Psyllid ID: psy8906

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
ccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccEEEEccc
cccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccEEEEEEccccEEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHcEEHHHcc
MERAMRKDSLLTELYLQLIKQttdhpdpnsrvnLRHWALLCLACSVVLPAHRLVRKYLVAHLKRcssdcvseegKYARFAEKCVLktqgtrrrqwppsreEILCTinrrpiyarfyfmdgsyhavefhpsatARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
meramrkdsLLTELYLQLIKqttdhpdpnSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGkyarfaekcvlktqgtrrrqwppsreeilctiNRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
*********LLTELYLQLIKQT*******SRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFI*
*ERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
********SLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLK**********PSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
*ERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYTIYEVGALGYAIYEFIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q8IVE3 1493 Pleckstrin homology domai yes N/A 0.805 0.097 0.357 5e-15
Q8C115 1491 Pleckstrin homology domai yes N/A 0.805 0.097 0.357 4e-14
Q9ULM0 1364 Pleckstrin homology domai no N/A 0.8 0.105 0.311 1e-12
Q9HD67 2058 Unconventional myosin-X O no N/A 0.794 0.069 0.366 2e-12
F8VQB6 2062 Unconventional myosin-X O no N/A 0.794 0.069 0.36 6e-12
D3ZJP6 2060 Unconventional myosin-X O no N/A 0.794 0.069 0.36 6e-12
Q00IB7 1433 Pleckstrin homology domai no N/A 0.8 0.100 0.318 8e-12
Q9W5D0 1820 Uncharacterized protein C no N/A 0.661 0.065 0.309 9e-11
Q80TI1 1356 Pleckstrin homology domai no N/A 0.8 0.106 0.298 9e-11
P79114 2052 Unconventional myosin-X O no N/A 0.794 0.069 0.346 1e-10
>sp|Q8IVE3|PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens GN=PLEKHH2 PE=2 SV=2 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 78/154 (50%), Gaps = 9/154 (5%)

Query: 10   LLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSDC 69
            L  E+  QLIKQT      N    L+ W LL L   + LP H  +   L  HLKR ++D 
Sbjct: 1016 LQNEICCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLW-LLRLHLKR-NADS 1073

Query: 70   VSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARF------YFMDGSYH 123
             +E GKYA + ++CV +TQ    R+  PSR EIL T+ R P +         +FM+G Y 
Sbjct: 1074 RTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQ 1133

Query: 124  AVEFHPSATARDAVALIRAKLGLRDGAL-GYAIY 156
             V F  S T  + +  +    G+R  A  G+A++
Sbjct: 1134 VVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALF 1167

Homo sapiens (taxid: 9606)
>sp|Q8C115|PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus GN=Plekhh2 PE=2 SV=3 Back     alignment and function description
>sp|Q9ULM0|PKHH1_HUMAN Pleckstrin homology domain-containing family H member 1 OS=Homo sapiens GN=PLEKHH1 PE=2 SV=2 Back     alignment and function description
>sp|Q9HD67|MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens GN=MYO10 PE=1 SV=3 Back     alignment and function description
>sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1 Back     alignment and function description
>sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1 Back     alignment and function description
>sp|Q00IB7|PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio GN=plekhh1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W5D0|Y34F_DROME Uncharacterized protein CG42248 OS=Drosophila melanogaster GN=CG42248 PE=1 SV=4 Back     alignment and function description
>sp|Q80TI1|PKHH1_MOUSE Pleckstrin homology domain-containing family H member 1 OS=Mus musculus GN=Plekhh1 PE=2 SV=2 Back     alignment and function description
>sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
345492693 2266 PREDICTED: myosin-X [Nasonia vitripennis 0.822 0.065 0.803 3e-74
383859871 2209 PREDICTED: unconventionnal myosin-X-like 0.822 0.066 0.797 4e-74
350409651 2217 PREDICTED: myosin-X-like [Bombus impatie 0.822 0.066 0.797 4e-74
340713871 2217 PREDICTED: myosin-X-like [Bombus terrest 0.822 0.066 0.797 4e-74
328784281 2208 PREDICTED: myosin-X [Apis mellifera] 0.822 0.067 0.797 6e-74
380024863 2219 PREDICTED: unconventionnal myosin-X-like 0.822 0.066 0.797 6e-74
307201499 2262 Myosin-I heavy chain [Harpegnathos salta 0.822 0.065 0.797 7e-74
328697745 2185 PREDICTED: myosin-VIIa-like [Acyrthosiph 0.822 0.067 0.791 1e-73
332018584 2216 Myosin-I heavy chain [Acromyrmex echinat 0.822 0.066 0.791 1e-73
307177446 2156 Myosin-I heavy chain [Camponotus florida 0.822 0.068 0.791 1e-73
>gi|345492693|ref|XP_001599387.2| PREDICTED: myosin-X [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 144/158 (91%)

Query: 1    MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVA 60
            MER MRK++LL ELYLQLIKQTTDHPDPNSRVNLRHWALL LACSV+LP  +++RKYL+ 
Sbjct: 1804 MERCMRKETLLGELYLQLIKQTTDHPDPNSRVNLRHWALLSLACSVILPPQKIIRKYLIT 1863

Query: 61   HLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDG 120
            HLKRC+SD V+EEGKYARFAEKC+ KTQGT RRQWPPSREEI+CTINRRPIYARF+FMDG
Sbjct: 1864 HLKRCASDYVTEEGKYARFAEKCLYKTQGTWRRQWPPSREEIMCTINRRPIYARFHFMDG 1923

Query: 121  SYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEV 158
             YHAVEFHPSATARD + LI+AK+GL + A+GYAIYEV
Sbjct: 1924 QYHAVEFHPSATARDVMELIKAKIGLGESAMGYAIYEV 1961

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383859871|ref|XP_003705415.1| PREDICTED: unconventionnal myosin-X-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350409651|ref|XP_003488805.1| PREDICTED: myosin-X-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713871|ref|XP_003395458.1| PREDICTED: myosin-X-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328784281|ref|XP_396622.4| PREDICTED: myosin-X [Apis mellifera] Back     alignment and taxonomy information
>gi|380024863|ref|XP_003696209.1| PREDICTED: unconventionnal myosin-X-like [Apis florea] Back     alignment and taxonomy information
>gi|307201499|gb|EFN81262.1| Myosin-I heavy chain [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328697745|ref|XP_003240425.1| PREDICTED: myosin-VIIa-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332018584|gb|EGI59169.1| Myosin-I heavy chain [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307177446|gb|EFN66573.1| Myosin-I heavy chain [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
FB|FBgn008559799 CG41281 [Drosophila melanogast 0.45 0.818 0.740 1.3e-29
FB|FBgn0085670109 CG41527 [Drosophila melanogast 0.422 0.697 0.657 1.1e-25
UNIPROTKB|F1S5I5 827 PLEKHH2 "Uncharacterized prote 0.805 0.175 0.357 4.8e-15
UNIPROTKB|I3LFD9 1235 PLEKHH2 "Uncharacterized prote 0.805 0.117 0.357 8.4e-15
UNIPROTKB|Q8IVE3 1493 PLEKHH2 "Pleckstrin homology d 0.805 0.097 0.357 3.6e-14
UNIPROTKB|F1MH50 1404 PLEKHH2 "Uncharacterized prote 0.805 0.103 0.357 5.5e-14
RGD|1304935 1488 Plekhh2 "pleckstrin homology d 0.805 0.097 0.363 5.9e-14
UNIPROTKB|E2R725 1493 PLEKHH2 "Uncharacterized prote 0.805 0.097 0.350 9.6e-14
UNIPROTKB|F6Y875 1493 PLEKHH2 "Uncharacterized prote 0.805 0.097 0.350 9.6e-14
MGI|MGI:2146813 1491 Plekhh2 "pleckstrin homology d 0.805 0.097 0.363 1.2e-13
FB|FBgn0085597 CG41281 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 1.3e-29, P = 1.3e-29
 Identities = 60/81 (74%), Positives = 73/81 (90%)

Query:     1 MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVA 60
             M++ M+K+SLL ELYLQLIKQTTDHPD NSRVNL++WALL + CSV+LP+ + VRKYL+A
Sbjct:    18 MDKCMKKESLLNELYLQLIKQTTDHPDANSRVNLKNWALLSVLCSVILPSMKAVRKYLIA 77

Query:    61 HLKRCSSDCVSEEGKYARFAE 81
             HLKRCSSD +SEEGKYAR+AE
Sbjct:    78 HLKRCSSDFLSEEGKYARYAE 98
GO:0005856 "cytoskeleton" evidence=IEA
FB|FBgn0085670 CG41527 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5I5 PLEKHH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFD9 PLEKHH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IVE3 PLEKHH2 "Pleckstrin homology domain-containing family H member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MH50 PLEKHH2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1304935 Plekhh2 "pleckstrin homology domain containing, family H (with MyTH4 domain) member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R725 PLEKHH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y875 PLEKHH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2146813 Plekhh2 "pleckstrin homology domain containing, family H (with MyTH4 domain) member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
smart00139152 smart00139, MyTH4, Domain in Myosin and Kinesin Ta 1e-15
pfam00784106 pfam00784, MyTH4, MyTH4 domain 1e-10
>gnl|CDD|214535 smart00139, MyTH4, Domain in Myosin and Kinesin Tails Back     alignment and domain information 
 Score = 70.1 bits (172), Expect = 1e-15
 Identities = 34/101 (33%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 2   ERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAH 61
           ++ +    L  E+Y QLIKQ TD+P   S    R W LL L  S+  P+ RL+  YL+  
Sbjct: 53  QKGLDHPELRDEIYCQLIKQLTDNPSRQS--EERGWQLLYLCTSLFPPSERLL-PYLLQF 109

Query: 62  LKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEI 102
           L R +      E   A++    + +T     R+ PPSR E+
Sbjct: 110 LSRRADP--GSEQGLAKYCLYRLERTLKNGARKQPPSRLEL 148

Domain present twice in myosin-VIIa, and also present in 3 other myosins. Length = 152
>gnl|CDD|216118 pfam00784, MyTH4, MyTH4 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
PF00784114 MyTH4: MyTH4 domain; InterPro: IPR000857 The micro 100.0
smart00139144 MyTH4 Domain in Myosin and Kinesin Tails. Domain p 100.0
KOG0248|consensus 936 99.71
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 98.71
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 98.69
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 98.39
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 98.28
cd0176887 RA RA (Ras-associating) ubiquitin domain. The RA ( 98.2
cd0177896 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour s 98.16
smart0031490 RA Ras association (RalGDS/AF-6) domain. RasGTP ef 98.15
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 98.13
cd0178487 rasfadin_RA Ubiquitin-like domain of Rasfadin. ras 97.99
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 97.63
KOG4239|consensus348 97.57
cd0178585 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA. PD 97.15
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 97.11
smart0045570 RBD Raf-like Ras-binding domain. 97.03
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 96.87
cd0177687 Rin1_RA Ubiquitin domain of RIN1 RAS effector. Rin 96.81
cd01782112 AF6_RA_repeat1 Ubiquitin domain of AT-6, first rep 96.8
PF14847105 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 96.15
cd0177597 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase 96.13
cd0178397 DAGK_delta_RA Ubiquitin-like domain of Diacylgylce 95.94
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 95.84
KOG3784|consensus 407 95.76
cd01779105 Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb 95.36
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 95.29
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 95.26
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 95.19
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 94.22
KOG3751|consensus 622 94.19
cd01781100 AF6_RA_repeat2 Ubiquitin domain of AT-6, second re 93.71
cd0181674 Raf_RBD Ubiquitin domain of Raf serine/threonine k 93.4
KOG2378|consensus 573 93.08
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 92.61
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 92.01
PTZ0004476 ubiquitin; Provisional 92.0
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 91.23
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 91.2
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 91.18
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 91.15
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 91.03
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 90.86
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 90.66
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 90.0
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 89.93
PF00794106 PI3K_rbd: PI3-kinase family, ras-binding domain; I 89.84
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 89.47
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 89.16
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 88.83
smart0016680 UBX Domain present in ubiquitin-regulatory protein 88.78
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 88.7
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 88.11
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 88.07
KOG3529|consensus 596 87.89
KOG3552|consensus 1298 87.86
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 87.38
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 87.16
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 85.87
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 85.81
KOG3530|consensus 616 85.8
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 85.59
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 83.65
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 83.53
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 83.06
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 82.45
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 82.19
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 81.88
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 81.64
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 81.4
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 80.54
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 80.47
>PF00784 MyTH4: MyTH4 domain; InterPro: IPR000857 The microtubule-based kinesin motors and actin-based myosin motors generate movements required for intracellular trafficking, cell division, and muscle contraction Back     alignment and domain information 
Probab=100.00  E-value=4.8e-36  Score=222.30  Aligned_cols=103  Identities=37%  Similarity=0.639  Sum_probs=82.2

Q ss_pred             CcccccCCCChhHHHHHHHHHhcCCCCCCchhhhHHHHHHHHHhcccCCCchHHHHHHHHHhhhccCC--CCCchHHHHH
Q psy8906           1 MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSSD--CVSEEGKYAR   78 (180)
Q Consensus         1 l~~~l~~~~LRDEiy~QliKQtt~Np~~~s~~~~rgW~LLal~~~~f~Ps~k~l~~yL~~fl~~~~~~--~~~~~~~~a~   78 (180)
                      |+.|+++|+||||||||||||||+||+++|  +.|||+||++|+++|+||. .|.+||..|+++++.+  .+++.+++|.
T Consensus        10 l~~~l~~~~LrDEiy~QliKQtt~np~~~s--~~r~W~Ll~~~~~~f~PS~-~l~~yL~~fl~~~~~~~~~~~~~~~~a~   86 (114)
T PF00784_consen   10 LQKGLENPELRDEIYCQLIKQTTNNPSPDS--CIRGWQLLALCCSCFPPSK-DLLPYLRNFLNRHADSQESDPEVGKYAQ   86 (114)
T ss_dssp             HHHHHH-CCHHHHHHHHHHHHTSS-SSCHH--HHHHHHHHHHHCCC----C-CCHHHHHHHHHCCHCHHSTTSHHHCCHH
T ss_pred             HHHHHcchhhHHHHHHHHHHHHHCCCchhh--HHHHHHHHHHHHhhcCCcH-HHHHHHHHHHHHcCcccCCCchHHHHHH
Confidence            467999999999999999999999999777  5999999999999999997 6999999999999752  2455788999


Q ss_pred             HHHHHHHhhccCCCCCCCCCHHHHHHhh
Q psy8906          79 FAEKCVLKTQGTRRRQWPPSREEILCTI  106 (180)
Q Consensus        79 ~c~~~L~r~~~~g~R~~~PS~~Ei~a~~  106 (180)
                      +|+++|+++.+.|+|+++||..||+|++
T Consensus        87 ~c~~~L~~~~~~g~R~~~Ps~~Ei~a~~  114 (114)
T PF00784_consen   87 YCLRRLKRTKKNGPRKFPPSRLEIEAIK  114 (114)
T ss_dssp             HHHHHHCCHHHH---SS---HHHHHHHH
T ss_pred             HHHHHHHHHhhcccCCCCcCHHHHHhhC
Confidence            9999999999999999999999999974

In general, these proteins consist of a motor domain that generates movement and a tail region that varies widely from class to class and is thought to mediate many of the regulatory or cargo binding functions specific to each class of motor []. The Myosin Tail Homology 4 (MyTH4) domain has been identified as a conserved domain in the tail domains of several different unconventional myosins [] and a plant kinesin-like protein [], but has more recently been found in several non-motor proteins []. Although the function is not yet fully understood, there is an evidence that the MyTH4 domain of Myosin-X (Myo10) binds to microtubules and thus could provide a link between an actin-based motor protein and the microtubule cytoskeleton []. The MyTH4 domain is found in one or two copies associated with other domains, such as myosin head, kinesin motor, FERM, PH, SH3 and IQ. The domain is predicted to be largely alpha-helical, interrupted by three or four turns. The MyTH4 domain contains four highly conserved regions designated MGD (consensus sequence L(K/R)(F/Y)MGDhP, LRDE (consensus LRDEhYCQhhKQHxxxN), RGW (consensus RGWxLh), and ELEA (RxxPPSxhELEA), where h indicates a hydrophobic residue and x is any residue [].; GO: 0005856 cytoskeleton; PDB: 3AU5_A 3AU4_A 3PZD_A 3PVL_A.
>smart00139 MyTH4 Domain in Myosin and Kinesin Tails Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>cd01768 RA RA (Ras-associating) ubiquitin domain Back     alignment and domain information
>cd01778 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour supproessor protein Back     alignment and domain information
>smart00314 RA Ras association (RalGDS/AF-6) domain Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>cd01784 rasfadin_RA Ubiquitin-like domain of Rasfadin Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>KOG4239|consensus Back     alignment and domain information
>cd01785 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA Back     alignment and domain information
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>cd01776 Rin1_RA Ubiquitin domain of RIN1 RAS effector Back     alignment and domain information
>cd01782 AF6_RA_repeat1 Ubiquitin domain of AT-6, first repeat Back     alignment and domain information
>PF14847 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B Back     alignment and domain information
>cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase Back     alignment and domain information
>cd01783 DAGK_delta_RA Ubiquitin-like domain of Diacylgylcerol kinase (DAGK) Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>cd01779 Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb_RA Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>cd01781 AF6_RA_repeat2 Ubiquitin domain of AT-6, second repeat Back     alignment and domain information
>cd01816 Raf_RBD Ubiquitin domain of Raf serine/threonine kinases Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>PF00794 PI3K_rbd: PI3-kinase family, ras-binding domain; InterPro: IPR000341 Phosphatidylinositol 3-kinase (PI3K) (2 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG3530|consensus Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3pzd_A 511 Structure Of The Myosin X Myth4-FermDCC COMPLEX Len 1e-13
3au4_A 555 Structure Of The Human Myosin-X Myth4-Ferm Cassette 3e-13
3pvl_A 655 Structure Of Myosin Viia Myth4-Ferm-Sh3 In Complex 4e-08
>pdb|3PZD|A Chain A, Structure Of The Myosin X Myth4-FermDCC COMPLEX Length = 511 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 78/150 (52%), Gaps = 7/150 (4%)
Query: 10  LLTELYLQLIKQTTDHPDPNSRVNLRHWALL-CLACSVVLPAHRLVRKYLVAHLKRCSSD 68
           L  ELY QLIKQT   P P S  NL  W +L CL+C+  LP+ R + KYL  HLKR    
Sbjct: 102 LRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCT-FLPS-RGILKYLKFHLKRIREQ 159
Query: 69  CV-SEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEF 127
              SE  KYA F  + + K   T+ R++ PSR+EI   I+R+ + +  Y   G    +  
Sbjct: 160 FPGSEMEKYALFTYESLKK---TKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITI 216
Query: 128 HPSATARDAVALIRAKLGLRDGALGYAIYE 157
           +   TA + V  +   L + D    +A++E
Sbjct: 217 NSHTTAGEVVEKLIRGLAMEDSRNMFALFE 246
>pdb|3AU4|A Chain A, Structure Of The Human Myosin-X Myth4-Ferm Cassette Bound To Its Specific Cargo, Dcc Length = 555 Back     alignment and structure
>pdb|3PVL|A Chain A, Structure Of Myosin Viia Myth4-Ferm-Sh3 In Complex With The Cen1 Of Sans Length = 655 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 4e-32
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 1e-26
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 2e-05
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 7e-04
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 9e-04
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
 Score =  119 bits (299), Expect = 4e-32
 Identities = 46/158 (29%), Positives = 70/158 (44%), Gaps = 3/158 (1%)

Query: 1   MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVA 60
           ++       L  ELY QLIKQT   P P S  NL  W +L       LP+  +  KYL  
Sbjct: 110 LQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGI-LKYLKF 168

Query: 61  HLKRCSSDCVSEEGKYARFAEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDG 120
           HLKR        E    ++A       + T+ R++ PSR+EI   I+R+ + +  Y   G
Sbjct: 169 HLKRIREQFPGTE--MEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGG 226

Query: 121 SYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEV 158
               +  +   TA + V  +   L + D    +A++E 
Sbjct: 227 GSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEY 264
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 100.0
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 100.0
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 98.61
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 98.61
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 98.54
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 98.47
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 98.34
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 98.33
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 98.09
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 97.96
4gmv_A 281 RAS-associated and pleckstrin homology domains-CO 97.84
3ddc_B163 RAS association domain-containing family protein; 97.72
3tca_A 291 Amyloid beta A4 precursor protein-binding family 1 97.53
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.41
3hk0_A 256 Growth factor receptor-bound protein 10; GRB10, RA 97.24
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 97.02
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 96.62
1wgy_A104 RAP guanine nucleotide exchange factor 5; ubiquiti 96.45
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 96.36
2dhz_A120 RAP guanine nucleotide exchange factor (GEF)- like 96.26
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 95.14
1wxa_A116 Afadin, AF-6 protein; RAS-binding domain, ubiquiti 94.84
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 94.42
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 94.34
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 94.12
2c5l_C117 Phosphoinositide-specific phospholipase C PLC-epsi 94.12
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 94.07
2cs4_A95 Protein C12ORF2; GTP binding, ubiquitin fold, stru 93.9
2pjh_A80 Protein NPL4, nuclear protein localization protein 93.73
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 93.59
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 93.58
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 93.51
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 93.49
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 93.4
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 93.37
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 93.05
2uwq_A86 Apoptosis-stimulating of P53 protein 2; ASPP2, ubi 92.85
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 92.71
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 92.59
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 92.34
3v6c_B91 Ubiquitin; structural genomics, structural genomic 92.34
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 92.13
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 92.12
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 92.09
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 92.01
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 91.94
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 91.91
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 91.86
1we6_A111 Splicing factor, putative; structural genomics, ub 91.84
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 91.64
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 90.87
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 90.73
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 90.7
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 90.67
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 89.94
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 89.91
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 89.81
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 89.78
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 89.7
2bye_A110 Phospholipase C, epsilon 1; RAS association domain 89.65
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 89.56
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 89.36
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 89.17
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 88.91
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 88.49
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 88.34
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 88.09
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 87.78
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 87.42
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 87.37
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 87.28
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 87.17
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 87.12
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 86.79
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 85.88
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 85.85
3m62_B106 UV excision repair protein RAD23; armadillo-like r 85.82
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 84.73
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 84.28
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 84.04
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 84.41
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 83.86
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 83.73
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 83.59
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 83.1
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 83.03
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 82.89
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 82.75
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 82.7
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 82.7
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 82.49
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 82.35
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 82.22
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 82.05
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 82.0
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 81.23
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 81.15
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 80.78
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
Probab=100.00  E-value=2.2e-41  Score=306.55  Aligned_cols=158  Identities=32%  Similarity=0.434  Sum_probs=144.3

Q ss_pred             CcccccCCCChhHHHHHHHHHhcCCCCCCchhhhHHHHHHHHHhcccCCCchHHHHHHHHHhhhccC-CCCCchHHHHHH
Q psy8906           1 MERAMRKDSLLTELYLQLIKQTTDHPDPNSRVNLRHWALLCLACSVVLPAHRLVRKYLVAHLKRCSS-DCVSEEGKYARF   79 (180)
Q Consensus         1 l~~~l~~~~LRDEiy~QliKQtt~Np~~~s~~~~rgW~LLal~~~~f~Ps~k~l~~yL~~fl~~~~~-~~~~~~~~~a~~   79 (180)
                      ++.|+++|+||||||||||||||+||+++|..+.|||+||++|+++|+||. .|.+||..||++++. .++++.++||.+
T Consensus       110 ~~~~~~~~~LrdEiy~Ql~kQ~t~n~~~~s~~~~r~W~Ll~~~~~~f~Ps~-~~~~~l~~~l~~~~~~~~~~~~~~~a~~  188 (555)
T 3au4_A          110 LQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSR-GILKYLKFHLKRIREQFPGTEMEKYALF  188 (555)
T ss_dssp             HHHHHHCTHHHHHHHHHHHHHTSSCSSTTCHHHHHHHHHHHHHHTTCCCCH-HHHHHHHHHHHHHHHHSTTSHHHHHHHH
T ss_pred             HHHhccchhhhhHHHHHHHHHhcCCCCCccHHHHHHHHHHHHHHhhcCCcH-HHHHHHHHHHHhhhhccCCccHHHHHHH
Confidence            367999999999999999999999999999656899999999999999986 699999999998763 234557899999


Q ss_pred             HHHHHHhhccCCCCCCCCCHHHHHHhhcCCCeeeEEEeeCCCEEEEEecccCCHHHHHHHHHHHcCCCCCCCceEEEEEe
Q psy8906          80 AEKCVLKTQGTRRRQWPPSREEILCTINRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVG  159 (180)
Q Consensus        80 c~~~L~r~~~~g~R~~~PS~~Ei~a~~~~~~i~~~i~~~dg~~~~v~vds~tt~~ev~~~i~~~lgl~~~~~gfaL~~~~  159 (180)
                      |+++|+|+   |+|+++||..||+|+.+++++.++|+|+||+...+.|+++||++|+++.+|+++||.+..++||||+..
T Consensus       189 c~~~L~rt---g~R~~~Ps~~Ei~a~~~~~~~~~~V~l~dg~~~~~~v~~~tt~~el~~~v~~~lgL~e~~~~FgL~~~~  265 (555)
T 3au4_A          189 TYESLKKT---KCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYN  265 (555)
T ss_dssp             HHHHHTTC---CCCSSCCCHHHHHHHHTTCCEEEEEEETTSCEEEEEECTTCBHHHHHHHHHHHTTCTTCCSEEEEEEES
T ss_pred             HHHHHHhc---CCCCCCCCHHHHHHHHhCCCcceEEEecCCCeEEEEeCCCCcHHHHHHHHHHHcCCCCCCCceEEEEEe
Confidence            99999995   999999999999999999999999999999999999999999999999999999998657899999986


Q ss_pred             cCC
Q psy8906         160 TLG  162 (180)
Q Consensus       160 ~~~  162 (180)
                      ++.
T Consensus       266 ~~~  268 (555)
T 3au4_A          266 GHV  268 (555)
T ss_dssp             SSC
T ss_pred             CCe
Confidence            543
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>3ddc_B RAS association domain-containing family protein; oncogene, tumorsuppressor, ubiquitin fold, RAS effector, RAP rassf1, rassf5, RAPL, NORE1, GMPPNP; HET: GNP; 1.80A {Mus musculus} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1wgy_A RAP guanine nucleotide exchange factor 5; ubiquitin fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2dhz_A RAP guanine nucleotide exchange factor (GEF)- like 1; LINK guanine nucleotide exchange factor II, LINK-gefii, RA domain, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1wxa_A Afadin, AF-6 protein; RAS-binding domain, ubiquitin-like fold, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.15.1.5 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2c5l_C Phosphoinositide-specific phospholipase C PLC-epsilon; signaling protein/complex, RAS, ubiquitin superfold, oncogene, GTP-binding; HET: GTP; 1.9A {Homo sapiens} SCOP: d.15.1.5 PDB: 2byf_A Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2cs4_A Protein C12ORF2; GTP binding, ubiquitin fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2uwq_A Apoptosis-stimulating of P53 protein 2; ASPP2, ubiquitin-like, SH3-domain, cell cycle, ANK repeat, SH3-binding; NMR {Homo sapiens} Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2bye_A Phospholipase C, epsilon 1; RAS association domain, ubiquitin superfold; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1wgra_100 d.15.1.5 (A:) Growth factor receptor-bound protein 8e-07
d1wgya_104 d.15.1.5 (A:) Rap guanine nucleotide exchange fact 0.002
d1pbwa_184 a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Hu 0.003
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: Growth factor receptor-bound protein 7, GRB-7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.3 bits (102), Expect = 8e-07
 Identities = 12/51 (23%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 108 RRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEV 158
            RP   + Y  DG+  +VE    ATAR    ++  +         + + E 
Sbjct: 7   GRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDE-TWGLVEC 56
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 98.94
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 98.14
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 97.37
d1wxaa1103 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 97.33
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 97.14
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 97.07
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 96.8
d1xrsb252 D-lysine 5,6-aminomutase beta subunit KamE, N-term 94.39
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 94.15
d2cs4a184 Ras association domain-containing protein 8 {Human 93.7
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 93.51
d1k8rb_95 Protein kinase byr2 {Fission yeast (Schizosaccharo 93.49
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 93.45
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 93.39
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 93.34
d2byea1109 Phospholipase C-epsilon-1 {Human (Homo sapiens) [T 93.14
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 92.84
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 92.09
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 91.9
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 91.28
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 90.84
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 90.73
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 90.13
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 90.06
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 89.83
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 89.3
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 88.43
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 87.87
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 87.85
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 86.8
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 86.68
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 86.42
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 85.99
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 85.8
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 85.8
d2c5lc1106 Phospholipase C-epsilon-1 {Human (Homo sapiens) [T 84.7
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 84.56
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 84.36
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 83.83
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 83.31
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 83.27
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 81.78
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 81.24
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 80.36
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: Growth factor receptor-bound protein 7, GRB-7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.94  E-value=1.4e-09  Score=76.07  Aligned_cols=58  Identities=21%  Similarity=0.239  Sum_probs=52.7

Q ss_pred             hcCCCeeeEEEeeCCCEEEEEecccCCHHHHHHHHHHHcCCCCCCCceEEEEEecCCee
Q psy8906         106 INRRPIYARFYFMDGSYHAVEFHPSATARDAVALIRAKLGLRDGALGYAIYEVGTLGYT  164 (180)
Q Consensus       106 ~~~~~i~~~i~~~dg~~~~v~vds~tt~~ev~~~i~~~lgl~~~~~gfaL~~~~~~~~~  164 (180)
                      ..+++..++||++||+++.+.|++.||+.||++.++.++++.+ ...|+||++..++..
T Consensus         5 ~~~~~~vvkv~~~dg~~k~l~V~~~tTa~eV~~~l~~K~~~~~-~~~f~L~E~~~~~~l   62 (100)
T d1wgra_           5 SSGRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALS-DETWGLVECHPHLAL   62 (100)
T ss_dssp             CCCSCEEEEEEETTSCEEEEEECTTCCHHHHHHHHHCSSSCCC-CCCCCEEEEETTTTE
T ss_pred             CCCCceEEEEEecCCCEEEEEECCCCcHHHHHHHHHHHhCCCC-CCCeEEEEecCCCcc
Confidence            3578999999999999999999999999999999999999987 468999999888653
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxaa1 d.15.1.5 (A:8-110) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xrsb2 d.230.4.1 (B:33-84) D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs4a1 d.15.1.5 (A:8-91) Ras association domain-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8rb_ d.15.1.5 (B:) Protein kinase byr2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byea1 d.15.1.5 (A:2-110) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure