.59
KOG2482|consensus423 96.51
KOG2785|consensus 390 96.47
KOG1146|consensus 1406 96.15
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.98
KOG2231|consensus 669 95.94
KOG2482|consensus423 95.92
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.57
KOG1146|consensus 1406 95.4
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.95
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.83
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.72
KOG4173|consensus253 94.46
COG5048467 FOG: Zn-finger [General function prediction only] 94.39
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 94.18
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.13
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.01
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.74
KOG4173|consensus253 93.71
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.92
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.98
KOG2893|consensus 341 91.9
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.04
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 90.78
COG404965 Uncharacterized protein containing archaeal-type C 90.0
KOG2186|consensus276 89.94
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 89.73
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.69
KOG2893|consensus341 89.51
COG404965 Uncharacterized protein containing archaeal-type C 88.59
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 88.26
PRK06266178 transcription initiation factor E subunit alpha; V 86.51
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.16
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 84.91
PF1371937 zinc_ribbon_5: zinc-ribbon domain 84.62
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 84.48
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 83.96
KOG2186|consensus 276 83.78
smart00531147 TFIIE Transcription initiation factor IIE. 83.57
KOG2807|consensus378 83.51
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 83.4
COG1592166 Rubrerythrin [Energy production and conversion] 82.79
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.48
PRK00464154 nrdR transcriptional regulator NrdR; Validated 82.03
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 81.77
PF1371736 zinc_ribbon_4: zinc-ribbon domain 81.3
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 81.0
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 80.53
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 80.46
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 80.39
PHA0062659 hypothetical protein 80.23
>KOG1074|consensus Back     alignment and domain information
Probab=99.97  E-value=3.3e-32  Score=241.67  Aligned_cols=113  Identities=27%  Similarity=0.620  Sum_probs=96.9

Q ss_pred             CCcccccccccccCCHHHHHHHHhhhcCCCCccccccccCccccchHhHHHHhhhhcCCCCC-CccccC---CCcccccC
Q psy8793         149 EKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTV-NRFPCD---KCEKVYSC  224 (345)
Q Consensus       149 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~~~~~~~~-~~~~C~---~C~~~f~~  224 (345)
                      ..|..|-+|-++..-+..|+.|++.|.+++||+|.  .|++.|+++.+|+.|+-.|-..+.. ..+.|+   +|.+.|.+
T Consensus       603 TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCK--iCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn  680 (958)
T KOG1074|consen  603 TDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCK--ICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTN  680 (958)
T ss_pred             CCccceeeeeecccchhhhhhhhhcccCcCccccc--cccchhccccchhhcccccccCccccccccCCchhhhcccccc
Confidence            34689999999999999999999999999999998  6999999999999999998776544 458899   99999999


Q ss_pred             hhhHHHHHHHhcCCC-------------CccCccccccCCChhHHHHHhhhh
Q psy8793         225 ASSLTKHMKARLGRQ-------------PVSCDICHKEFTHPSSVLYHKQSI  263 (345)
Q Consensus       225 ~~~l~~H~~~~~~~~-------------~~~C~~C~~~f~~~~~l~~H~~~~  263 (345)
                      .-.+..|+++|.+..             .-.|+.|.+.|.....+..++..+
T Consensus       681 ~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~  732 (958)
T KOG1074|consen  681 AVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQ  732 (958)
T ss_pred             cccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhcc
Confidence            999999999987321             135888999887777777776655



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>KOG2807|consensus Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 7e-22
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-12
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-04
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 6e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-08
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 4e-08
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 9e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 5e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-08
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 6e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 8e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 9e-07
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 7e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 8e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-05
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 6e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 8e-05
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 7e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 101 bits (251), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 57/198 (28%), Positives = 85/198 (42%), Gaps = 33/198 (16%) Query: 148 GEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNK 207 GEKP+ C C K F ++ H R H GEKP Sbjct: 18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKP---------------------------- 49 Query: 208 PTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNE 267 + C +C K +S LT+H + G +P C C K F+ +++ H+++ + Sbjct: 50 -----YKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEK 104 Query: 268 IFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHTGAKPYVC 327 + C +C K F + L HQ H +PY+CP+C ++ +L H HTG KPY C Sbjct: 105 PYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKC 164 Query: 328 EICNKVLTHRSSLISHYR 345 C K + R +L H R Sbjct: 165 PECGKSFSRRDALNVHQR 182
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-31
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 7e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-09
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-12
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 7e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 3e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  116 bits (294), Expect = 1e-31
 Identities = 60/205 (29%), Positives = 84/205 (40%), Gaps = 35/205 (17%)

Query: 142 HLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHV 201
                 GEKP+ C  C K F  ++    H R H GEKP                      
Sbjct: 12  QAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKP---------------------- 49

Query: 202 RTCHNKPTVNRFPCDKCEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQ 261
                      + C +C K +S    LT+H +   G +P  C  C K F+  +++  H Q
Sbjct: 50  -----------YKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAH-Q 97

Query: 262 SIHNNEI-FKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKHT 320
             H  E  + C +C K F  +  L  HQ  H   +PY+CP+C  ++    +L  H   HT
Sbjct: 98  RTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHT 157

Query: 321 GAKPYVCEICNKVLTHRSSLISHYR 345
           G KPY C  C K  + R +L  H R
Sbjct: 158 GEKPYKCPECGKSFSRRDALNVHQR 182


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.82
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.76
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.7
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.66
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.64
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.63
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.59
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.59
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.56
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.55
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.54
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.54
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.53
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.53
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.5
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.48
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.47
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.47
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.46
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.45
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.42
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.36
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.35
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.34
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.31
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.29
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.29
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.26
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.25
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.22
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.2
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.2
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.2
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.19
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.19
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.17
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.16
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.1
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.1
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.07
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.02
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.0
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.96
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.92
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.88
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.86
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.83
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.82
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.79
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.78
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.76
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.73
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.68
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.65
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.62
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.6
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.6
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.59
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.55
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.49
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.45
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.41
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.39
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.39
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.36
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.36
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.34
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.33
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.33
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.32
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.31
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.31
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.3
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.3
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.28
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.28
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.27
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.26
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.25
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.25
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.24
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.23
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.22
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.22
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.21
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.21
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.2
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.2
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.5
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.19
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.47
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.46
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.16
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.34
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.06
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.33
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.9
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.87
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.8
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.72
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.27
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.94
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.91
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.89
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.81
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.64
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.47
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.43
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.94
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.42
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 92.33
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.63
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 90.6
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 90.17
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.93
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 89.57
2k5c_A95 Uncharacterized protein PF0385; structural genomic 87.62
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 86.77
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.17
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 85.59
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 84.83
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 84.03
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.76
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 83.65
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 81.05
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 80.98
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 80.58
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 80.56
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 80.35
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 80.24
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=4e-38  Score=251.16  Aligned_cols=183  Identities=30%  Similarity=0.647  Sum_probs=141.8

Q ss_pred             cccceeccccCCCcccccccccccCCHHHHHHHHhhhcCCCCccccccccCccccchHhHHHHhhhhcCCCCCCccccCC
Q psy8793         138 GHKLHLKRHTGEKPHTCELCSKGFLSAESYKCHLRRHKGEKPVTCTFENCTETFVESWAMRKHVRTCHNKPTVNRFPCDK  217 (345)
Q Consensus       138 ~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~  217 (345)
                      .+..|+..+.++++|.|+.|++.|.+...|..|++.|.++++|.|.  .|+..|.+...|..|+..|++.   .+|.|+.
T Consensus         8 ~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~---~~~~C~~   82 (190)
T 2i13_A            8 SSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCP--ECGKSFSDKKDLTRHQRTHTGE---KPYKCPE   82 (190)
T ss_dssp             -----------------------CCSSHHHHHGGGCC---CCEECT--TTCCEESSHHHHHHHHHHHHCC---CCEECTT
T ss_pred             cchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCC--CcCchhCCHHHHHHHHHhcCCC---CCccCcc
Confidence            4556777888889999999999999999999999999999999997  6999999999999999998876   7799999


Q ss_pred             CcccccChhhHHHHHHHhcCCCCccCccccccCCChhHHHHHhhhhcCCceeecCcCccccCChHHHHHHHHHhCCCCCc
Q psy8793         218 CEKVYSCASSLTKHMKARLGRQPVSCDICHKEFTHPSSVLYHKQSIHNNEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPY  297 (345)
Q Consensus       218 C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  297 (345)
                      |++.|.+...|..|++.|.++++|.|+.|++.|.+...|..|+..|+++++|.|++|++.|.+.+.|..|+++|+++++|
T Consensus        83 C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~  162 (190)
T 2i13_A           83 CGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPY  162 (190)
T ss_dssp             TCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCE
T ss_pred             cCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccccCChHHHHHHhhhhcCCCcc
Q psy8793         298 QCPQCPMAYKTNISLSAHLMKHTGAKPY  325 (345)
Q Consensus       298 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~  325 (345)
                      .|++|++.|.....|..|+++|+|++||
T Consensus       163 ~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          163 KCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             ECTTTCCEESSHHHHHHHHTTC------
T ss_pred             ECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            9999999999999999999999999886



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 345
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 8e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 9e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.004
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.1 bits (123), Expect = 1e-09
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 6  KQYQCSQCPKAFNQKGNLKEHFR-IHTGEKPFTCNI 40
          K Y C  C K F++  +L  H + +HT E+P  C +
Sbjct: 4  KPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.68
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.67
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.32
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.27
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.21
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.2
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.2
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.2
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.15
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.13
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.11
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.09
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.09
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.06
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.0
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.98
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.9
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.8
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.78
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.77
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.69
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.56
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.52
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.52
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.34
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.2
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.17
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.04
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.97
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.96
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.93
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.88
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.8
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.75
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.68
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.65
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.64
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.64
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.57
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.55
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.54
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.53
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.48
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.32
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.14
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.08
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.06
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.06
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.97
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.95
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.95
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.93
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.89
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.82
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.8
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.68
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.67
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.65
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.61
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.55
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.54
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.26
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.07
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.05
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.81
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.72
d1y0jb136 U-shaped transcription factor, different fingers { 95.7
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.41
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.18
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.02
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.82
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.79
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.4
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.38
d1y0jb136 U-shaped transcription factor, different fingers { 93.9
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.53
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.42
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.34
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.96
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.88
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.84
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.6
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.47
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.95
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.74
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.26
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.42
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.29
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 89.12
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.81
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 87.15
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 86.56
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 86.39
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 85.96
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 85.85
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 84.68
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 82.47
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 82.3
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=1.5e-17  Score=99.68  Aligned_cols=53  Identities=32%  Similarity=0.756  Sum_probs=37.5

Q ss_pred             CceeecCcCccccCChHHHHHHHHHhCCCCCcCCCCCccccCChHHHHHHhhhh
Q psy8793         266 NEIFKCTKCDKVFQHIQLLNRHQLVHMDTRPYQCPQCPMAYKTNISLSAHLMKH  319 (345)
Q Consensus       266 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  319 (345)
                      ++||.| .||+.|...+.|..|+++|++++||.|.+||++|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            456777 37777777777777777777777777777777777777777776665



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure