Psyllid ID: psy8966


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGRFRLF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccc
cHHHHHHccccEEccccccccEEccHHHHHHHcHHHHccccEEccccccccccccccccHHHHHHHHccccccccHccHHHHHHHHHHHHHHHccccEEccccccccEEccHHHHHHHcHHHHccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccHccHHHHccc
vhlrihsgirpykcpveYCEKAFSTQYSRKAhirthtgekpyrcahefcsksfktsgdlqkhvrthtgkytpgpgidsrlivREDFVHLrihsgirpykcpveYCEKAFSTQYSRKAhirthtgekpyrcahefcsksfktsgdlqkhvrthtgkytaevpgsilDCLSGRFRLF
vhlrihsgirpykcpvEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQkhvrthtgkytpgpgidsrlIVREDFVHLRIhsgirpykcpVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRThtgkytaevpgsildclsgrfrlf
VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGRFRLF
****IHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGR****
VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGRFRLF
VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGRFRLF
VH***HSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLSGRFRLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q91853 565 Zinc finger protein 143 O N/A N/A 0.777 0.240 0.5 5e-39
Q58DZ6 567 Zinc finger protein 143 O yes N/A 0.777 0.239 0.5 8e-39
O70230 638 Zinc finger protein 143 O yes N/A 0.777 0.213 0.487 1e-38
Q5XIU2 638 Zinc finger protein 143 O yes N/A 0.777 0.213 0.487 1e-38
P36508 570 Zinc finger protein 76 OS yes N/A 0.777 0.238 0.481 3e-38
P52747 638 Zinc finger protein 143 O no N/A 0.777 0.213 0.481 3e-38
Q8BMU0 568 Zinc finger protein 76 OS no N/A 0.777 0.239 0.481 4e-38
B4F7E9 568 Zinc finger protein 76 OS no N/A 0.777 0.239 0.475 3e-37
A6QQW0 613 Zinc finger protein 143 O no N/A 0.777 0.221 0.481 3e-37
Q1LYE3 623 Zinc finger protein 143 O no N/A 0.777 0.218 0.469 6e-35
>sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 Back     alignment and function desciption
 Score =  160 bits (404), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 103/164 (62%), Gaps = 28/164 (17%)

Query: 1   VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQ 60
           VH R H+G RPY+C    C KAF+T Y  K+H+RTHTGEKPYRC+ E C+KSFKTSGDLQ
Sbjct: 249 VHERSHTGDRPYQCDHGSCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQ 308

Query: 61  KHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIR 120
           KHVRTHTG+                          RP+KCP E C ++F+T   RK HIR
Sbjct: 309 KHVRTHTGE--------------------------RPFKCPFEGCGRSFTTSNIRKVHIR 342

Query: 121 THTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGK--YTAEVPG 162
           THTGE+PY C+   C ++F ++ + + HVR HTG+  Y   VPG
Sbjct: 343 THTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPG 386




Transcriptional activator. Activates the gene for selenocysteine tRNA (tRNAsec). Binds to the activator element (AE) motif of the selenocysteine tRNA gene promoter.
Xenopus laevis (taxid: 8355)
>sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 Back     alignment and function description
>sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 Back     alignment and function description
>sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 Back     alignment and function description
>sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 Back     alignment and function description
>sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 Back     alignment and function description
>sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 Back     alignment and function description
>sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 Back     alignment and function description
>sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
443686655 662 hypothetical protein CAPTEDRAFT_223732 [ 0.862 0.228 0.528 6e-39
198430617 704 PREDICTED: similar to zinc finger protei 0.737 0.183 0.503 1e-37
405954239 649 hypothetical protein CGI_10003391 [Crass 0.737 0.198 0.496 2e-37
148223786 600 zinc finger protein 143 [Xenopus laevis] 0.777 0.226 0.5 2e-37
229892180 565 RecName: Full=Zinc finger protein 143; A 0.777 0.240 0.5 2e-37
363734708 637 PREDICTED: zinc finger protein 143 [Gall 0.777 0.213 0.5 3e-37
326920006 637 PREDICTED: zinc finger protein 143-like 0.777 0.213 0.5 3e-37
229892181 567 RecName: Full=Zinc finger protein 143; A 0.777 0.239 0.5 4e-37
71895897 555 zinc finger protein 143 [Xenopus (Silura 0.777 0.245 0.5 4e-37
47507273 507 Staf protein [Xenopus laevis] 0.777 0.268 0.5 5e-37
>gi|443686655|gb|ELT89849.1| hypothetical protein CAPTEDRAFT_223732 [Capitella teleta] Back     alignment and taxonomy information
 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 84/159 (52%), Positives = 98/159 (61%), Gaps = 8/159 (5%)

Query: 1   VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQ 60
           VH R H+G RPYKC    C KAF+T Y  K HIR HTGEKPY C    CSK+FKTSGDLQ
Sbjct: 293 VHERSHTGDRPYKCEYAGCNKAFATNYGLKGHIRVHTGEKPYECPDVNCSKAFKTSGDLQ 352

Query: 61  KHVRTHTGK---YTPGPGIDSRLI---VREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYS 114
           KH+RTHTG+     P  G D       +R+  VH+R H+G+RPY CP   C KAFS+  +
Sbjct: 353 KHIRTHTGEKPFKCPFEGCDRYFTTSNIRK--VHIRTHTGLRPYVCPENGCNKAFSSATN 410

Query: 115 RKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHT 153
            K H+R HTGEKPY C  + C K F     L KH   HT
Sbjct: 411 YKNHVRIHTGEKPYVCTVQGCGKRFTEYSSLYKHHVVHT 449




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|198430617|ref|XP_002127297.1| PREDICTED: similar to zinc finger protein 523 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|405954239|gb|EKC21736.1| hypothetical protein CGI_10003391 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|148223786|ref|NP_001084373.1| zinc finger protein 143 [Xenopus laevis] gi|940879|emb|CAA59354.1| selenocysteine tRNA activating factor [Xenopus laevis] Back     alignment and taxonomy information
>gi|229892180|sp|Q91853.2|ZN143_XENLA RecName: Full=Zinc finger protein 143; AltName: Full=Selenocysteine tRNA gene transcription-activating factor Back     alignment and taxonomy information
>gi|363734708|ref|XP_426401.3| PREDICTED: zinc finger protein 143 [Gallus gallus] Back     alignment and taxonomy information
>gi|326920006|ref|XP_003206267.1| PREDICTED: zinc finger protein 143-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|229892181|sp|Q58DZ6.2|ZN143_XENTR RecName: Full=Zinc finger protein 143; AltName: Full=Selenocysteine tRNA gene transcription-activating factor Back     alignment and taxonomy information
>gi|71895897|ref|NP_001025654.1| zinc finger protein 143 [Xenopus (Silurana) tropicalis] gi|62027600|gb|AAH92134.1| zinc finger protein 143 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|47507273|gb|AAH71051.1| Staf protein [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
UNIPROTKB|P36508 570 ZNF76 "Zinc finger protein 76" 0.92 0.282 0.502 1.2e-40
UNIPROTKB|Q5R3B9 544 ZNF76 "Zinc finger protein 76" 0.92 0.295 0.502 1.2e-40
UNIPROTKB|E2RAQ6 570 ZNF76 "Uncharacterized protein 0.92 0.282 0.502 1.6e-40
UNIPROTKB|F1RZ10 546 ZNF76 "Uncharacterized protein 0.92 0.294 0.502 1.6e-40
MGI|MGI:2687278 568 Zfp523 "zinc finger protein 52 0.92 0.283 0.502 2.6e-40
UNIPROTKB|F1LNL6 568 Zfp523 "Zinc finger protein 76 0.92 0.283 0.502 2.6e-40
UNIPROTKB|E1BND9 571 ZNF76 "Uncharacterized protein 0.92 0.281 0.502 2.6e-40
UNIPROTKB|E7EX64340 ZNF76 "Zinc finger protein 76" 0.868 0.447 0.512 1.4e-39
RGD|1306239 568 Zfp523 "zinc finger protein 52 0.92 0.283 0.497 1.8e-39
ZFIN|ZDB-GENE-061027-379 516 zgc:153635 "zgc:153635" [Danio 0.891 0.302 0.518 2.9e-39
UNIPROTKB|P36508 ZNF76 "Zinc finger protein 76" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 432 (157.1 bits), Expect = 1.2e-40, P = 1.2e-40
 Identities = 85/169 (50%), Positives = 102/169 (60%)

Query:     1 VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQ 60
             VH R H+G RPY+C    C KAF+T Y  K+H+RTHTGEKPY+C  E CSK+FKTSGDLQ
Sbjct:   184 VHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQ 243

Query:    61 KHVRTHTGK---YTPGPGIDSRLIVREDF--VHLRIHSGIRPYKCPVEYCEKAFSTQYSR 115
             KHVRTHTG+     P  G   R     +   VH+R H+G RPY CP  +C + F++  + 
Sbjct:   244 KHVRTHTGERPFQCPFEGC-GRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNY 302

Query:   116 KAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKH--VRTHTGKYTAEVPG 162
             K H+R HTGEKPY C    C K F     L KH  V TH   YT    G
Sbjct:   303 KNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCSTCG 351


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=TAS
GO:0006359 "regulation of transcription from RNA polymerase III promoter" evidence=TAS
UNIPROTKB|Q5R3B9 ZNF76 "Zinc finger protein 76" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAQ6 ZNF76 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ10 ZNF76 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2687278 Zfp523 "zinc finger protein 523" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNL6 Zfp523 "Zinc finger protein 76" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BND9 ZNF76 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EX64 ZNF76 "Zinc finger protein 76" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306239 Zfp523 "zinc finger protein 523" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061027-379 zgc:153635 "zgc:153635" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
COG5189423 COG5189, SFP1, Putative transcriptional repressor 7e-07
COG5189423 COG5189, SFP1, Putative transcriptional repressor 7e-07
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 1e-05
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 2e-04
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 2e-04
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 47.8 bits (113), Expect = 7e-07
 Identities = 26/80 (32%), Positives = 32/80 (40%), Gaps = 24/80 (30%)

Query: 8   GIRPYKCPVEYCEKAFSTQYSRKAHIRTH--------------------TGEKPYRCAHE 47
             +PYKCPVE C K +  Q   K H   H                      +KPYRC  E
Sbjct: 346 DGKPYKCPVEGCNKKYKNQNGLKYH-MLHGHQNQKLHENPSPEKMNIFSAKDKPYRC--E 402

Query: 48  FCSKSFKTSGDLQKHVRTHT 67
            C K +K    L+ H R H+
Sbjct: 403 VCDKRYKNLNGLKYH-RKHS 421


Length = 423

>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
KOG2462|consensus279 99.95
KOG2462|consensus279 99.88
KOG3608|consensus467 99.81
KOG1074|consensus 958 99.77
KOG3608|consensus 467 99.75
KOG3576|consensus267 99.67
KOG1074|consensus958 99.63
KOG3623|consensus 1007 99.57
KOG3576|consensus267 99.53
KOG3623|consensus 1007 99.51
PHA00733128 hypothetical protein 99.04
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.97
PLN03086567 PRLI-interacting factor K; Provisional 98.97
PHA0276855 hypothetical protein; Provisional 98.89
PHA0276855 hypothetical protein; Provisional 98.89
PLN03086567 PRLI-interacting factor K; Provisional 98.79
PHA0061644 hypothetical protein 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.74
PHA00733128 hypothetical protein 98.71
KOG3993|consensus500 98.61
PHA0061644 hypothetical protein 98.41
PHA0073279 hypothetical protein 98.14
PHA0073279 hypothetical protein 98.1
KOG3993|consensus500 98.08
COG5189423 SFP1 Putative transcriptional repressor regulating 98.02
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.96
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.64
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.61
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.56
smart0035526 ZnF_C2H2 zinc finger. 97.25
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.24
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.2
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.17
COG5189423 SFP1 Putative transcriptional repressor regulating 97.16
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.1
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.01
PRK04860160 hypothetical protein; Provisional 96.89
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.52
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.47
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.46
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.37
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.2
smart0035526 ZnF_C2H2 zinc finger. 96.14
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.04
PRK04860160 hypothetical protein; Provisional 95.91
COG5048467 FOG: Zn-finger [General function prediction only] 95.22
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.05
KOG4173|consensus253 94.84
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.33
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.1
KOG1146|consensus 1406 92.9
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.16
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.15
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.55
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.47
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.55
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 90.23
COG1592166 Rubrerythrin [Energy production and conversion] 90.22
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.83
COG5048467 FOG: Zn-finger [General function prediction only] 89.1
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.56
KOG2893|consensus 341 88.11
KOG2893|consensus 341 87.65
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.69
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 85.6
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 84.75
COG404965 Uncharacterized protein containing archaeal-type C 84.09
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 83.42
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 82.86
PHA0062659 hypothetical protein 82.32
KOG1146|consensus 1406 81.68
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 80.91
COG404965 Uncharacterized protein containing archaeal-type C 80.76
PRK06266178 transcription initiation factor E subunit alpha; V 80.11
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 80.07
>KOG2462|consensus Back     alignment and domain information
Probab=99.95  E-value=2.4e-28  Score=167.18  Aligned_cols=123  Identities=38%  Similarity=0.737  Sum_probs=108.8

Q ss_pred             CCccCCCccchhhccChHHHHHHHhhhcC---CCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccc
Q psy8966          10 RPYKCPVEYCEKAFSTQYSRKAHIRTHTG---EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDF   86 (175)
Q Consensus        10 ~~~~C~~~~C~~~f~~~~~L~~h~~~~~~---~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~   86 (175)
                      ..|.|.  .||+.|...++|.+|..+|..   .+.+.|..  |++.|.+..+|..|+++|.-                  
T Consensus       129 ~r~~c~--eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~--C~K~YvSmpALkMHirTH~l------------------  186 (279)
T KOG2462|consen  129 PRYKCP--ECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKY--CGKVYVSMPALKMHIRTHTL------------------  186 (279)
T ss_pred             Cceecc--ccccccccccccchhhcccccccccccccCCC--CCceeeehHHHhhHhhccCC------------------
Confidence            358897  899999999999999999854   45699965  99999999999999999862                  


Q ss_pred             hhhhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhh
Q psy8966          87 VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus        87 ~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                                +.+|+  .||+.|....-|+.|+++|+|||||.|  +.|+++|..+++|+.||++|.+.++|.|+.|+++
T Consensus       187 ----------~c~C~--iCGKaFSRPWLLQGHiRTHTGEKPF~C--~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~Ks  252 (279)
T KOG2462|consen  187 ----------PCECG--ICGKAFSRPWLLQGHIRTHTGEKPFSC--PHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKS  252 (279)
T ss_pred             ----------Ccccc--cccccccchHHhhcccccccCCCCccC--CcccchhcchHHHHHHHHhhcCCccccCcchhhH
Confidence                      56776  899999999999999999999999999  7799999999999999999999999999999988


Q ss_pred             hc
Q psy8966         167 CL  168 (175)
Q Consensus       167 ~~  168 (175)
                      |.
T Consensus       253 Fs  254 (279)
T KOG2462|consen  253 FA  254 (279)
T ss_pred             HH
Confidence            85



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-26
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-16
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-06
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-15
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-14
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-14
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-14
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-14
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 7e-12
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-11
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-12
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 7e-11
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-11
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-11
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-10
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-11
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-10
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-11
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-10
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-11
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-10
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 3e-10
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 3e-10
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 8e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 8e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 8e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-05
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 1e-05
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 1e-05
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 1e-05
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 1e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 5e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 5e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 6e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 115 bits (288), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 74/159 (46%), Positives = 90/159 (56%), Gaps = 10/159 (6%) Query: 2 HLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQK 61 H R H+G +PYKCP C K+FS + H RTHTGEKPY+C C KSF +L+ Sbjct: 40 HQRTHTGEKPYKCPE--CGKSFSDKKDLTRHQRTHTGEKPYKCPE--CGKSFSQRANLRA 95 Query: 62 HVRTHTGK--YTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHI 119 H RTHTG+ Y S + H R H+G +PYKCP C K+FS + + H Sbjct: 96 HQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPE--CGKSFSREDNLHTHQ 153 Query: 120 RTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTA 158 RTHTGEKPY+C C KSF L H RTHTGK T+ Sbjct: 154 RTHTGEKPYKCPE--CGKSFSRRDALNVHQRTHTGKKTS 190
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-48
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-44
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-47
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-40
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-44
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-36
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-43
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-34
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-42
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-34
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-29
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-36
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-36
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-25
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-32
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-30
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-27
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-25
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-22
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-20
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-20
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-18
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-20
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-20
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 4e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 4e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 1e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 1e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-04
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
 Score =  153 bits (389), Expect = 5e-48
 Identities = 48/154 (31%), Positives = 64/154 (41%), Gaps = 24/154 (15%)

Query: 1   VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQ 60
            HL  H+G +P+ C  E CEK F++ +    H  THTGEK + C  + C   F T  +++
Sbjct: 32  AHLCKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMK 91

Query: 61  KHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIR 120
           KH                                I  Y C  E C KAF      K H  
Sbjct: 92  KHFNRFHN------------------------IKICVYVCHFENCGKAFKKHNQLKVHQF 127

Query: 121 THTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTG 154
           +HT + PY C HE C K F     L++H + H G
Sbjct: 128 SHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAG 161


>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.82
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.8
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.78
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.69
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.67
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.64
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.63
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.63
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.63
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.58
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.57
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.56
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.55
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.54
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.54
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.54
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.52
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.51
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.5
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.49
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.48
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.47
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.46
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.45
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.44
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.44
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.43
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.43
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.42
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.42
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.42
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.42
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.42
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.42
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.42
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.42
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.42
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.41
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.41
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.41
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.41
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.39
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.38
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.37
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.37
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.34
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.32
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.32
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.28
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.27
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.27
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.26
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.26
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.26
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.25
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.24
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.24
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.24
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.23
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.22
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.22
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.22
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.18
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.1
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.1
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.05
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.03
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.01
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.0
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.99
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.98
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.96
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.94
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.93
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.92
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.9
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.87
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.85
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.83
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.8
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.8
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.78
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.74
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.71
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.7
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.68
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.66
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.65
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.63
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.62
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.6
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.58
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.55
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.5
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.49
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.48
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.47
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.47
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.46
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.45
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.45
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.82
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.8
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.42
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.4
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.4
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.36
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.36
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.35
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.67
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.31
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.22
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.22
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.22
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.22
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.18
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.17
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.13
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.11
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.09
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.07
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.06
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.02
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.0
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.25
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.0
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.22
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.93
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.96
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.9
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.03
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.97
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.88
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.78
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.69
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.85
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 84.53
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.97
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 81.36
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=9.9e-34  Score=192.12  Aligned_cols=161  Identities=43%  Similarity=0.721  Sum_probs=126.0

Q ss_pred             cccccCCCCCccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCC--CCCCCCcc
Q psy8966           2 HLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYT--PGPGIDSR   79 (175)
Q Consensus         2 ~~~~~~~~~~~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~--~~~~~~~~   79 (175)
                      |++++.++++|.|.  .|++.|.....|..|+..|.+.++|.|..  |++.|.+...|..|++.|.++.+  |..+....
T Consensus        12 h~~~~~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   87 (190)
T 2i13_A           12 QAALEPGEKPYACP--ECGKSFSRSDHLAEHQRTHTGEKPYKCPE--CGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSF   87 (190)
T ss_dssp             ---------------------CCSSHHHHHGGGCC---CCEECTT--TCCEESSHHHHHHHHHHHHCCCCEECTTTCCEE
T ss_pred             hhhhcCCCCCCcCC--CCccccCCHHHHHHHHHHcCCCCCccCCC--cCchhCCHHHHHHHHHhcCCCCCccCcccCCcc
Confidence            67788999999998  99999999999999999999999999965  99999999999999999998765  44444444


Q ss_pred             chhcccchhhhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCcccc
Q psy8966          80 LIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAE  159 (175)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~  159 (175)
                      .....+..|++.|.++++|.|+  .|++.|.+...|..|+++|.+++||.|  ++|++.|.....|..|+++|+++.||.
T Consensus        88 ~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C--~~C~~~f~~~~~L~~H~~~H~~~~~~~  163 (190)
T 2i13_A           88 SQRANLRAHQRTHTGEKPYACP--ECGKSFSQLAHLRAHQRTHTGEKPYKC--PECGKSFSREDNLHTHQRTHTGEKPYK  163 (190)
T ss_dssp             SCHHHHHHHHHHHHTCCCEECT--TTCCEESSHHHHHHHHHHHHCCCCEEC--TTTCCEESCHHHHHHHHHHHHCCCCEE
T ss_pred             CCHHHHHHHHHhcCCCCCCcCC--CCCCccCCHHHHHHHHHHhCCCCCeEC--CCCCcccCCHHHHHHHHHhcCCCCCeE
Confidence            4555667899999999999997  899999999999999999999999999  899999999999999999999999999


Q ss_pred             CCcchhhhccc
Q psy8966         160 VPGSILDCLSG  170 (175)
Q Consensus       160 C~~c~~~~~~~  170 (175)
                      |++|++.|.+.
T Consensus       164 C~~C~~~f~~~  174 (190)
T 2i13_A          164 CPECGKSFSRR  174 (190)
T ss_dssp             CTTTCCEESSH
T ss_pred             CCCCCCccCCH
Confidence            99999998764



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 6e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 6e-06
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-06
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-06
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 7e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 7e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 9e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 9e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.9 bits (109), Expect = 2e-08
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 12 YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRC 44
          + CP   C K+F+ +   K H++ H+  + Y C
Sbjct: 2  FSCPEPACGKSFNFKKHLKEHMKLHSDTRDYIC 34


>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.71
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.45
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.43
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.33
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.31
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.29
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.27
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.23
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.22
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.22
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.21
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.19
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.16
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.09
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.09
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.07
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.06
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.05
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.04
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.04
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.02
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.02
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.97
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.94
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.91
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.88
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.78
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.78
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.47
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.34
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.31
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.15
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.08
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.06
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.0
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.9
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.82
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.76
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.74
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.73
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.64
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.55
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.51
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.44
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.44
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.38
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.37
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.37
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.34
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.32
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.31
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.3
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.21
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.19
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.17
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.09
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.05
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.04
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.87
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.76
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.61
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.51
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.49
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.45
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.41
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.28
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.24
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.16
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.94
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.76
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.6
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.55
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.49
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.96
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.7
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 94.7
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.36
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.26
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.82
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.46
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.38
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.96
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 92.61
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.88
d1y0jb136 U-shaped transcription factor, different fingers { 91.7
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.91
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 89.98
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.64
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.61
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.1
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.2
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.14
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.67
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.33
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=2.7e-18  Score=90.45  Aligned_cols=53  Identities=36%  Similarity=0.794  Sum_probs=50.7

Q ss_pred             CcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHh
Q psy8966          95 IRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus        95 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h  152 (175)
                      ++||.|   +||+.|...++|..|+++|++++||.|  ++||++|.+.+.|.+|+++|
T Consensus         1 EK~y~C---~Cgk~F~~~~~l~~H~~~Ht~ekpy~C--~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC---QCGKSFTHKSQRDRHMSMHLGLRPYGC--GVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC---TTSCEESSHHHHHHHHHHHSCCCSEEC--TTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC---CCCCeECCHHHhHHHhhccccccCCcC--CCcCCEecCHHHHHHHHhcC
Confidence            579999   499999999999999999999999999  99999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure