Psyllid ID: psy8885


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MIDKGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLRRLFRQKEESTRRLSNIIA
ccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccEEEEEEEEccccEEEEEEEEccccEEEEcccccHHEHHHHHccccHHHHHHHHcccc
ccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccEEEEccccEEccccccEEcHHHEEEEEEEcccccEEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
midkgngyVRLMVKKVAKEgynftfgnesvSTFVTAFYDAVILYSIALNEtiamggsqsdgsaITRRMWnrtyqdpksilptttplrLVHKYILYYVIplcnhkctiANSILSQQYVAWSQTLRLEKKLRRLFRQKEESTRRLSNIIA
midkgngyvRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRtyqdpksilptttpLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLrrlfrqkeestrrlsniia
MIDKGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTlrlekklrrlfrqkeeSTRRLSNIIA
******GYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGG*****SAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLRRL****************
***KGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLR******************LSNI**
MIDKGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLRRLFRQ*************
*IDKGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLRRLFRQKEEST*****II*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDKGNGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDPKSILPTTTPLRLVHKYILYYVIPLCNHKCTIANSILSQQYVAWSQTLRLEKKLRRLFRQKEESTRRLSNIIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
P16066 1061 Atrial natriuretic peptid yes N/A 0.418 0.058 0.451 2e-10
P18293 1057 Atrial natriuretic peptid yes N/A 0.418 0.058 0.403 8e-09
P18910 1057 Atrial natriuretic peptid yes N/A 0.418 0.058 0.403 1e-08
P17342541 Atrial natriuretic peptid no N/A 0.378 0.103 0.406 6e-07
P41740535 Atrial natriuretic peptid no N/A 0.378 0.104 0.406 1e-06
P55202 1050 Atrial natriuretic peptid N/A N/A 0.594 0.083 0.326 1e-06
P70180536 Atrial natriuretic peptid no N/A 0.378 0.104 0.406 2e-06
P10730537 Atrial natriuretic peptid no N/A 0.304 0.083 0.444 6e-06
P20594 1047 Atrial natriuretic peptid no N/A 0.425 0.060 0.353 7e-06
P16067 1047 Atrial natriuretic peptid no N/A 0.425 0.060 0.338 3e-05
>sp|P16066|ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens GN=NPR1 PE=1 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (70%)

Query: 13  VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72
           +K +A E +NFT  +  V+T   +F+D ++LY  A+ ET+A GG+ +DG  IT+RMWNR+
Sbjct: 329 LKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRS 388

Query: 73  YQ 74
           +Q
Sbjct: 389 FQ 390




Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 6EC: .EC: 1EC: .EC: 2
>sp|P18293|ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus GN=Npr1 PE=2 SV=2 Back     alignment and function description
>sp|P18910|ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus GN=Npr1 PE=1 SV=1 Back     alignment and function description
>sp|P17342|ANPRC_HUMAN Atrial natriuretic peptide receptor 3 OS=Homo sapiens GN=NPR3 PE=1 SV=2 Back     alignment and function description
>sp|P41740|ANPRC_RAT Atrial natriuretic peptide receptor 3 OS=Rattus norvegicus GN=Npr3 PE=2 SV=1 Back     alignment and function description
>sp|P55202|ANPRB_ANGJA Atrial natriuretic peptide receptor 2 OS=Anguilla japonica GN=npr2 PE=2 SV=1 Back     alignment and function description
>sp|P70180|ANPRC_MOUSE Atrial natriuretic peptide receptor 3 OS=Mus musculus GN=Npr3 PE=1 SV=3 Back     alignment and function description
>sp|P10730|ANPRC_BOVIN Atrial natriuretic peptide receptor 3 OS=Bos taurus GN=NPR3 PE=1 SV=2 Back     alignment and function description
>sp|P20594|ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens GN=NPR2 PE=1 SV=1 Back     alignment and function description
>sp|P16067|ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus GN=Npr2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
242014720 664 Guanylate cyclase 32E precursor, putativ 0.418 0.093 0.661 7e-18
321461543 1050 hypothetical protein DAPPUDRAFT_201000 [ 0.412 0.058 0.557 6e-14
291229636 1035 PREDICTED: natriuretic peptide receptor 0.418 0.059 0.580 1e-13
340725323 1453 PREDICTED: atrial natriuretic peptide re 0.418 0.042 0.578 5e-13
350403823 1453 PREDICTED: atrial natriuretic peptide re 0.418 0.042 0.578 6e-13
345493253 1322 PREDICTED: atrial natriuretic peptide re 0.418 0.046 0.578 7e-13
328783669 1436 PREDICTED: atrial natriuretic peptide re 0.418 0.043 0.578 1e-12
380016320 1351 PREDICTED: atrial natriuretic peptide re 0.418 0.045 0.578 1e-12
307212159 555 Atrial natriuretic peptide receptor A [H 0.418 0.111 0.562 2e-12
332029271 867 Atrial natriuretic peptide receptor A [A 0.418 0.071 0.546 7e-12
>gi|242014720|ref|XP_002428033.1| Guanylate cyclase 32E precursor, putative [Pediculus humanus corporis] gi|212512552|gb|EEB15295.1| Guanylate cyclase 32E precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 57/62 (91%)

Query: 13  VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72
           VK++A++ YN++FG++SVSTF+TAFYDAVILYS+ALNE+I  GGS+ +G+ ITRRMWNRT
Sbjct: 228 VKELAEKNYNYSFGDDSVSTFITAFYDAVILYSLALNESIREGGSEVNGNDITRRMWNRT 287

Query: 73  YQ 74
           ++
Sbjct: 288 FK 289




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321461543|gb|EFX72574.1| hypothetical protein DAPPUDRAFT_201000 [Daphnia pulex] Back     alignment and taxonomy information
>gi|291229636|ref|XP_002734779.1| PREDICTED: natriuretic peptide receptor 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|340725323|ref|XP_003401021.1| PREDICTED: atrial natriuretic peptide receptor 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403823|ref|XP_003486915.1| PREDICTED: atrial natriuretic peptide receptor 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345493253|ref|XP_001603765.2| PREDICTED: atrial natriuretic peptide receptor 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328783669|ref|XP_001121839.2| PREDICTED: atrial natriuretic peptide receptor 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016320|ref|XP_003692135.1| PREDICTED: atrial natriuretic peptide receptor 1-like [Apis florea] Back     alignment and taxonomy information
>gi|307212159|gb|EFN88013.1| Atrial natriuretic peptide receptor A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332029271|gb|EGI69254.1| Atrial natriuretic peptide receptor A [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
FB|FBgn0034568 1161 CG3216 [Drosophila melanogaste 0.418 0.053 0.539 3.3e-11
UNIPROTKB|F1SFW3 831 NPR1 "Guanylate cyclase" [Sus 0.418 0.074 0.467 7.2e-11
UNIPROTKB|E1BN71 1064 NPR1 "Guanylate cyclase" [Bos 0.418 0.058 0.451 7.1e-10
FB|FBgn0051183 1417 CG31183 [Drosophila melanogast 0.459 0.047 0.453 1.3e-09
WB|WBGene00020131 1276 gcy-28 [Caenorhabditis elegans 0.425 0.049 0.5 1.4e-09
UNIPROTKB|P16066 1061 NPR1 "Atrial natriuretic pepti 0.418 0.058 0.451 2.4e-09
UNIPROTKB|F1PMP1 1060 NPR1 "Guanylate cyclase" [Cani 0.418 0.058 0.451 1.7e-08
MGI|MGI:97371 1057 Npr1 "natriuretic peptide rece 0.418 0.058 0.403 7.5e-08
RGD|3195 1057 Npr1 "natriuretic peptide rece 0.418 0.058 0.403 9.6e-08
UNIPROTKB|D6RDL8252 NPR3 "Atrial natriuretic pepti 0.378 0.222 0.406 1.3e-07
FB|FBgn0034568 CG3216 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 3.3e-11, P = 3.3e-11
 Identities = 34/63 (53%), Positives = 43/63 (68%)

Query:    13 VKKVAKEGYNFTFGN-ESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNR 71
             V++ A   YN+TFG  E V+ F+ AFYD V L  +ALNET+  GG   DG  ITRRMWNR
Sbjct:   393 VRENALYDYNYTFGEGEEVNFFIGAFYDGVYLLGMALNETLTEGGDIRDGVNITRRMWNR 452

Query:    72 TYQ 74
             T++
Sbjct:   453 TFE 455




GO:0004383 "guanylate cyclase activity" evidence=ISS;NAS
GO:0004872 "receptor activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0006182 "cGMP biosynthetic process" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IKR
GO:0006468 "protein phosphorylation" evidence=IKR
UNIPROTKB|F1SFW3 NPR1 "Guanylate cyclase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BN71 NPR1 "Guanylate cyclase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0051183 CG31183 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00020131 gcy-28 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P16066 NPR1 "Atrial natriuretic peptide receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMP1 NPR1 "Guanylate cyclase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97371 Npr1 "natriuretic peptide receptor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3195 Npr1 "natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D6RDL8 NPR3 "Atrial natriuretic peptide receptor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd06373396 cd06373, PBP1_NPR_like, Ligand binding domain of n 8e-29
cd06352389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 2e-18
cd06385405 cd06385, PBP1_NPR_A, Ligand-binding domain of type 1e-16
cd06386387 cd06386, PBP1_NPR_C_like, Ligand-binding domain of 2e-12
cd06384399 cd06384, PBP1_NPR_B, Ligand-binding domain of type 2e-11
cd06370404 cd06370, PBP1_Speract_GC_like, Ligand-binding doma 1e-09
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 4e-06
>gnl|CDD|107368 cd06373, PBP1_NPR_like, Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
 Score =  108 bits (271), Expect = 8e-29
 Identities = 35/62 (56%), Positives = 47/62 (75%)

Query: 13  VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72
           VK+ AK+ +N T  +  V+ F  AFYDAV+LY++ALNET+A GG   DG+ ITRRMWNRT
Sbjct: 288 VKERAKKKFNTTSDDSLVNFFAGAFYDAVLLYALALNETLAEGGDPRDGTNITRRMWNRT 347

Query: 73  YQ 74
           ++
Sbjct: 348 FE 349


Ligand binding domain of natriuretic peptide receptor (NPR) family which consists of three different subtypes: type A natriuretic peptide receptor (NPR-A, or GC-A), type B natriuretic peptide receptors (NPR-B, or GC-B), and type C natriuretic peptide receptor (NPR-C). There are three types of natriuretic peptide (NP) ligands specific to the receptors: atrial NP (ANP), brain or B-type NP (BNP), and C-type NP (CNP). The NP family is thought to have arisen through gene duplication during evolution and plays an essential role in cardiovascular and body fluid homeostasis. ANP and BNP bind mainly to NPR-A, while CNP binds specifically to NPR-B. Both NPR-A and NPR-B have guanylyl cyclase catalytic activity and produces intracellular secondary messenger cGMP in response to peptide-ligand binding. Consequently, the NPR-A activation results in vasodilation and inhibition of vascular smooth muscle cell proliferation. NPR-C acts as the receptor for all the three members of NP family, and functions as a clearance receptor. Unlike NPR-A and -B, NPR-C lacks an intracellular guanylyl cyclase domain and is thought to exert biological actions by sequestration of released natriuretic peptides and/or inhibition of adenylyl cyclase. Length = 396

>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|107380 cd06385, PBP1_NPR_A, Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>gnl|CDD|107381 cd06386, PBP1_NPR_C_like, Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>gnl|CDD|107379 cd06384, PBP1_NPR_B, Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.68
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 99.56
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 99.35
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 99.33
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 99.31
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 99.24
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 98.96
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 98.92
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 98.73
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 98.29
PF01094348 ANF_receptor: Receptor family ligand binding regio 98.1
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 97.86
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 97.82
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 97.65
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 97.53
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 97.22
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 96.87
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 96.81
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 96.76
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 96.75
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 96.7
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 96.45
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 96.38
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 96.28
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 95.86
KOG1055|consensus 865 95.67
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 95.24
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 94.94
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 94.5
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 93.02
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 92.33
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 92.13
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 91.64
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 90.9
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 90.5
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 88.59
cd06359333 PBP1_Nba_like Type I periplasmic binding component 87.73
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 86.96
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 84.69
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 82.96
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 81.95
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
Probab=99.68  E-value=7.4e-17  Score=141.46  Aligned_cols=63  Identities=13%  Similarity=0.265  Sum_probs=58.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHcCCCCCChHHHHHHhhcCccccc---------------cc---ccCCCCCcEEEEEee
Q psy8885          32 TFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDP---------------KS---ILPTTTPLRLVHKYI   93 (148)
Q Consensus        32 ~yaa~LyDAV~LYA~ALnetL~~g~~~~nGt~I~~~m~nrtF~Gv---------------ys---LD~~~g~f~vV~~Y~   93 (148)
                      .||++|||||+|||+||||+|++|+++.| ++|+++||||||+|+               |+   |++++++|+||++|+
T Consensus       285 ~~aa~fyDaVLLYa~AL~EtL~~G~~~~~-~~I~~~m~NrTF~GitG~V~IDeNGDRd~dfsLl~ms~~tg~y~vV~~y~  363 (380)
T cd06369         285 DYVAAYHDGVLLFGHVLKKFLESQEGVQT-FSFINEFRNISFEGAGGPYTLDEYGDRDVNFTLLYTSTDTSKYKVLFEFD  363 (380)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCCCCc-HHHHHHHhCcceecCCCceEeCCCCCccCceEEEEeeCCCCCeEEEEEEE
Confidence            99999999999999999999999999655 999999999999999               66   378889999999999


Q ss_pred             ec
Q psy8885          94 LY   95 (148)
Q Consensus        94 g~   95 (148)
                      +.
T Consensus       364 t~  365 (380)
T cd06369         364 TS  365 (380)
T ss_pred             CC
Confidence            84



Ligand-binding domain of the membrane guanylyl cyclase C (GC-C or StaR). StaR is a key receptor for the STa (Escherichia coli Heat Stable enterotoxin), a potent stimulant of intestinal chloride and bicarbonate secretion that cause acute secretory diarrhea. The catalytic domain of the STa/guanylin receptor type membrane GC is highly similar to those of the natriuretic peptide receptor (NPR) type and sensory organ-specific type membrane GCs (GC-D, GC-E and GC-F). The GC-C receptor is mainly expressed in the intestine of most vertebrates, but is also found in the kidney and other organs. Moreover, GC-C is activated by guanylin and uroguanylin, endogenous peptide ligands synthesized in the intestine and kidney. Consequently, the receptor activation results in increased cGMP levels and phosphorylation of the CFTR chloride channel and secretion.

>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>KOG1055|consensus Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1dp4_A435 Dimerized Hormone Binding Domain Of The Atrial Natr 1e-09
1yk1_A479 Structure Of Natriuretic Peptide Receptor-C Complex 4e-08
1yk0_B480 Structure Of Natriuretic Peptide Receptor-c Complex 4e-08
1jdn_A441 Crystal Structure Of Hormone Receptor Length = 441 5e-08
>pdb|1DP4|A Chain A, Dimerized Hormone Binding Domain Of The Atrial Natriuretic Peptide Receptor Length = 435 Back     alignment and structure

Iteration: 1

Score = 58.5 bits (140), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 42/62 (67%) Query: 13 VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72 +K +A + +NFT + + +F+D ++LY A+ ET+A GG+ +DG IT+RMWNR+ Sbjct: 297 LKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRS 356 Query: 73 YQ 74 +Q Sbjct: 357 FQ 358
>pdb|1YK1|A Chain A, Structure Of Natriuretic Peptide Receptor-C Complexed With Brain Natriuretic Peptide Length = 479 Back     alignment and structure
>pdb|1JDN|A Chain A, Crystal Structure Of Hormone Receptor Length = 441 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 1e-13
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 5e-10
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
 Score = 66.0 bits (160), Expect = 1e-13
 Identities = 25/64 (39%), Positives = 42/64 (65%)

Query: 13  VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72
           +K +A + +NFT  +   +    +F+D ++LY  A+ ET+A GG+ +DG  IT+RMWNR+
Sbjct: 297 LKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRS 356

Query: 73  YQDP 76
           +Q  
Sbjct: 357 FQGV 360


>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 99.63
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 98.65
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 98.5
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 98.35
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 98.05
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 97.91
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 97.88
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 97.88
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 97.71
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 97.51
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 97.25
3n0w_A379 ABC branched chain amino acid family transporter, 96.95
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 96.81
3h5l_A419 Putative branched-chain amino acid ABC transporter 96.75
4evq_A375 Putative ABC transporter subunit, substrate-bindi 96.67
3td9_A366 Branched chain amino acid ABC transporter, peripl 96.29
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 96.17
3snr_A362 Extracellular ligand-binding receptor; structural 95.86
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 95.84
3sg0_A386 Extracellular ligand-binding receptor; structural 95.79
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 95.56
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 95.53
3n0x_A374 Possible substrate binding protein of ABC transpo 94.86
3ipc_A356 ABC transporter, substrate binding protein (amino; 94.54
3i45_A387 Twin-arginine translocation pathway signal protei; 94.49
3hut_A358 Putative branched-chain amino acid ABC transporter 94.32
1usg_A346 Leucine-specific binding protein; leucine-binding 94.12
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 93.87
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 93.16
1pea_A385 Amidase operon; gene regulator, receptor, binding 92.4
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 92.32
3lop_A364 Substrate binding periplasmic protein; protein str 91.38
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 90.03
3lkb_A392 Probable branched-chain amino acid ABC transporter 88.85
2lw9_A51 Unconventionnal myosin-X; MYO10 anti-CC, motor pro 87.83
4gnr_A353 ABC transporter substrate-binding protein-branche 87.6
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
Probab=99.63  E-value=6.8e-16  Score=127.65  Aligned_cols=109  Identities=33%  Similarity=0.457  Sum_probs=79.8

Q ss_pred             chhHHHHHHHHhcCCCCcccCCcchhhHHHHHHHHHHHHHHHHHHHHHcCCCCCChHHHHHHhhcCccccc---------
Q psy8885           6 NGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDP---------   76 (148)
Q Consensus         6 ~~~F~~eVk~~a~~pFn~t~~~~~v~~yaa~LyDAV~LYA~ALnetL~~g~~~~nGt~I~~~m~nrtF~Gv---------   76 (148)
                      ...|.++.+.....+|+|+.+...++.++++.||||+++|+||++++..+++..+|.+|.+.|++.+|.|+         
T Consensus       290 ~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~ydav~~~a~Al~~~~~~~~~~~~~~~l~~~l~~~~f~g~~G~v~fd~~  369 (435)
T 1dp4_A          290 YLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRN  369 (435)
T ss_dssp             HHHHHHHHHHHHHHHHCCCCCCSGGGHHHHHHHHHHHHHHHHHHHHHHTTCCTTCHHHHHHTTTTEEEEETTEEEEECTT
T ss_pred             HHHHHHHHHHHhcCCCCcccccchhhHHHHHHHHHHHHHHHHHHHHHHcCCCCCCHHHHHHHHhCceeeccceeEEECCC
Confidence            34566666444445677876555688899999999999999999999887766799999999999999987         


Q ss_pred             ------cc---ccCCCCCcEEEEEeeec----------------CCCCCCCCCceecCC--CchH
Q psy8885          77 ------KS---ILPTTTPLRLVHKYILY----------------YVIPLCNHKCTIANS--ILSQ  114 (148)
Q Consensus        77 ------ys---LD~~~g~f~vV~~Y~g~----------------g~~PLd~P~CGF~G~--~C~~  114 (148)
                            |.   ++..+|.+++|+.|+..                +.+|.|.|+|||+|+  .|+.
T Consensus       370 g~~~~~~~i~~~~~~~g~~~~vg~~~~~~~~l~~~~~~~i~W~~~~~P~~~p~Cgf~~~~~~C~~  434 (435)
T 1dp4_A          370 GDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGFDNEDPACNQ  434 (435)
T ss_dssp             SBBCCCEEEEEECTTTCCEEEEEEECTTTCCEEESTTCCCCCTTSSCCCSSCTTCC---------
T ss_pred             CCccceeEEEEecCCCCcEEEEEEecCCCceEEEcCCceeeCCCCCCCCCCCCCCcCCCcCCCCC
Confidence                  22   12245678999988631                479999999999999  9974



>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>2lw9_A Unconventionnal myosin-X; MYO10 anti-CC, motor protein; NMR {Homo sapiens} Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 2e-08
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 6e-07
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 49.4 bits (116), Expect = 2e-08
 Identities = 25/62 (40%), Positives = 42/62 (67%)

Query: 13  VKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRT 72
           +K +A + +NFT  +   +    +F+D ++LY  A+ ET+A GG+ +DG  IT+RMWNR+
Sbjct: 297 LKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRS 356

Query: 73  YQ 74
           +Q
Sbjct: 357 FQ 358


>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 99.79
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 99.14
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 98.37
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 93.25
d1qo0a_373 Amide receptor/negative regulator of the amidase o 92.91
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.79  E-value=1.1e-19  Score=145.15  Aligned_cols=102  Identities=33%  Similarity=0.471  Sum_probs=90.6

Q ss_pred             chhHHHHHHHHhcCCCCcccCCcchhhHHHHHHHHHHHHHHHHHHHHHcCCCCCChHHHHHHhhcCccccc---------
Q psy8885           6 NGYVRLMVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQDP---------   76 (148)
Q Consensus         6 ~~~F~~eVk~~a~~pFn~t~~~~~v~~yaa~LyDAV~LYA~ALnetL~~g~~~~nGt~I~~~m~nrtF~Gv---------   76 (148)
                      ...|.+++++....+|+++..+..++.|+++.||||++||+||+++++.+++..||.+|.+.|++++|+|+         
T Consensus       290 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yDav~~~a~Al~~~~~~~~~~~~~~~l~~~l~~~~f~G~tG~v~fd~n  369 (425)
T d1dp4a_         290 YLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRN  369 (425)
T ss_dssp             HHHHHHHHHHHHHHHHCCCCCCSGGGHHHHHHHHHHHHHHHHHHHHHHTTCCTTCHHHHHHTTTTEEEEETTEEEEECTT
T ss_pred             HHHHHHHHHHHhhccCCCCccccccchHHHHHHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHhCCeEecCCeeEEECCC
Confidence            35678888777788899888888999999999999999999999999999999999999999999999998         


Q ss_pred             ------cc---ccCCCCCcEEEEEeeec----------------CCCCCCCCCcee
Q psy8885          77 ------KS---ILPTTTPLRLVHKYILY----------------YVIPLCNHKCTI  107 (148)
Q Consensus        77 ------ys---LD~~~g~f~vV~~Y~g~----------------g~~PLd~P~CGF  107 (148)
                            |.   +|+++++|++|+.|+..                |.||+|+|.|||
T Consensus       370 Gdr~~~y~i~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~i~W~~~~~P~d~p~cgf  425 (425)
T d1dp4a_         370 GDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGF  425 (425)
T ss_dssp             SBBCCCEEEEEECTTTCCEEEEEEECTTTCCEEESTTCCCCCTTSSCCCSSCTTCC
T ss_pred             CCcccceEEEEEECCCCeEEEEEEEECCCCeEEecCCceeECCCCCCCCCCCCCCC
Confidence                  44   36678899999999832                679999999998



>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure