Psyllid ID: psy9001


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350-
MVGIWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLNNVREERNNENNMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
ccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccEEEEEEEEccccEEEEEEEEEEcccccccccccccccccccEEEEEccccccccccccccccEEEEEEcccccEEEcccccEEEEEEcccccccEEccccccccccccHHcccccccccccEEEEEEccccccccccccHHHHHccccHHHHcccccccHHHHHHHHHccccccccccccccccHHHHHcccccEEEcccccccccEEHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEcEEEEHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccEEEEccccccHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEEccccEEEEEEccccccccccccccccccccccccccccccccEEHHHHHHHcccccccccccHHHHHHcccccccccEEEEEccccccHHHHcccccHHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccEEEcccccccccccEEEEEEEEcccccccccEEEccccccEEEEccccccccccccccccccccccEEcccccccccccccccccccEEcccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEccccEEEEEcccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccccccccHHccccccEEEEEcccEEEEEcc
cEEEEEccccccccccccccEEEEEcccccccccccccHHHHHcccHHcccccccccccEEEEEEccccHHHHcccEEEEEccccccccccccccccccEEEEEEccccccccccccccEEEEEEEcccccEEEcccHHHHEcccccccccccccccccccHHHHHHHHccccccccccEEEEEEEccccccccccccHcccccccccEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccHccccccccHEccccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccEEcHccHHccccccHHHHHHHHHHcccccccccHHHHHccccccHHHHHHHHHEEEEHHHccccccEEEccccccccccccccccccHHHHHcccccccccEEEEEEccccHHccccccccccccccccccccccccccEEEEEccccEEEEEEEccccccccccccEEEEEEcccHHccccccEEEEEcccccccccccEEEEEccccccccccccccccEEEEccccccHHccccccHEEEEEEEHHHHEcccccEEEccccHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHcccHHccccccccccccccccccHHHHHHccccHHHHHHHcccccEEEccEEEEcccccEEEEEEccccccccccccccccEEEEEEcccccccEEEEEEcccccccccccHHHHHcccccccccEcccccccccHHHHHcccccccHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEcccccccccccccccccccccEccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccHccccccccHEccccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccHHHHHcHHHHHHHHcccccccccEEEEEccccEEccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHccHHHHEEEcccccccccccccccccEEEEEEEEccccccEEEcccccccEEEcccccEEEEcc
mvgiwtgdrlrqsfgtpeqLKYLVDEChkaglfgtpeQLKYLVDEChkaglfgtpeQLKYLVDECHKAGLLCFMHVVCAagdfnnwnreefaykkldfgkwelvlppnpdgscklthlsQVKLVVRNQHghlldrlspwatyvteppvvghayeqriwnpkpqdkhkwtsskpkkpdnlkiyESHVgictqeqkcasyeDFVRVVIPRIVKQGMAIPDKWIELLKKFkdedwnmgnivhtltNRRYMEKTVAYAEshdqalvgdKTIAFWLMDKEMythmstlsdpslIIDRacekfgtpeqLKYLVDEChkaglfgtpeQLKYLVDECHKAGLYVLLDVVHSHASknvldglnefdgtqacffhdgprgthplwdsrlfnySEIEVLRFLLSNLRWYLdeyqfdgfrfdgvtsmlyhnhgcgegfsghydeyfglnvdtDALIYLMVANKflhdkypeiITIAedvsgmpascrpvteggtgfdyrleirpdmsdmtvGTFDAAMNTTEERFKWlsadpgyvstkhegdkVIIFERAGLLfafnfngtqsftdyrycstqsysthntwtwrgsisKLHRVGVEQAGKYKvvldsdcshfggfnrldpgtvyetypepwnnrrnsiklylptrtglilttspgtssdipsgwisrelvttlptgmlgdngILLMMNYSsinssiggiEKFTTSYNKYgihvqadnsvrcfewapsaQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAassrtmgnsqsvdpasihipelhkllerdpylnpyqyEMKRRYGLMVNFLEqfekhedpasihipelhkllerdpylnpyqyEMKRRYGLMVNFLeqlspwatyvteppvvghayeqriwnpkpqdkhkwtsskpkkpenlkiYESHVGictqeqkcasyeDFVRVVIPRIvkqgdfnnwnreefaykkldfgkwelvlppnpdgdfnnwnreefaykkldfgkwelvlppnpdgscklthlsQVKLVVRNQhghlldrfgtpeQLKYLVDEChkaglfgtpeQLKYLVDECHKAGLYVLLDVVHSHASknvldglnefdgtqacffhdgprgthplwdsrlfnySEIEVLRFLLSNLRWYLEEyqfdgfrfdgvtsmlyhnhgcgegfsghydeyfglnvdtDALIYLMVANKflhdkypeiITIAedvsgmpascrpvteggtgfdyrLGQYLHQHsilfprvgveqagkykvvldsdcshfggfnrldpgtvyetypepwnnrrnsiklylptrtgiidevnLLNNVREERNNENNMKRYIQTesnmngfgiqtlptqsplylvakiekpcstrevvkaplpfgvrlhskvdmciigk
mvgiwtgdrlrqsfgtPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRiwnpkpqdkhkwtsskpkkpdnlKIYESHVGICTQEQKCASYEDFVRVVIPRIvkqgmaipdKWIELLKkfkdedwnmgnivhtltnrrYMEKTVAYaeshdqalvGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIaedvsgmpascrpvteggtgFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHfggfnrldpgtvYETYPEPWNNRRNSIKLYLPTRTGLILttspgtssdipsgwISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPelhkllerdpYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIwnpkpqdkhkwtsskpkkpenlKIYESHVGICTQEQKCASYEDFVRVVIPRivkqgdfnnwnREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIaedvsgmpaSCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCShfggfnrldpgtvyetypepwnnrrnSIKLYLPTRtgiidevnllnnvreernnenNMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTrevvkaplpfgvrlhskvdmciigk
MVGIWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYssinssiggiEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDevnllnnvreernnennMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
***IWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWN*******************LKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAA**************SIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWN*******************LKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLNNV*************I****NMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCII**
**G****DRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIP*GWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLN*****************TESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
MVGIWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPK************KKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPK************KKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLNNVREERNNENNMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
MVGIWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLNNVREERNNENNMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGIWTGDRLRQSFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLLCFMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMSDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGTSSDIPSGWISRELVTTLPTGMLGDNGILLMMNYSSINSSIGGIEKFTTSYNKYGIHVQADNSVRCFEWAPSAQQLYLTGYNAVQLMAIMEHAYYASFGYQVTSFFAASSRTMGNSQSVDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQFEKHEDPASIHIPELHKLLERDPYLNPYQYEMKRRYGLMVNFLEQLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPDGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLGQYLHQHSILFPRVGVEQAGKYKVVLDSDCSHFGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGIIDEVNLLNNVREERNNENNMKRYIQTESNMNGFGIQTLPTQSPLYLVAKIEKPCSTREVVKAPLPFGVRLHSKVDMCIIGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1351 2.2.26 [Sep-21-2011]
Q6T308699 1,4-alpha-glucan-branchin N/A N/A 0.262 0.506 0.466 7e-97
Q6EAS5699 1,4-alpha-glucan-branchin yes N/A 0.262 0.506 0.464 7e-97
Q04446702 1,4-alpha-glucan-branchin yes N/A 0.262 0.504 0.455 1e-95
Q9D6Y9702 1,4-alpha-glucan-branchin yes N/A 0.262 0.504 0.459 2e-95
Q8NKE1683 1,4-alpha-glucan-branchin N/A N/A 0.251 0.497 0.438 8e-88
Q6CCT1691 1,4-alpha-glucan-branchin yes N/A 0.254 0.497 0.408 1e-85
O23647858 1,4-alpha-glucan-branchin yes N/A 0.248 0.391 0.418 1e-82
Q9LZS3805 1,4-alpha-glucan-branchin no N/A 0.248 0.417 0.416 1e-79
Q08047799 1,4-alpha-glucan-branchin N/A N/A 0.283 0.479 0.382 8e-78
Q6BXN1711 1,4-alpha-glucan-branchin yes N/A 0.256 0.486 0.406 9e-77
>sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 Back     alignment and function desciption
 Score =  356 bits (914), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 253/435 (58%), Gaps = 81/435 (18%)

Query: 62  VDECHKAGLLC-----FMHVVCAAGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLT 116
           V  C   GL C         V   GDFN+WN   + YKKLD+GKWEL +PP  + S  + 
Sbjct: 75  VHRCADGGLYCKEWAPGAEGVFLTGDFNDWNPFSYPYKKLDYGKWELYIPPKQNKSQLVP 134

Query: 117 HLSQVKLVVRNQHGHLLDRLSPWATYVT-EPPVVGHAYEQRIWNPKPQDKHKWTSSKPKK 175
           H S++K+V+R++ G +L R+SPWA YVT E   V   Y+   W+  P+  +K+  S+PKK
Sbjct: 135 HGSKLKVVIRSKSGEILYRISPWAKYVTREGENVN--YDWTHWD--PEHPYKFKHSRPKK 190

Query: 176 PDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMG 235
           P  ++IYESHVGI + E K ASY+ F   V+PRI                  KD  +N  
Sbjct: 191 PRGVRIYESHVGISSYEGKIASYKHFTYNVLPRI------------------KDLGYNCI 232

Query: 236 NIVHTLTNRRYMEKTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACE 295
            ++  + +  Y             A  G +  +F+                      A  
Sbjct: 233 QMMAIMEHAYY-------------ASFGYQITSFFA---------------------ASS 258

Query: 296 KFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNE 355
           ++GTPE+                   LK LVD  H  G+ VLLDVVHSHASKN  DGLN 
Sbjct: 259 RYGTPEE-------------------LKELVDTAHSMGITVLLDVVHSHASKNSEDGLNM 299

Query: 356 FDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSM 415
           FDGT +C+FH GPRG H LWDSRLF YS  EVLRFLLSN+RW+L+EY FDGFRFDGVTSM
Sbjct: 300 FDGTDSCYFHSGPRGNHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYGFDGFRFDGVTSM 359

Query: 416 LYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCR 475
           LYH+HG G+ FSG Y EYFGL VD DALIYLM+AN  +H  YP  ITIAEDVSGMPA C 
Sbjct: 360 LYHHHGMGQAFSGDYHEYFGLQVDEDALIYLMLANHLVHTLYPNSITIAEDVSGMPALCS 419

Query: 476 PVTEGGTGFDYRLEI 490
           P+++GG GFDYRL +
Sbjct: 420 PISQGGVGFDYRLAM 434




Required for sufficient glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule and, consequently, in reducing the osmotic pressure within cells.
Felis catus (taxid: 9685)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 Back     alignment and function description
>sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 Back     alignment and function description
>sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NKE1|GLGB_GLOIN 1,4-alpha-glucan-branching enzyme OS=Glomus intraradices GN=GLC3 PE=2 SV=1 Back     alignment and function description
>sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 Back     alignment and function description
>sp|O23647|GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LZS3|GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.2 PE=1 SV=1 Back     alignment and function description
>sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 Back     alignment and function description
>sp|Q6BXN1|GLGB_DEBHA 1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLC3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1351
380026836694 PREDICTED: LOW QUALITY PROTEIN: 1,4-alph 0.282 0.548 0.491 1e-116
350410058692 PREDICTED: 1,4-alpha-glucan-branching en 0.281 0.549 0.486 1e-116
383863554692 PREDICTED: 1,4-alpha-glucan-branching en 0.282 0.550 0.489 1e-115
307197707596 1,4-alpha-glucan-branching enzyme [Harpe 0.283 0.642 0.494 1e-113
322785359691 hypothetical protein SINV_12923 [Solenop 0.284 0.555 0.477 1e-113
332023850697 1,4-alpha-glucan-branching enzyme [Acrom 0.282 0.548 0.473 1e-112
91076104692 PREDICTED: similar to GA17312-PA [Tribol 0.282 0.550 0.479 1e-111
195124622690 GI21261 [Drosophila mojavensis] gi|19391 0.286 0.560 0.477 1e-111
156548680694 PREDICTED: 1,4-alpha-glucan-branching en 0.285 0.556 0.475 1e-111
198458865690 GA17312 [Drosophila pseudoobscura pseudo 0.285 0.559 0.470 1e-110
>gi|380026836|ref|XP_003697146.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like [Apis florea] Back     alignment and taxonomy information
 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 282/470 (60%), Gaps = 89/470 (18%)

Query: 80  AGDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPW 139
            GDFN WNR   +YKKLD+GKWEL LPPN DGSC + HLS++K++V++Q+  LL+RLSPW
Sbjct: 91  TGDFNGWNRTTNSYKKLDYGKWELHLPPNADGSCPIKHLSEIKIIVKDQNNELLERLSPW 150

Query: 140 ATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYE 199
           ATYVT+       Y+QRIW P P++ +K+  SK KKP++L+IYE HVGI TQE K  +Y 
Sbjct: 151 ATYVTQDKSESATYKQRIWYPLPENVYKFKYSKQKKPESLRIYECHVGIATQELKIGTYL 210

Query: 200 DFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQ 259
           +F + +IPRIVKQG       I+L+                           A  E    
Sbjct: 211 EFAKNIIPRIVKQGYNA----IQLM---------------------------AIMEHAYY 239

Query: 260 ALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTP 319
           A  G +  +F+                      A  ++GTPE+LK               
Sbjct: 240 ASFGYQVTSFY---------------------AASSRYGTPEELK--------------- 263

Query: 320 EQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRL 379
                L+D  H+ GLYVLLDVVHSHASKN LDGLN FDGT  CFFH G RG HPLWDSRL
Sbjct: 264 ----QLIDTAHQYGLYVLLDVVHSHASKNTLDGLNMFDGTDGCFFHSGNRGHHPLWDSRL 319

Query: 380 FNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVD 439
           FNY E EVLRFLLSNLRWY++EY FDGFRFDGVTSMLYH+ G G+GF+GHY+EY+GLNVD
Sbjct: 320 FNYGEYEVLRFLLSNLRWYIEEYNFDGFRFDGVTSMLYHSRGFGQGFTGHYEEYYGLNVD 379

Query: 440 TDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIR-PDM---- 494
            + ++YLM+AN  LH  YP +ITIAEDVSGMP  CRP+TEGG GFDYRL +  PD     
Sbjct: 380 VEGVVYLMLANYILHYLYPNMITIAEDVSGMPGVCRPITEGGLGFDYRLAMAIPDKWIKL 439

Query: 495 ------SDMTVGTFDAAMNTTEERFKWLSADPGYVSTKHE---GDKVIIF 535
                  D  VG  D     T  R  W+     Y  +  +   GDK I F
Sbjct: 440 LKEXKDEDWNVG--DICWTLTNRR--WMEKTVAYSESHDQALVGDKTIAF 485




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350410058|ref|XP_003488932.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863554|ref|XP_003707245.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307197707|gb|EFN78864.1| 1,4-alpha-glucan-branching enzyme [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322785359|gb|EFZ12033.1| hypothetical protein SINV_12923 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023850|gb|EGI64074.1| 1,4-alpha-glucan-branching enzyme [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|91076104|ref|XP_968648.1| PREDICTED: similar to GA17312-PA [Tribolium castaneum] gi|270014582|gb|EFA11030.1| hypothetical protein TcasGA2_TC004619 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195124622|ref|XP_002006790.1| GI21261 [Drosophila mojavensis] gi|193911858|gb|EDW10725.1| GI21261 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|156548680|ref|XP_001602425.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|198458865|ref|XP_001361183.2| GA17312 [Drosophila pseudoobscura pseudoobscura] gi|198136502|gb|EAL25760.2| GA17312 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1351
FB|FBgn0053138685 AGBE "1,4-Alpha-Glucan Branchi 0.162 0.319 0.619 1.2e-124
UNIPROTKB|G4NAD9691 MGG_03186 "1,4-alpha-glucan-br 0.132 0.259 0.694 9.1e-130
UNIPROTKB|F1PX32699 GBE1 "Uncharacterized protein" 0.131 0.254 0.709 9.2e-129
UNIPROTKB|Q04446702 GBE1 "1,4-alpha-glucan-branchi 0.131 0.253 0.703 5.8e-126
UNIPROTKB|E9PGM4661 GBE1 "1,4-alpha-glucan-branchi 0.131 0.269 0.703 5.8e-126
MGI|MGI:1921435702 Gbe1 "glucan (1,4-alpha-), bra 0.131 0.253 0.726 4.5e-125
ASPGD|ASPL0000046871684 AN2314 [Emericella nidulans (t 0.132 0.261 0.666 1.6e-121
UNIPROTKB|F1MZP0655 GBE1 "Uncharacterized protein" 0.131 0.271 0.709 2.5e-121
WB|WBGene00011409681 T04A8.7 [Caenorhabditis elegan 0.131 0.261 0.675 1.2e-117
ZFIN|ZDB-GENE-110411-171688 si:ch211-213e17.1 "si:ch211-21 0.131 0.258 0.698 2.4e-118
FB|FBgn0053138 AGBE "1,4-Alpha-Glucan Branching Enzyme" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 720 (258.5 bits), Expect = 1.2e-124, Sum P(4) = 1.2e-124
 Identities = 143/231 (61%), Positives = 166/231 (71%)

Query:   316 FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 375
             +G PEQLK ++D  H  GL+VLLDVVHSHASKNV DGLN+FDGT +CFFHDG RG H LW
Sbjct:   248 YGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGARGEHSLW 307

Query:   376 DSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 435
             DSRLFNY E EVLRFLLSNLRW+ DEY FDG+RFDGVTSMLYH+ G GEGFSG Y+EYFG
Sbjct:   308 DSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSGDYNEYFG 367

Query:   436 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIR-PD- 493
             LNVDTDAL YL +AN  LH     IITIAEDVSGMP  CRPV+EGG GFDYRL +  PD 
Sbjct:   368 LNVDTDALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRLGMAIPDK 427

Query:   494 ----MSDMTVGTFDAA--MNTTEERFKWLSADPGYVSTKHE---GDKVIIF 535
                 + + +   +D    ++T   R +W+     Y  +  +   GDK I F
Sbjct:   428 WIELLKEQSDDEWDMGNLVHTLTNR-RWMENTVAYAESHDQALVGDKTIAF 477


GO:0003844 "1,4-alpha-glucan branching enzyme activity" evidence=ISS
GO:0005978 "glycogen biosynthetic process" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0008340 "determination of adult lifespan" evidence=IMP
UNIPROTKB|G4NAD9 MGG_03186 "1,4-alpha-glucan-branching enzyme" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1PX32 GBE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q04446 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGM4 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921435 Gbe1 "glucan (1,4-alpha-), branching enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046871 AN2314 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZP0 GBE1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00011409 T04A8.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-171 si:ch211-213e17.1 "si:ch211-213e17.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.1.180.737

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1351
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 1e-115
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 1e-114
PLN02447 758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 6e-98
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 2e-97
PLN02960897 PLN02960, PLN02960, alpha-amylase 6e-58
PLN02960 897 PLN02960, PLN02960, alpha-amylase 6e-58
PLN03244872 PLN03244, PLN03244, alpha-amylase; Provisional 1e-49
PLN03244 872 PLN03244, PLN03244, alpha-amylase; Provisional 3e-49
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 5e-48
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 5e-43
cd11322402 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom 2e-41
cd11322402 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom 3e-41
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 1e-40
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 2e-40
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 2e-36
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 4e-36
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 5e-32
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 6e-32
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 1e-30
TIGR01515618 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha 5e-30
TIGR01515618 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha 6e-30
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 3e-29
cd0285495 cd02854, E_set_GBE_euk_N, N-terminal Early set dom 7e-29
PRK12568730 PRK12568, PRK12568, glycogen branching enzyme; Pro 7e-25
PRK12568730 PRK12568, PRK12568, glycogen branching enzyme; Pro 9e-25
PRK147051224 PRK14705, PRK14705, glycogen branching enzyme; Pro 1e-24
PRK147051224 PRK14705, PRK14705, glycogen branching enzyme; Pro 2e-24
cd11325436 cd11325, AmyAc_GTHase, Alpha amylase catalytic dom 2e-22
cd11325436 cd11325, AmyAc_GTHase, Alpha amylase catalytic dom 4e-22
cd0285495 cd02854, E_set_GBE_euk_N, N-terminal Early set dom 3e-20
PRK14706 639 PRK14706, PRK14706, glycogen branching enzyme; Pro 8e-19
PRK14706639 PRK14706, PRK14706, glycogen branching enzyme; Pro 1e-18
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 1e-17
PLN02960897 PLN02960, PLN02960, alpha-amylase 6e-16
pfam0280692 pfam02806, Alpha-amylase_C, Alpha amylase, C-termi 7e-16
PLN02960897 PLN02960, PLN02960, alpha-amylase 9e-16
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 3e-15
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 1e-13
TIGR02402544 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose 2e-13
TIGR02402544 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose 6e-13
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 7e-13
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 1e-12
PLN03244872 PLN03244, PLN03244, alpha-amylase; Provisional 1e-12
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 2e-12
PLN03244872 PLN03244, PLN03244, alpha-amylase; Provisional 2e-12
cd11350390 cd11350, AmyAc_4, Alpha amylase catalytic domain f 3e-12
cd11350390 cd11350, AmyAc_4, Alpha amylase catalytic domain f 8e-12
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 7e-10
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 1e-09
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 4e-09
PLN02960897 PLN02960, PLN02960, alpha-amylase 1e-08
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 2e-08
cd11322402 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom 9e-08
PLN02960897 PLN02960, PLN02960, alpha-amylase 2e-07
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 3e-07
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 3e-07
COG1523 697 COG1523, PulA, Type II secretory pathway, pullulan 3e-07
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 4e-07
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 5e-07
cd11326433 cd11326, AmyAc_Glg_debranch, Alpha amylase catalyt 7e-07
PLN03244872 PLN03244, PLN03244, alpha-amylase; Provisional 8e-07
COG1523697 COG1523, PulA, Type II secretory pathway, pullulan 8e-07
cd11326433 cd11326, AmyAc_Glg_debranch, Alpha amylase catalyt 1e-06
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 2e-06
pfam0292283 pfam02922, CBM_48, Carbohydrate-binding module 48 2e-06
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 3e-06
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 4e-06
TIGR021021111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 4e-06
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 7e-06
TIGR02102 1111 TIGR02102, pullulan_Gpos, pullulanase, extracellul 7e-06
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 8e-06
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 2e-05
PLN02447 758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 2e-05
PLN02960897 PLN02960, PLN02960, alpha-amylase 2e-05
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 2e-05
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 2e-05
PLN03244872 PLN03244, PLN03244, alpha-amylase; Provisional 3e-05
pfam0280692 pfam02806, Alpha-amylase_C, Alpha amylase, C-termi 3e-05
TIGR02104605 TIGR02104, pulA_typeI, pullulanase, type I 5e-05
PLN02447758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 6e-05
PRK14706639 PRK14706, PRK14706, glycogen branching enzyme; Pro 9e-05
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 1e-04
TIGR02104605 TIGR02104, pulA_typeI, pullulanase, type I 1e-04
smart00642166 smart00642, Aamy, Alpha-amylase domain 1e-04
smart00642166 smart00642, Aamy, Alpha-amylase domain 1e-04
cd11352443 cd11352, AmyAc_5, Alpha amylase catalytic domain f 1e-04
cd11352443 cd11352, AmyAc_5, Alpha amylase catalytic domain f 1e-04
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 2e-04
TIGR02100 688 TIGR02100, glgX_debranch, glycogen debranching enz 3e-04
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 5e-04
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 5e-04
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 6e-04
cd02855105 cd02855, E_set_GBE_prok_N, N-terminal Early set do 6e-04
COG0366505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 7e-04
PRK12313633 PRK12313, PRK12313, glycogen branching enzyme; Pro 0.001
PRK14706639 PRK14706, PRK14706, glycogen branching enzyme; Pro 0.001
TIGR02100688 TIGR02100, glgX_debranch, glycogen debranching enz 0.001
PRK09505683 PRK09505, malS, alpha-amylase; Reviewed 0.001
PRK09505683 PRK09505, malS, alpha-amylase; Reviewed 0.001
PRK147051224 PRK14705, PRK14705, glycogen branching enzyme; Pro 0.002
PRK14706639 PRK14706, PRK14706, glycogen branching enzyme; Pro 0.002
COG0366505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 0.002
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 0.002
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 0.002
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 0.002
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 0.002
cd11341406 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase 0.002
cd11314302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 0.002
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 0.003
cd11321406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 0.003
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 0.003
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 0.003
PRK05402726 PRK05402, PRK05402, glycogen branching enzyme; Pro 0.003
PRK147051224 PRK14705, PRK14705, glycogen branching enzyme; Pro 0.003
pfam0292283 pfam02922, CBM_48, Carbohydrate-binding module 48 0.003
pfam0292283 pfam02922, CBM_48, Carbohydrate-binding module 48 0.003
cd11314302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 0.003
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 0.003
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 0.003
PRK03705658 PRK03705, PRK03705, glycogen debranching enzyme; P 0.003
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 0.004
TIGR01515618 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha 0.004
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 0.004
cd11341406 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase 0.004
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
 Score =  365 bits (940), Expect = e-115
 Identities = 136/180 (75%), Positives = 150/180 (83%), Gaps = 1/180 (0%)

Query: 316 FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 375
           FGTPE LKYL+D  H  G+ VLLDVVHSHASKNVLDGLN FDGT  C+FH+G RG HPLW
Sbjct: 84  FGTPEDLKYLIDTAHGMGIAVLLDVVHSHASKNVLDGLNMFDGTDGCYFHEGERGNHPLW 143

Query: 376 DSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 435
           DSRLFNY + EVLRFLLSNLRW+L+EY+FDGFRFDGVTSMLYH+HG G GFSG Y EYFG
Sbjct: 144 DSRLFNYGKWEVLRFLLSNLRWWLEEYRFDGFRFDGVTSMLYHHHGLGTGFSGDYGEYFG 203

Query: 436 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIR-PDM 494
           LNVD DAL+YLM+AN  LH+ YP  ITIAEDVSGMP  CRPV+EGG GFDYRL +  PD 
Sbjct: 204 LNVDEDALVYLMLANDLLHELYPNAITIAEDVSGMPGLCRPVSEGGIGFDYRLAMAIPDK 263


Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 406

>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|199884 cd02854, E_set_GBE_euk_N, N-terminal Early set domain associated with the catalytic domain of eukaryotic glycogen branching enzyme (also called 1,4 alpha glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|139075 PRK12568, PRK12568, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|139075 PRK12568, PRK12568, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) Back     alignment and domain information
>gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) Back     alignment and domain information
>gnl|CDD|199884 cd02854, E_set_GBE_euk_N, N-terminal Early set domain associated with the catalytic domain of eukaryotic glycogen branching enzyme (also called 1,4 alpha glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|217237 pfam02806, Alpha-amylase_C, Alpha amylase, C-terminal all-beta domain Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|233850 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>gnl|CDD|233850 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200465 cd11326, AmyAc_Glg_debranch, Alpha amylase catalytic domain found in glycogen debranching enzymes Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200465 cd11326, AmyAc_Glg_debranch, Alpha amylase catalytic domain found in glycogen debranching enzymes Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|217288 pfam02922, CBM_48, Carbohydrate-binding module 48 (Isoamylase N-terminal domain) Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|233728 TIGR02102, pullulan_Gpos, pullulanase, extracellular, Gram-positive Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|217237 pfam02806, Alpha-amylase_C, Alpha amylase, C-terminal all-beta domain Back     alignment and domain information
>gnl|CDD|233730 TIGR02104, pulA_typeI, pullulanase, type I Back     alignment and domain information
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|233730 TIGR02104, pulA_typeI, pullulanase, type I Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|131155 TIGR02100, glgX_debranch, glycogen debranching enzyme GlgX Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|199885 cd02855, E_set_GBE_prok_N, N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|131155 TIGR02100, glgX_debranch, glycogen debranching enzyme GlgX Back     alignment and domain information
>gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200480 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins Back     alignment and domain information
>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|217288 pfam02922, CBM_48, Carbohydrate-binding module 48 (Isoamylase N-terminal domain) Back     alignment and domain information
>gnl|CDD|217288 pfam02922, CBM_48, Carbohydrate-binding module 48 (Isoamylase N-terminal domain) Back     alignment and domain information
>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|235152 PRK03705, PRK03705, glycogen debranching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200480 cd11341, AmyAc_Pullulanase_LD-like, Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1351
PLN02447758 1,4-alpha-glucan-branching enzyme 100.0
PRK12568730 glycogen branching enzyme; Provisional 100.0
PRK147051224 glycogen branching enzyme; Provisional 100.0
PRK14706639 glycogen branching enzyme; Provisional 100.0
PLN02960897 alpha-amylase 100.0
PLN02447 758 1,4-alpha-glucan-branching enzyme 100.0
PRK05402726 glycogen branching enzyme; Provisional 100.0
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 100.0
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
PRK12313633 glycogen branching enzyme; Provisional 100.0
PLN03244872 alpha-amylase; Provisional 100.0
KOG0470|consensus757 100.0
KOG0470|consensus 757 100.0
PLN03244 872 alpha-amylase; Provisional 100.0
PLN02960 897 alpha-amylase 100.0
PRK14706 639 glycogen branching enzyme; Provisional 100.0
PRK12568 730 glycogen branching enzyme; Provisional 100.0
PRK14705 1224 glycogen branching enzyme; Provisional 100.0
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
PRK05402 726 glycogen branching enzyme; Provisional 100.0
PRK12313 633 glycogen branching enzyme; Provisional 100.0
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 100.0
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 100.0
PRK03705 658 glycogen debranching enzyme; Provisional 100.0
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
PLN02877 970 alpha-amylase/limit dextrinase 100.0
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
PRK03705658 glycogen debranching enzyme; Provisional 100.0
TIGR021021111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 100.0
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 100.0
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 100.0
PLN02877970 alpha-amylase/limit dextrinase 100.0
PRK145101221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
PRK10785598 maltodextrin glucosidase; Provisional 100.0
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 100.0
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 100.0
PRK10785598 maltodextrin glucosidase; Provisional 100.0
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 100.0
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK09441479 cytoplasmic alpha-amylase; Reviewed 100.0
PRK09505683 malS alpha-amylase; Reviewed 100.0
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 99.98
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.98
PRK09505683 malS alpha-amylase; Reviewed 99.97
PRK09441479 cytoplasmic alpha-amylase; Reviewed 99.97
PLN00196428 alpha-amylase; Provisional 99.96
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.96
PLN02361401 alpha-amylase 99.96
PLN00196428 alpha-amylase; Provisional 99.95
PLN02784894 alpha-amylase 99.94
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 99.93
PLN02361401 alpha-amylase 99.92
PRK13840495 sucrose phosphorylase; Provisional 99.9
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 99.9
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 99.89
TIGR02455688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.89
PLN02784894 alpha-amylase 99.88
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 99.88
PRK13840495 sucrose phosphorylase; Provisional 99.84
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.83
KOG0471|consensus545 99.82
KOG0471|consensus 545 99.77
TIGR02401825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.73
smart00642166 Aamy Alpha-amylase domain. 99.7
PF14872811 GHL5: Hypothetical glycoside hydrolase 5 99.68
cd0285499 Glycogen_branching_enzyme_like_N_term Glycogen bra 99.66
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.59
cd0285499 Glycogen_branching_enzyme_like_N_term Glycogen bra 99.57
PRK145071693 putative bifunctional 4-alpha-glucanotransferase/m 99.37
PRK14511879 maltooligosyl trehalose synthase; Provisional 99.35
cd02860100 Pullulanase_N_term Pullulanase domain N-terminus. 99.35
KOG2212|consensus504 99.34
PF0280695 Alpha-amylase_C: Alpha amylase, C-terminal all-bet 99.31
smart00642166 Aamy Alpha-amylase domain. 99.27
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 99.21
PF0292285 CBM_48: Carbohydrate-binding module 48 (Isoamylase 99.05
KOG2212|consensus504 99.05
cd02860100 Pullulanase_N_term Pullulanase domain N-terminus. 99.03
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 99.0
COG3280889 TreY Maltooligosyl trehalose synthase [Carbohydrat 98.97
cd02856103 Glycogen_debranching_enzyme_N_term Glycogen_debran 98.9
cd0285385 MTHase_N_term Maltooligosyl trehalose synthase (MT 98.88
PF0292285 CBM_48: Carbohydrate-binding module 48 (Isoamylase 98.87
PRK14511 879 maltooligosyl trehalose synthase; Provisional 98.87
cd02855106 Glycogen_branching_enzyme_N_term Glycogen branchin 98.83
cd02855106 Glycogen_branching_enzyme_N_term Glycogen branchin 98.82
cd02852119 Isoamylase_N_term Isoamylase N-terminus domain. Is 98.8
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 98.78
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 98.68
cd02856103 Glycogen_debranching_enzyme_N_term Glycogen_debran 98.65
cd02852119 Isoamylase_N_term Isoamylase N-terminus domain. Is 98.53
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 98.43
cd0285385 MTHase_N_term Maltooligosyl trehalose synthase (MT 98.35
cd0285885 Esterase_N_term Esterase N-terminal domain. Estera 98.28
cd0286182 E_set_proteins_like E or "early" set-like proteins 98.26
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 98.24
PF1194189 DUF3459: Domain of unknown function (DUF3459); Int 98.17
cd0285885 Esterase_N_term Esterase N-terminal domain. Estera 98.1
PF14701423 hDGE_amylase: glucanotransferase domain of human g 97.9
cd0285979 AMPKbeta_GBD_like AMP-activated protein kinase (AM 97.8
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 97.54
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 97.49
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 97.43
cd0286182 E_set_proteins_like E or "early" set-like proteins 97.29
COG1649418 Uncharacterized protein conserved in bacteria [Fun 97.15
cd0268883 E_set E or "early" set of sugar utilizing enzymes 96.95
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 96.52
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 96.52
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 96.38
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 96.37
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 96.27
cd0268883 E_set E or "early" set of sugar utilizing enzymes 96.12
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 96.08
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 95.96
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 95.79
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 95.68
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 95.67
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 95.62
COG1649418 Uncharacterized protein conserved in bacteria [Fun 95.59
KOG3625|consensus 1521 95.35
cd06600317 GH31_MGAM-like This family includes the following 95.21
cd06600317 GH31_MGAM-like This family includes the following 95.2
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 94.88
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 94.77
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 94.72
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 94.62
PF14701423 hDGE_amylase: glucanotransferase domain of human g 94.45
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 94.29
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 94.1
PF13199559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 93.61
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 93.52
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 93.49
PF13199559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 93.21
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 92.2
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 91.96
PRK10658665 putative alpha-glucosidase; Provisional 91.93
PRK10426635 alpha-glucosidase; Provisional 91.69
cd06595292 GH31_xylosidase_XylS-like This family represents a 91.6
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 91.58
PLN02950909 4-alpha-glucanotransferase 91.56
PRK10426635 alpha-glucosidase; Provisional 91.4
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 91.23
PRK10658665 putative alpha-glucosidase; Provisional 91.14
PF13200316 DUF4015: Putative glycosyl hydrolase domain 90.84
cd06595292 GH31_xylosidase_XylS-like This family represents a 90.82
PF01055441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 90.49
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 90.32
PF01055441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 90.21
COG1501772 Alpha-glucosidases, family 31 of glycosyl hydrolas 90.02
cd0580895 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 90.02
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 89.92
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 89.63
PF13200316 DUF4015: Putative glycosyl hydrolase domain 89.49
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 88.92
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 88.9
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 88.07
smart0063281 Aamy_C Aamy_C domain. 87.61
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 87.57
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 87.27
cd06601332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 86.67
PLN02763978 hydrolase, hydrolyzing O-glycosyl compounds 86.48
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 86.32
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 85.62
PF0068696 CBM_20: Starch binding domain; InterPro: IPR002044 85.61
COG1501 772 Alpha-glucosidases, family 31 of glycosyl hydrolas 84.84
PLN02635538 disproportionating enzyme 84.74
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 84.35
cd06601332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 84.04
PF11852168 DUF3372: Domain of unknown function (DUF3372); Int 83.75
PRK14582671 pgaB outer membrane N-deacetylase; Provisional 82.7
PF1043878 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal 81.77
PRK14508497 4-alpha-glucanotransferase; Provisional 81.44
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 80.97
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 80.82
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 80.7
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
Probab=100.00  E-value=2e-90  Score=856.07  Aligned_cols=523  Identities=46%  Similarity=0.839  Sum_probs=469.4

Q ss_pred             HHHHHhhhccCCCCChhhhhHhhhccc-ccCCCCCccccccccccccCceeEEE-----EEEEEEEeecCCCCcccccee
Q psy9001          21 KYLVDECHKAGLFGTPEQLKYLVDECH-KAGLFGTPEQLKYLVDECHKAGLLCF-----MHVVCAAGDFNNWNREEFAYK   94 (1351)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~f~~~~~l~~l~~~~~~~gv~F~-----A~~V~LvGDFN~Wd~~~~~M~   94 (1351)
                      -|...+.+|+..|   .+..++|++.. +-+.|+.. ...+|.. ..++|++|+     |++|+|+||||+|++..++|+
T Consensus        71 ~~~~~~~~r~~~~---~~~~~~i~~~~~~l~~f~~~-y~~lGa~-~~~~g~~FrvWAP~A~~V~LvGdFN~W~~~~~~M~  145 (758)
T PLN02447         71 PYEDHLRYRYSRY---RRRREEIEKNEGGLEAFSRG-YEKFGFN-RSEGGITYREWAPGAKAAALIGDFNNWNPNAHWMT  145 (758)
T ss_pred             hHHHHHHHHHHHH---HHHHHHHhhcCCCHHHHHHH-HHhceeE-EecCCEEEEEECCCCCEEEEEEecCCCCCCccCce
Confidence            4666788888888   88888888544 34557653 4444444 455899999     999999999999999899999


Q ss_pred             ecCCCeEEEEcCCCCCCCcccCcccEEEEEEEecCCceeeccCCcceEEecCCCC-ccceeeeeeCCCCCCCCccCCCCC
Q psy9001          95 KLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPVV-GHAYEQRIWNPKPQDKHKWTSSKP  173 (1351)
Q Consensus        95 k~~~GvW~~~ip~~~~G~~~~~~g~~Y~y~i~~~~g~~~~~~DPyA~~~~~~~~~-~~~~~~~~~~p~~~~~~~w~~~~p  173 (1351)
                      +.++|+|+++||+ .+|.|+++||++|||+|++.+|....++||||++++.++.. +.++++++|+|+..++|.|++.+|
T Consensus       146 ~~~~GvWe~~ip~-~~g~~~~~~G~~Yky~i~~~~g~~~~r~dpya~~~~~~p~~~~~~~~svv~dp~~~~~y~w~~~~~  224 (758)
T PLN02447        146 KNEFGVWEIFLPD-ADGSPAIPHGSRVKIRMETPDGRWVDRIPAWIKYAVQAPGEIGAPYNGVYWDPPEEEKYVFKHPRP  224 (758)
T ss_pred             eCCCCEEEEEECC-ccccccCCCCCEEEEEEEeCCCcEEeecCchHheeeccCCccCCCCceEEeCCCCCCCCCCCCCCC
Confidence            9889999999999 77878999999999999998898899999999999998752 456788999996445799999888


Q ss_pred             CCCCCceEEEEecCCccCCCCCCCHHHHHHhhhHHHHHcCCCcCceeEEEeecccccccCccceEEEccccccccccccc
Q psy9001         174 KKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAY  253 (1351)
Q Consensus       174 ~~~~~~vIYE~hvr~ft~~~~~G~~~gi~~~~L~yLk~LGvt~~~~~I~L~Pif~~~~~~~~~ii~~~~~~~~~e~~~~~  253 (1351)
                      +.+.+++|||+|||+|+++...|+|+++++++|||||+||||+    |||||                    ++|+  +.
T Consensus       225 ~~~~~~~IYE~Hvg~~~~~~~~gty~~~~~~~L~ylk~LG~t~----I~LmP--------------------i~e~--~~  278 (758)
T PLN02447        225 PRPAALRIYEAHVGMSSEEPKVNSYREFADDVLPRIKALGYNA----VQLMA--------------------IQEH--AY  278 (758)
T ss_pred             CCCCCCEEEEEeCCcccCCCCCCCHHHHHHHHHHHHHHcCCCE----EEECC--------------------cccc--CC
Confidence            7778999999999999988889999999988899999999999    99999                    4454  55


Q ss_pred             cCCCCccccCcccccccccchhhhcccccCCCCchhcccccccCCCCccccccccccccCCCCCCHHHHHHHHHHHHHcC
Q psy9001         254 AESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDECHKAG  333 (1351)
Q Consensus       254 ~~s~~~~~wGY~~~~y~~~~~e~~~~~s~~~dp~~~~~a~~~~y~~~~~~~y~~d~~~id~~~G~~~efk~LV~~~H~~G  333 (1351)
                      .++     |||++++||                     +++                   ++||+++|||+||++||++|
T Consensus       279 ~~~-----wGY~~~~~f---------------------a~~-------------------~~~Gtp~dlk~LVd~aH~~G  313 (758)
T PLN02447        279 YGS-----FGYHVTNFF---------------------AVS-------------------SRSGTPEDLKYLIDKAHSLG  313 (758)
T ss_pred             CCC-----CCcCcccCc---------------------ccc-------------------cccCCHHHHHHHHHHHHHCC
Confidence            555     999999999                     887                   89999999999999999999


Q ss_pred             CEEEEEeeccccccCCcCCcccCCCCCCcCcccCCCCCCCCCCCccCCCCCHHHHHHHHHHHHHHHHHcCCCcccccccc
Q psy9001         334 LYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVT  413 (1351)
Q Consensus       334 I~VILDvV~NH~~~~~~~~~~~f~g~~~~yy~~~~~~~~~~w~~~~ln~~~p~v~~~l~~~l~~W~~e~~vDGfR~D~a~  413 (1351)
                      |+||||||+||++.+...++..|+|+...||+.++.+.+..|++.+||+++++||+||+++++||++||||||||||++.
T Consensus       314 I~VilDvV~nH~~~~~~~gl~~fDg~~~~Yf~~~~~g~~~~w~~~~~N~~~~eVr~fLl~~~~~Wl~ey~IDGfRfDaV~  393 (758)
T PLN02447        314 LRVLMDVVHSHASKNTLDGLNGFDGTDGSYFHSGPRGYHWLWDSRLFNYGNWEVLRFLLSNLRWWLEEYKFDGFRFDGVT  393 (758)
T ss_pred             CEEEEEeccccccccccccccccCCCCccccccCCCCCcCcCCCceecCCCHHHHHHHHHHHHHHHHHhCcccccccchh
Confidence            99999999999998866778889998878888777777788988899999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCCCCccccCCCccCchHHHHHHHHHHHHHhhCCCeEEEEEcCCCCCCcccccccCCCCCCCcCC--cC
Q psy9001         414 SMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLE--IR  491 (1351)
Q Consensus       414 ~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~f~~~~~~~v~~~~P~~~~iaE~~~~~p~~~~~~~~gg~gfd~~~~--~~  491 (1351)
                      +|+|+++|.+.+|++++.+++++++|.+++.||+++|+.||+.+|++++|||+++++|.+|+|++.||+||||+|+  |+
T Consensus       394 smlY~~hg~~~~f~~~~~~~~g~~~d~~a~~fL~~~N~~i~~~~p~~~~IAEd~s~~p~l~~p~~~GGlGFDykw~Mg~~  473 (758)
T PLN02447        394 SMLYHHHGLQMAFTGNYNEYFGMATDVDAVVYLMLANDLLHGLYPEAVTIAEDVSGMPTLCRPVQEGGVGFDYRLAMAIP  473 (758)
T ss_pred             hhhccccCcccccccCcccccCCccChHHHHHHHHHHHHHHHhCCCeEEEEEcCCCCCCccccCCCCcCCcceEECCccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999  77


Q ss_pred             CCC------------------------------------------CCCc-------------------------------
Q psy9001         492 PDM------------------------------------------SDMT-------------------------------  498 (1351)
Q Consensus       492 ~d~------------------------------------------~~~s-------------------------------  498 (1351)
                      ++.                                          ++++                               
T Consensus       474 ~~~l~~l~~~~d~~~~~~~l~~sl~~r~~~E~~I~y~eSHDevv~Gkksl~~~l~d~~my~~m~~~~~~~~~~~R~~~lh  553 (758)
T PLN02447        474 DKWIELLKEKRDEDWSMGDIVHTLTNRRYTEKCVAYAESHDQALVGDKTIAFWLMDKEMYDGMSTLTPATPVVDRGIALH  553 (758)
T ss_pred             hHHHHHHhhCCCcccCHHHHHHHHhcccccCceEeccCCcCeeecCcchhHhhhcchhhhhcCCCChhhhhhHHHHHHHH
Confidence            653                                          1111                               


Q ss_pred             -----------------------------------------------------------HHHHHHHHHHhhhcccccccC
Q psy9001         499 -----------------------------------------------------------VGTFDAAMNTTEERFKWLSAD  519 (1351)
Q Consensus       499 -----------------------------------------------------------l~~f~k~L~~Lr~~~~~L~~g  519 (1351)
                                                                                 |++|+|+||+|++++++|..+
T Consensus       554 kmirl~~~~~pG~g~L~FMGnEFg~~ew~Dfpr~~n~ws~~~~~~~W~L~d~~~l~~~~l~~f~~~L~~l~~~~~~L~~~  633 (758)
T PLN02447        554 KMIRLITMALGGEGYLNFMGNEFGHPEWIDFPREGNGWSYDKCRRRWDLADADHLRYKFLNAFDRAMMHLDEKYGFLTSE  633 (758)
T ss_pred             HHHHHHHHhCCCCcceeecccccCCchhccCcccccccCcccccCCccccCCCchhhhHHHHHHHHHHHHHhcCccccCC
Confidence                                                                       256999999999999999999


Q ss_pred             CcceEeecCCCcEEEEEeCceEEEEeCCCCCcccccccccccCcccccccccccccccceEeeeccCCceEEEccCCCCc
Q psy9001         520 PGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVVLDSDCSH  599 (1351)
Q Consensus       520 ~~~~~~~~~~~~Vlaf~R~~ll~v~Nf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~g~~~~vlnsD~~~  599 (1351)
                      ..++...+++++||+|.|..|||||||+|++++.+|+                        ||||.+|+|++|||||+.+
T Consensus       634 ~~~i~~~d~~~~Viaf~R~~ll~V~NF~p~~s~~~Y~------------------------igvp~~G~y~~ilnSD~~~  689 (758)
T PLN02447        634 HQYVSRKDEGDKVIVFERGDLVFVFNFHPTNSYSDYR------------------------VGCDKPGKYKIVLDSDAWE  689 (758)
T ss_pred             CceeeeecCCCCEEEEEeCCeEEEEeCCCCCCCCCcE------------------------ECCCCCCeEEEEECCCchh
Confidence            8899999999999999999999999999977899999                        9999999999999999999


Q ss_pred             cCcccccCCCCceeeeecccCCcccEEEEEeCCcEEEEEEECCCC
Q psy9001         600 FGGFNRLDPGTVYETYPEPWNNRRNSIKLYLPTRTGLILTTSPGT  644 (1351)
Q Consensus       600 ygG~~~~~~~~~~~~~~~~~~g~~~si~l~LPpls~~vl~~~~~~  644 (1351)
                      |||+++++..+.+.+++.+|+|+++||.|+|||++++||++.++.
T Consensus       690 fGG~~~~~~~~~~~~~~~~~~~~~~s~~v~iP~~~~~vl~~~~~~  734 (758)
T PLN02447        690 FGGFGRVDHDADHFTPEGNFDNRPHSFMVYAPSRTAVVYAPVDED  734 (758)
T ss_pred             cCCCCccCCCccEEecccCcCCCCcEEEEEeCCceEEEEEECCcc
Confidence            999999876666888999999999999999999999999998654



>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>cd02860 Pullulanase_N_term Pullulanase domain N-terminus Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>PF02806 Alpha-amylase_C: Alpha amylase, C-terminal all-beta domain; InterPro: IPR006048 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>cd02860 Pullulanase_N_term Pullulanase domain N-terminus Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain Back     alignment and domain information
>cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain Back     alignment and domain information
>PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain Back     alignment and domain information
>cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain Back     alignment and domain information
>cd02852 Isoamylase_N_term Isoamylase N-terminus domain Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain Back     alignment and domain information
>cd02852 Isoamylase_N_term Isoamylase N-terminus domain Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain Back     alignment and domain information
>cd02858 Esterase_N_term Esterase N-terminal domain Back     alignment and domain information
>cd02861 E_set_proteins_like E or "early" set-like proteins Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF11941 DUF3459: Domain of unknown function (DUF3459); InterPro: IPR022567 This functionally uncharacterised domain is found in bacteria Back     alignment and domain information
>cd02858 Esterase_N_term Esterase N-terminal domain Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>cd02861 E_set_proteins_like E or "early" set-like proteins Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3625|consensus Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>smart00632 Aamy_C Aamy_C domain Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>PF11852 DUF3372: Domain of unknown function (DUF3372); InterPro: IPR024561 This entry represents the uncharacterised C-terminal domain of secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>PF10438 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal domain; InterPro: IPR019492 This domain is at the very C terminus of cyclo-malto-dextrinase proteins and consists of 8 beta strands, is largely globular and appears to help stabilise the active sites created by upstream domains, IPR015171 from INTERPRO, and IPR006047 from INTERPRO Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1351
3amk_A702 Structure Of The Starch Branching Enzyme I (Bei) Fr 5e-65
3amk_A 702 Structure Of The Starch Branching Enzyme I (Bei) Fr 5e-64
3aml_A755 Structure Of The Starch Branching Enzyme I (Bei) Fr 2e-64
3aml_A 755 Structure Of The Starch Branching Enzyme I (Bei) Fr 5e-64
3k1d_A722 Crystal Structure Of Glycogen Branching Enzyme Syno 9e-22
1m7x_A617 The X-Ray Crystallographic Structure Of Branching E 3e-21
1eha_A558 Crystal Structure Of Glycosyltrehalose Trehalohydro 4e-08
1eh9_A558 Crystal Structure Of Sulfolobus Solfataricus Glycos 4e-08
3vgg_A558 Crystal Structure Of Glycosyltrehalose Trehalohydro 5e-08
3vgd_A558 Ctystal Structure Of Glycosyltrehalose Trehalohydro 2e-07
3vge_A558 Crystal Structure Of Glycosyltrehalose Trehalohydro 2e-07
2bhu_A602 Crystal Structure Of Deinococcus Radiodurans Maltoo 1e-06
2bhy_A602 Crystal Structure Of Deinococcus Radiodurans Maltoo 3e-06
2vnc_A718 Crystal Structure Of Glycogen Debranching Enzyme Tr 5e-06
2vnc_A 718 Crystal Structure Of Glycogen Debranching Enzyme Tr 3e-05
4gkl_A422 Crystal Structure Of A Noncanonic Maltogenic Alpha- 2e-05
2ya0_A714 Catalytic Module Of The Multi-Modular Glycogen-Degr 3e-05
2ya0_A 714 Catalytic Module Of The Multi-Modular Glycogen-Degr 9e-05
2ya2_A708 Catalytic Module Of The Multi-Modular Glycogen-Degr 3e-05
2ya2_A 708 Catalytic Module Of The Multi-Modular Glycogen-Degr 9e-05
2ya1_A1014 Product Complex Of A Multi-Modular Glycogen-Degradi 3e-05
2ya1_A 1014 Product Complex Of A Multi-Modular Glycogen-Degradi 1e-04
3faw_A 877 Crystal Structure Of The Group B Streptococcus Pull 5e-05
1j0h_A588 Crystal Structure Of Bacillus Stearothermophilus Ne 7e-05
1j0j_A588 Crystal Structure Of Neopullulanase E357q Complex W 7e-05
3m07_A 618 1.4 Angstrom Resolution Crystal Structure Of Putati 2e-04
1gvi_A588 Thermus Maltogenic Amylase In Complex With Beta-Cd 4e-04
1gvi_A588 Thermus Maltogenic Amylase In Complex With Beta-Cd 5e-04
1sma_A588 Crystal Structure Of A Maltogenic Amylase Length = 4e-04
1sma_A588 Crystal Structure Of A Maltogenic Amylase Length = 5e-04
>pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 702 Back     alignment and structure

Iteration: 1

Score = 246 bits (628), Expect = 5e-65, Method: Compositional matrix adjust. Identities = 145/411 (35%), Positives = 212/411 (51%), Gaps = 70/411 (17%) Query: 81 GDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWA 140 G+FNNWN + +K FG W + + + +G + H S+VK R+ G +DR+ W Sbjct: 83 GEFNNWNGAKHKMEKDKFGIWSIKIS-HVNGKPAIPHNSKVKFRFRHGGGAWVDRIPAWI 141 Query: 141 TYVT-EPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYE 199 Y T + G Y+ W+P +++ + +P KPD +IYE+HVG+ +E + ++Y Sbjct: 142 RYATFDASKFGAPYDGVHWDPPACERYVFKHPRPPKPDAPRIYEAHVGMSGEEPEVSTYR 201 Query: 200 DFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEKTVAYAESHDQ 259 +F V+PRI + ++N ++ + + Y Sbjct: 202 EFADNVLPRI------------------RANNYNTVQLMAIMEHSYY------------- 230 Query: 260 ALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTP 319 A G F+ + + T D ++D+A H G Sbjct: 231 ASFGYHVTNFFAVS----SRSGTPEDLKYLVDKA-----------------HSLG----- 264 Query: 320 EQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRL 379 L+ L+D H S+ + L+G + T +FH G RG H LWDSRL Sbjct: 265 --LRVLMDVVHSHA---------SNNVTDGLNGYDVGQNTHESYFHTGDRGYHKLWDSRL 313 Query: 380 FNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVD 439 FNY+ EVLRFLLSNLR+++DE+ FDGFRFDGVTSMLYH+HG +GF+G+Y EYF L+ D Sbjct: 314 FNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGINKGFTGNYKEYFSLDTD 373 Query: 440 TDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEI 490 DA++Y+M+AN +H PE +AEDVSGMP CRPV EGG GFD+RL + Sbjct: 374 VDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDFRLAM 424
>pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 702 Back     alignment and structure
>pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 755 Back     alignment and structure
>pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 755 Back     alignment and structure
>pdb|3K1D|A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H37rv Length = 722 Back     alignment and structure
>pdb|1M7X|A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme Length = 617 Back     alignment and structure
>pdb|1EHA|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase From Sulfolobus Solfataricus Length = 558 Back     alignment and structure
>pdb|1EH9|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Glycosyltrehalose Trehalohydrolase Length = 558 Back     alignment and structure
>pdb|3VGG|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (E283q) Complexed With Maltoheptaose Length = 558 Back     alignment and structure
>pdb|3VGD|A Chain A, Ctystal Structure Of Glycosyltrehalose Trehalohydrolase (D252e) Length = 558 Back     alignment and structure
>pdb|3VGE|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (D252s) Length = 558 Back     alignment and structure
>pdb|2BHU|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase Length = 602 Back     alignment and structure
>pdb|2BHY|A Chain A, Crystal Structure Of Deinococcus Radiodurans Maltooligosyltrehalose Trehalohydrolase In Complex With Trehalose Length = 602 Back     alignment and structure
>pdb|2VNC|A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus Length = 718 Back     alignment and structure
>pdb|2VNC|A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus Length = 718 Back     alignment and structure
>pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana Length = 422 Back     alignment and structure
>pdb|2YA0|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 714 Back     alignment and structure
>pdb|2YA0|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 714 Back     alignment and structure
>pdb|2YA2|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua In Complex With An Inhibitor Length = 708 Back     alignment and structure
>pdb|2YA2|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua In Complex With An Inhibitor Length = 708 Back     alignment and structure
>pdb|2YA1|A Chain A, Product Complex Of A Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 1014 Back     alignment and structure
>pdb|2YA1|A Chain A, Product Complex Of A Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 1014 Back     alignment and structure
>pdb|3FAW|A Chain A, Crystal Structure Of The Group B Streptococcus Pullulanase Sap Length = 877 Back     alignment and structure
>pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 Back     alignment and structure
>pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 Back     alignment and structure
>pdb|3M07|A Chain A, 1.4 Angstrom Resolution Crystal Structure Of Putative Alpha Amylase From Salmonella Typhimurium Length = 618 Back     alignment and structure
>pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 Back     alignment and structure
>pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 Back     alignment and structure
>pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 Back     alignment and structure
>pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1351
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 2e-92
3aml_A755 OS06G0726400 protein; starch-branching, transferas 2e-92
3aml_A755 OS06G0726400 protein; starch-branching, transferas 1e-34
3aml_A755 OS06G0726400 protein; starch-branching, transferas 2e-32
3aml_A755 OS06G0726400 protein; starch-branching, transferas 5e-32
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 6e-16
3aml_A755 OS06G0726400 protein; starch-branching, transferas 3e-15
3aml_A755 OS06G0726400 protein; starch-branching, transferas 2e-14
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 5e-12
3aml_A755 OS06G0726400 protein; starch-branching, transferas 3e-06
3aml_A755 OS06G0726400 protein; starch-branching, transferas 2e-04
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 4e-38
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 5e-38
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 1e-08
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 4e-08
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 9e-07
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 7e-06
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 8e-38
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 9e-38
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 1e-08
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 4e-08
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 4e-07
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 4e-06
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 2e-24
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 4e-24
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 2e-04
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 5e-04
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 1e-23
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 2e-23
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 1e-04
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 6e-04
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 2e-21
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 2e-21
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 9e-05
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 7e-04
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 9e-12
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 1e-11
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 1e-11
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 5e-11
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 5e-11
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 1e-10
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 6e-11
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 8e-11
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 7e-11
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 7e-11
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 1e-10
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 1e-10
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 2e-10
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 5e-10
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 3e-10
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 3e-10
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 6e-10
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 7e-10
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 1e-09
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 3e-09
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 3e-09
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 3e-09
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 3e-09
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 4e-09
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 6e-09
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 6e-09
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 6e-09
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 1e-08
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 1e-08
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 2e-08
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 1e-08
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 2e-08
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 1e-08
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 1e-08
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 8e-08
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 3e-07
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 5e-07
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 4e-07
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 4e-07
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 5e-07
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 1e-06
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 7e-07
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 1e-06
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 9e-07
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 2e-06
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 1e-06
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 2e-06
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 1e-06
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 2e-06
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 1e-06
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 2e-06
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 3e-06
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 3e-06
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 4e-06
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 4e-06
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 6e-06
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 1e-05
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 3e-05
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 7e-05
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 4e-05
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 7e-05
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 7e-05
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 1e-04
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 2e-04
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 3e-04
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 3e-04
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 3e-04
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 4e-04
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 9e-04
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 3e-04
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 3e-04
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 8e-04
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 8e-04
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
 Score =  315 bits (808), Expect = 2e-92
 Identities = 113/177 (63%), Positives = 135/177 (76%), Gaps = 3/177 (1%)

Query: 1029 FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFD---GTQACFFHDGPRGTH 1085
             GTPE LKYLVD+ H  GL VL+DVVHSHAS NV DGLN +D    T   +FH G RG H
Sbjct: 247  SGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHESYFHTGDRGYH 306

Query: 1086 PLWDSRLFNYSEIEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDE 1145
             LWDSRLFNY+  EVLRFLLSNLR++++E+ FDGFRFDGVTSMLYH+HG  +GF+G+Y E
Sbjct: 307  KLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGINKGFTGNYKE 366

Query: 1146 YFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLG 1202
            YF L+ D DA++Y+M+AN  +H   PE   +AEDVSGMP  CRPV EGG GFD+RL 
Sbjct: 367  YFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDFRLA 423


>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 750 Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 750 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Length = 657 Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Length = 657 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Length = 718 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Length = 718 Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Length = 877 Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Length = 877 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Length = 718 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Length = 718 Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Length = 714 Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Length = 714 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Length = 1014 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Length = 1014 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Length = 921 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Length = 921 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Length = 884 Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Length = 884 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Length = 1083 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Length = 1083 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1351
3aml_A755 OS06G0726400 protein; starch-branching, transferas 100.0
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 100.0
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 100.0
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 100.0
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 100.0
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 100.0
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 100.0
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 100.0
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 100.0
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 100.0
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 100.0
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 100.0
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 100.0
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 100.0
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 100.0
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 100.0
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 100.0
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.98
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.98
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 99.98
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.98
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.98
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.97
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 99.97
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 99.97
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.97
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.97
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 99.97
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.97
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.97
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.96
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.96
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.94
1iv8_A720 Maltooligosyl trehalose synthase; beta alpha barre 99.9
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.86
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.82
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.81
3hje_A704 704AA long hypothetical glycosyltransferase; treha 99.81
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.7
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.68
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.61
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.51
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.01
1z0n_A96 5'-AMP-activated protein kinase, beta-1 subunit; b 98.62
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 97.77
1z0n_A96 5'-AMP-activated protein kinase, beta-1 subunit; b 97.62
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 97.52
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 97.48
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 97.46
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 96.9
2qlv_B252 Protein SIP2, protein SPM2; heterotrimer, ATP-bind 96.82
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 96.81
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 96.81
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 96.35
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 95.93
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 95.92
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 95.67
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 94.74
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 92.62
3vmn_A 643 Dextranase; TIM barrel, immunoglobrin fold, greek- 92.47
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 92.27
3vmn_A643 Dextranase; TIM barrel, immunoglobrin fold, greek- 92.15
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 91.05
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 90.66
2f2h_A773 Putative family 31 glucosidase YICI; BETA8alpha8 b 90.54
2g3m_A693 Maltase, alpha-glucosidase; hydrolase, glycoside h 90.45
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 90.34
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 90.11
2g3m_A 693 Maltase, alpha-glucosidase; hydrolase, glycoside h 90.09
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 89.43
3l4y_A875 Maltase-glucoamylase, intestinal; glycoside hydrol 89.38
3lpp_A898 Sucrase-isomaltase; glycoside hydrolase family 31, 89.28
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 89.25
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 89.11
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 88.58
3nsx_A666 Alpha-glucosidase; structural genomics, PSI-2, pro 88.07
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 87.7
3nsx_A 666 Alpha-glucosidase; structural genomics, PSI-2, pro 87.31
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 86.76
2z0b_A131 GDE5, KIAA1434, putative glycerophosphodiester pho 86.5
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 86.29
4ba0_A817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 85.7
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 85.28
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 85.26
4ba0_A 817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 85.04
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 84.94
2aam_A309 Hypothetical protein TM1410; structural genomics, 84.86
1ac0_A108 Glucoamylase; hydrolase, starch binding domain; HE 84.02
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 83.58
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 83.02
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 82.58
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 82.03
1x7f_A385 Outer surface protein; structural genomics, unknow 82.0
3cc1_A433 BH1870 protein, putative alpha-N-acetylgalactosami 80.66
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 80.48
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 80.02
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
Probab=100.00  E-value=3.8e-76  Score=748.25  Aligned_cols=526  Identities=42%  Similarity=0.739  Sum_probs=442.8

Q ss_pred             hhhhHHHHHhhhccCCCCChhhhhHhhhccc-ccCCCCCccccccccccccCceeEEE-----EEEEEEEeecCCCCccc
Q psy9001          17 PEQLKYLVDECHKAGLFGTPEQLKYLVDECH-KAGLFGTPEQLKYLVDECHKAGLLCF-----MHVVCAAGDFNNWNREE   90 (1351)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~f~~~~~l~~l~~~~~~~gv~F~-----A~~V~LvGDFN~Wd~~~   90 (1351)
                      |--.-|-..+.+++..|   ++..+.|++.. .-+.|...  -..++....+.||+|+     |++|+|+||||+|++..
T Consensus        18 ~~l~~~~~~~~~r~~~~---~~~~~~~~~~~~~~~~f~~~--~~~lGa~~~~~gv~F~vwAP~A~~V~l~gdfn~w~~~~   92 (755)
T 3aml_A           18 PKLEEFKDHFNYRIKRY---LDQKCLIEKHEGGLEEFSKG--YLKFGINTVDGATIYREWAPAAQEAQLIGEFNNWNGAK   92 (755)
T ss_dssp             GGGGGGHHHHHHHHHHH---HHHHHHHHHHHSCHHHHTTG--GGTSEEEEETTEEEEEEECTTCSEEEEEEGGGTTCCTT
T ss_pred             CcchhhHHHHHHHHHHH---HHHHHHHHhcCCcHHHHhhh--hhcCceEEeCCeEEEEEECCCCCEEEEEEecCCCCCce
Confidence            33344556778888888   88888887543 34556543  2344555667899999     99999999999999989


Q ss_pred             cceeecCCCeEEEEcCCCCCCCcccCcccEEEEEEEecCCceeeccCCcceEEecCCC-CccceeeeeeCCCCCCCCccC
Q psy9001          91 FAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRLSPWATYVTEPPV-VGHAYEQRIWNPKPQDKHKWT  169 (1351)
Q Consensus        91 ~~M~k~~~GvW~~~ip~~~~G~~~~~~g~~Y~y~i~~~~g~~~~~~DPyA~~~~~~~~-~~~~~~~~~~~p~~~~~~~w~  169 (1351)
                      ++|++.++|+|+++||+. .|.+.+.+|++|+|+|.+.+|++..++||||++++.++. .+..+++++++|+...+|.|+
T Consensus        93 ~~m~~~~~GvW~~~v~~~-~g~~~i~~g~~Y~y~i~~~~g~~~~~~dpya~~~~~~~~~~~~~~~~~v~d~~~~~~~~w~  171 (755)
T 3aml_A           93 HKMEKDKFGIWSIKISHV-NGKPAIPHNSKVKFRFRHGGGAWVDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFK  171 (755)
T ss_dssp             CBCEECTTSEEEEEEECB-TTBCSSCTTEEEEEEEECTTCCCEEECCTTCSCEEECCSSSSCCEEEEECCCCGGGCCCCC
T ss_pred             eeceeCCCCEEEEEEccc-ccccCCCCCCEEEEEEECCCCcEEecCCcchheEeecccccCcccceEEECCcccccCCCC
Confidence            999998889999999963 344457788999999998889888899999999998876 355667788887433469999


Q ss_pred             CCCCCCCCCceEEEEecCCccCCCCCCCHHHHHHhhhHHHHHcCCCcCceeEEEeecccccccCccceEEEccccccccc
Q psy9001         170 SSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGMAIPDKWIELLKKFKDEDWNMGNIVHTLTNRRYMEK  249 (1351)
Q Consensus       170 ~~~p~~~~~~vIYE~hvr~ft~~~~~G~~~gi~~~~L~yLk~LGvt~~~~~I~L~Pif~~~~~~~~~ii~~~~~~~~~e~  249 (1351)
                      +.+++.+.+++|||+|||+|+.+...|+|++|+++.|||||+||||+    |||||||                    ++
T Consensus       172 ~~~~~~~~~~~IYE~hv~~~~~~~~~Gt~~~l~~~~L~yLk~LGvt~----I~L~Pi~--------------------e~  227 (755)
T 3aml_A          172 HPRPPKPDAPRIYEAHVGMSGEEPEVSTYREFADNVLPRIRANNYNT----VQLMAIM--------------------EH  227 (755)
T ss_dssp             SCCCCCCSSCEEEEEESTTCSSSSSCCCHHHHHHHTHHHHHHTTCCE----EEEESCE--------------------EC
T ss_pred             CcCCCCCCCCEEEEEeeeccccCCCCCCHHHHHHHHHHHHHHcCCCE----EEECchh--------------------cC
Confidence            88877778999999999999988889999999986699999999999    9999944                    43


Q ss_pred             cccccCCCCccccCcccccccccchhhhcccccCCCCchhcccccccCCCCccccccccccccCCCCCCHHHHHHHHHHH
Q psy9001         250 TVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTLSDPSLIIDRACEKFGTPEQLKYLVDECHKAGLFGTPEQLKYLVDEC  329 (1351)
Q Consensus       250 ~~~~~~s~~~~~wGY~~~~y~~~~~e~~~~~s~~~dp~~~~~a~~~~y~~~~~~~y~~d~~~id~~~G~~~efk~LV~~~  329 (1351)
                        +...     +|||++++||                     +++                   |+||+++|||+||++|
T Consensus       228 --~~~~-----~~GY~~~dy~---------------------a~~-------------------~~~Gt~~df~~lv~~~  260 (755)
T 3aml_A          228 --SYYA-----SFGYHVTNFF---------------------AVS-------------------SRSGTPEDLKYLVDKA  260 (755)
T ss_dssp             --SCGG-----GTTCSCSEEE---------------------EEC-------------------GGGCCHHHHHHHHHHH
T ss_pred             --CCCC-----CCCCccCCCC---------------------ccC-------------------CCCCCHHHHHHHHHHH
Confidence              3333     4999999999                     887                   8999999999999999


Q ss_pred             HHcCCEEEEEeeccccccCCcCCcccCC---CCCCcCcccCCCCCCCCCCCccCCCCCHHHHHHHHHHHHHHHHHcCCCc
Q psy9001         330 HKAGLYVLLDVVHSHASKNVLDGLNEFD---GTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLDEYQFDG  406 (1351)
Q Consensus       330 H~~GI~VILDvV~NH~~~~~~~~~~~f~---g~~~~yy~~~~~~~~~~w~~~~ln~~~p~v~~~l~~~l~~W~~e~~vDG  406 (1351)
                      |++||+||||+|+||++.++.+++..|+   +..+.||+.++.+.+..|++++||+++|+||++|+++++||++||||||
T Consensus       261 H~~Gi~VilD~V~NH~~~~~~~g~~~fd~~~~~~~~yf~~~~~g~~~~w~~~~lN~~~p~V~~~l~~~l~~Wl~e~gvDG  340 (755)
T 3aml_A          261 HSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHESYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDG  340 (755)
T ss_dssp             HHTTCEEEEEECCSCBCCCTTTSGGGGCSSCCGGGSSBCCGGGGEETTTTEECBCTTSHHHHHHHHHHHHHHHHHHCCCE
T ss_pred             HHCCCEEEEEEeccccccccccchhccccCCCCCcceeecCCCCccCCCCCceeccCCHHHHHHHHHHHHHHHHHcCCCE
Confidence            9999999999999999998877777777   6556788876667778899999999999999999999999999999999


Q ss_pred             cccccccccccccCCCCCCCCCCccccCCCccCchHHHHHHHHHHHHHhhCCCeEEEEEcCCCCCCcccccccCCCCCCC
Q psy9001         407 FRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDY  486 (1351)
Q Consensus       407 fR~D~a~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~f~~~~~~~v~~~~P~~~~iaE~~~~~p~~~~~~~~gg~gfd~  486 (1351)
                      ||||+|.+|++.+++.+.+|+..+..+++...|.+++.||+++++.+++.+|++++|||.|+++|.++.+...+|.||||
T Consensus       341 fR~Dav~~m~~~~~g~~~~f~~~~~~~~~~~~~~~ai~fl~~~~~~v~~~~p~~~lIaE~~~~~p~~~~~~~~gglgFd~  420 (755)
T 3aml_A          341 FRFDGVTSMLYHHHGINKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGGVGFDF  420 (755)
T ss_dssp             EEETTHHHHHBTTTTTTCCCCSCGGGTSSTTBCHHHHHHHHHHHHHHHHHCTTCEEEECCSSCCTTTTSCGGGTSCCCSE
T ss_pred             EEecchhhhhhcccCcccccccccccccccccchhHHHHHHHHHHHHHHHCCCeEEEEEccCCCccceeeccCCCccccc
Confidence            99999999998877776667666666778888999999999999999999999999999999999999988888889987


Q ss_pred             cCC--cC---------------------------------------CCC---CC--------------------------
Q psy9001         487 RLE--IR---------------------------------------PDM---SD--------------------------  496 (1351)
Q Consensus       487 ~~~--~~---------------------------------------~d~---~~--------------------------  496 (1351)
                      +|+  |+                                       +|.   ++                          
T Consensus       421 ~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~l~~~~~~~~~vnf~~nHD~~r~g~~~~~f~l~d~~~~~~~~~l~~~~~~~  500 (755)
T 3aml_A          421 RLAMAIPDRWIDYLKNKEDRKWSMSEIVQTLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYTGMSDLQPASPTI  500 (755)
T ss_dssp             EECTTHHHHHHHHHHHCCGGGCCHHHHHHHHHCSCTTSCEEECSCCCCTTSCCCBCHHHHHHTTHHHHSCBSSSCCCHHH
T ss_pred             cccccchHHHHHHHhhCCccccCHHHHHHHHHhccCchhheehhhcCCccccccccccccccchhhhhhhhhccccchhh
Confidence            663  10                                       110   00                          


Q ss_pred             ----------------------------------------------------------------CcHHHHHHHHHHhhhc
Q psy9001         497 ----------------------------------------------------------------MTVGTFDAAMNTTEER  512 (1351)
Q Consensus       497 ----------------------------------------------------------------~sl~~f~k~L~~Lr~~  512 (1351)
                                                                                      +.|.+|+|+||+||++
T Consensus       501 ~~~~~~~k~a~~~llt~pG~P~lly~G~E~G~~~~~~~p~~g~~~~~~~~r~~W~~~~~~~~~~~~l~~~~r~Li~lRk~  580 (755)
T 3aml_A          501 NRGIALQKMIHFITMALGGDGYLNFMGNEFGHPEWIDFPREGNNWSYDKCRRQWSLVDTDHLRYKYMNAFDQAMNALEEE  580 (755)
T ss_dssp             HHHHHHHHHHHHHHHHHHCSEEEEETTGGGTCCSBCCCCCGGGTTCCTTSSCCHHHHHCTTBSHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHCCCCEEEEeCchhcCCcCcccCcccCCCCCcccccCCcccccCccchhHHHHHHHHHHHHHHHh
Confidence                                                                            1256789999999999


Q ss_pred             ccccccCCcceEeecCCCcEEEEEeCceEEEEeCCCCCcccccccccccCcccccccccccccccceEeeeccCCceEEE
Q psy9001         513 FKWLSADPGYVSTKHEGDKVIIFERAGLLFAFNFNGTQSFTDYRYCSTQSYSTHNTWTWRGSISKLHRVGVEQAGKYKVV  592 (1351)
Q Consensus       513 ~~~L~~g~~~~~~~~~~~~Vlaf~R~~ll~v~Nf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~g~~~~v  592 (1351)
                      +|+|+.|..++...+.+++|++|.|..+|||+||++.+.+.+|+                        ||+|.+|+|++|
T Consensus       581 ~paL~~G~~~~~~~~~~~~vlaf~R~~llVv~N~s~~~~~~~~~------------------------i~vp~~g~~~~v  636 (755)
T 3aml_A          581 FSFLSSSKQIVSDMNEKDKVIVFERGDLVFVFNFHPNKTYKGYK------------------------VGCDLPGKYRVA  636 (755)
T ss_dssp             HCGGGCCCEEEEEEETTTTEEEEEETTEEEEEECCSSCCEEEEE------------------------EEESSCSEEEEE
T ss_pred             ChhhcCCCEEEEeecCCCcEEEEEECCEEEEEECCCCCccceeE------------------------ECCCCCCeEEEE
Confidence            99999886566565667889999999999999999986677777                        999999999999


Q ss_pred             ccCCCCccCcccccCCCCceeee--------ecccCCcccEEEEEeCCcEEEEEEECCC
Q psy9001         593 LDSDCSHFGGFNRLDPGTVYETY--------PEPWNNRRNSIKLYLPTRTGLILTTSPG  643 (1351)
Q Consensus       593 lnsD~~~ygG~~~~~~~~~~~~~--------~~~~~g~~~si~l~LPpls~~vl~~~~~  643 (1351)
                      ||||+..|||++.++....+.+.        +.+++|++++|.|+|||++++||+.+++
T Consensus       637 lnsd~~~~gG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lPp~s~~vl~~~~~  695 (755)
T 3aml_A          637 LDSDALVFGGHGRVGHDVDHFTSPEGMPGVPETNFNNRPNSFKVLSPPRTCVAYYRVDE  695 (755)
T ss_dssp             EETTSGGGTSCCCSCTTCCEECEECSCTTCGGGSBTTBSEEEEEEECTTEEEEEEECCT
T ss_pred             EeCCccccCCccccCCccceecccccccccccccccCCCCeEEEEECCCEEEEEEEcCc
Confidence            99999999999887655455554        5789999999999999999999999763



>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>3cc1_A BH1870 protein, putative alpha-N-acetylgalactosaminidase; structural genomic center for structural genomics, JCSG; HET: MSE PGE PG4 P33; 2.00A {Bacillus halodurans c-125} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1351
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 2e-16
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 5e-16
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 2e-04
d1m7xa2106 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching en 5e-15
d1m7xa2106 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching en 5e-12
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 1e-10
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 1e-10
d1m7xa1110 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching en 9e-09
d1m7xa1110 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching en 0.002
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 1e-07
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 1e-07
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 3e-07
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 3e-07
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 0.003
d1g5aa2554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 5e-07
d1g5aa2554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 5e-06
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 1e-06
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 1e-06
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 1e-06
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 3e-06
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 3e-06
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 3e-06
d1iv8a2653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 3e-06
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 4e-06
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 1e-05
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 1e-05
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 2e-05
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 3e-05
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 5e-05
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 8e-05
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 6e-05
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 4e-04
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 6e-05
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 8e-04
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 7e-05
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 7e-05
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 1e-04
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 1e-04
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 2e-04
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 2e-04
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 3e-04
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 3e-04
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 5e-04
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 6e-04
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 6e-04
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 8e-04
d2bhua3420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 0.002
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: 1,4-alpha-glucan branching enzyme, central domain
species: Escherichia coli [TaxId: 562]
 Score = 80.4 bits (197), Expect = 2e-16
 Identities = 57/207 (27%), Positives = 89/207 (42%), Gaps = 3/207 (1%)

Query: 316 FGTPEQLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLW 375
           FGT +  +Y +D  H AGL V+LD V  H   +    L EFDGT      D   G H  W
Sbjct: 86  FGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDD-FALAEFDGTNLYEHSDPREGYHQDW 144

Query: 376 DSRLFNYSEIEVLRFLLSNLRWYLDEYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFG 435
           ++ ++NY   EV  FL+ N  ++++ +  D  R D V SM+Y ++             FG
Sbjct: 145 NTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDY--SRKEGEWIPNEFG 202

Query: 436 LNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPVTEGGTGFDYRLEIRPDMS 495
              + +A+ +L   N+ L ++    +T+AE+ +  P   RP   GG GF Y+  +     
Sbjct: 203 GRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHD 262

Query: 496 DMTVGTFDAAMNTTEERFKWLSADPGY 522
            +     D                  Y
Sbjct: 263 TLDYMKLDPVYRQYHHDKLTFGILYNY 289


>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1351
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 99.98
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.98
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.97
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.97
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.97
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.97
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.97
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.97
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.97
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 99.97
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.97
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.96
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.96
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.96
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.96
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.96
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.95
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.95
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.95
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.95
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.95
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 99.94
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.94
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.94
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.93
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.92
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.92
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.91
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.91
d1iv8a2653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.85
d1m7xa2106 1,4-alpha-glucan branching enzyme {Escherichia col 99.78
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.72
d1m7xa1110 1,4-alpha-glucan branching enzyme, N-terminal doma 99.49
d1m7xa1110 1,4-alpha-glucan branching enzyme, N-terminal doma 99.48
d2fhfa1115 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.25
d1eh9a190 Glycosyltrehalose trehalohydrolase, N-terminal dom 98.98
d2bhua197 Glycosyltrehalose trehalohydrolase, N-terminal dom 98.78
d1bf2a1162 Isoamylase, N-terminal domain N {Pseudomonas amylo 98.71
d2fhfa1115 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 98.69
d1eh9a190 Glycosyltrehalose trehalohydrolase, N-terminal dom 98.55
d2bhua197 Glycosyltrehalose trehalohydrolase, N-terminal dom 98.37
d1bf2a1162 Isoamylase, N-terminal domain N {Pseudomonas amylo 97.61
d2qlvb187 SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} 97.57
d1ji1a283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 97.36
d1wzla283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 97.18
d1z0na187 5'-AMP-activated protein kinase subunit beta-1 {Ra 97.17
d1ea9c280 Maltogenic amylase {Bacillus sp., cyclomaltodextri 97.1
d1j0ha283 Neopullulanase {Bacillus stearothermophilus [TaxId 96.61
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 96.18
d1uoka179 Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 139 95.98
d1m53a178 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 95.8
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 95.7
d1g5aa174 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 94.87
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 94.39
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 94.34
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 94.21
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 94.08
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 94.04
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 93.93
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 92.8
d1x1na1523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 92.12
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 91.7
d1tz7a1485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 91.24
d1cyga389 Cyclodextrin glycosyltransferase {Bacillus stearot 91.04
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 90.9
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 90.41
d3bmva389 Cyclodextrin glycosyltransferase {Thermoanaerobact 90.35
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 89.59
d1eswa_500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 89.41
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 89.16
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 88.95
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 88.9
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 88.59
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 87.84
d1z0na187 5'-AMP-activated protein kinase subunit beta-1 {Ra 87.61
d1cxla390 Cyclodextrin glycosyltransferase {Bacillus circula 87.53
d2qlvb187 SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} 87.02
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 87.01
d1x1na1523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 86.6
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 86.46
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 86.36
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 85.07
d1ua7a178 Bacterial alpha-Amylase {Bacillus subtilis [TaxId: 83.92
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 83.81
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 83.8
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 83.24
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 82.83
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 82.61
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 82.27
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 81.5
d1wzla1120 Maltogenic amylase, N-terminal domain N {Thermoact 81.32
d1tz7a1485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 80.58
d1wzaa179 Bacterial alpha-Amylase {Halothermothrix orenii [T 80.44
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 80.14
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=3.9e-40  Score=390.18  Aligned_cols=207  Identities=26%  Similarity=0.381  Sum_probs=157.0

Q ss_pred             CCccccCCCCCC--CCceEEEeecCCcccCCCcccccccccccccceeccCCCcccccccccccccCCceEEEecCCCCC
Q psy9001         877 KHKWTSSKPKKP--ENLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGDFNNWNREEFAYKKLDFGKWELVLPPNPD  954 (1351)
Q Consensus       877 ~~~w~~~~p~~p--~d~iIYE~HV~~~s~~~~~gty~~f~~~~lp~ik~lG~fn~~~~~~~~l~~lg~giwel~ip~~~~  954 (1351)
                      .|+|+.+.++.+  +++||||+|||.|+.+   |+|++++++ |++||+|| ++              +||.+.|     
T Consensus         1 ~~~w~~~~~~~~~~~~~viYe~~~~~f~~~---Gd~~g~~~~-ldyl~~LG-v~--------------~i~L~Pv-----   56 (420)
T d2bhua3           1 TFDWTDADWHGIKLADCVFYEVHVGTFTPE---GTYRAAAEK-LPYLKELG-VT--------------AIQVMPL-----   56 (420)
T ss_dssp             SSCCCCTTCCCCCGGGCCEEEECHHHHSSS---CSHHHHHHT-HHHHHHHT-CC--------------EEEECCC-----
T ss_pred             CcCCCCCCCCCCCccccEEEEEehhhcCCC---CCHHHHHHh-HHHHHHcC-CC--------------EEEeCCC-----
Confidence            378887775533  7999999999999854   777777763 67777766 22              2233221     


Q ss_pred             CCCcccccCccceecCCccceeeecCCCCCCCccccccCcceeeecccCCCCCCCCCCcccccc-ccccccccCCCCCHH
Q psy9001         955 GDFNNWNREEFAYKKLDFGKWELVLPPNPDGSCKLTHLSQVKLVVRNQHGHLLDRFGTPEQLKY-LVDECHKAGLFGTPE 1033 (1351)
Q Consensus       955 g~~Y~~~~~~~~y~~~d~gy~~~~~pp~~~~~~~i~d~~~~~l~~~~~~G~~~~~~~sp~~hgY-~~Dy~~idp~yGt~e 1033 (1351)
                                                                    .+       +....+||| ++||++|||+|||++
T Consensus        57 ----------------------------------------------~~-------~~~~~~~GY~~~d~~~vdp~~G~~~   83 (420)
T d2bhua3          57 ----------------------------------------------AA-------FDGQRGWGYDGAAFYAPYAPYGRPE   83 (420)
T ss_dssp             ----------------------------------------------EE-------CSSSCCCSTTCCEEEEECGGGCCHH
T ss_pred             ----------------------------------------------Cc-------CCCCCCCCCCcccCCCcCcccCCHH
Confidence                                                          11       011246899 999999999999999


Q ss_pred             HHHHHHHHHHHcCCEEEEEeecccccCCccccCcCCCCCCCccccCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q psy9001        1034 QLKYLVDECHKAGLYVLLDVVHSHASKNVLDGLNEFDGTQACFFHDGPRGTHPLWDSRLFNYSEIEVLRFLLSNLRWYLE 1113 (1351)
Q Consensus      1034 dfK~LV~~aH~~GI~VILDVV~NHts~~~~~~l~~~dg~~~~yf~~~~~g~~~~w~~~dlN~~np~Vr~~lid~l~yWl~ 1113 (1351)
                      |||+||++||++||+||||+|+||++.++ .++..+.   +.+|...   ..+. ++.+||++||+||++|+++++||++
T Consensus        84 d~~~lv~~aH~~gi~VilD~V~NH~~~~~-~~~~~~~---~~~~~~~---~~~~-~~~dlN~~np~v~~~~~~~~~~Wl~  155 (420)
T d2bhua3          84 DLMALVDAAHRLGLGVFLDVVYNHFGPSG-NYLSSYA---PSYFTDR---FSSA-WGMGLDYAEPHMRRYVTGNARMWLR  155 (420)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECCSCCCSSS-CCHHHHC---GGGEEEE---EECS-SSEEECTTSHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccccccccccccccCCCC-ccccccc---ccccccc---cccc-ccccccccChHHHHHHHHHhheeee
Confidence            99999999999999999999999999988 3443322   2222211   1112 3468999999999999999999999


Q ss_pred             HhCCCeEEEcCcccccccCCCCCCCCCCCcccccCCcCChhHHHHHHHHHHHHHhhCCCeEEEEccCCCCCCccccc
Q psy9001        1114 EYQFDGFRFDGVTSMLYHNHGCGEGFSGHYDEYFGLNVDTDALIYLMVANKFLHDKYPEIITIAEDVSGMPASCRPV 1190 (1351)
Q Consensus      1114 eygVDGFRfD~a~~m~~~~~g~~~~~~~~~~~~~g~~~d~~~~~fl~~~~~~l~~~~Pd~ilIaE~~~~~p~~~~p~ 1190 (1351)
                      ++||||||||+|.+|.+.                      ....++.++++.+++..|++++|||.|.+.+.+....
T Consensus       156 ~~GVDGfR~D~~~~l~~~----------------------~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~  210 (420)
T d2bhua3         156 DYHFDGLRLDATPYMTDD----------------------SETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVN  210 (420)
T ss_dssp             HHCCSEEEETTGGGCCCC----------------------SSSCHHHHHHHHHHTTCSCCEEEEECSSCCTHHHHTT
T ss_pred             cccccEEEEeeeeeeccc----------------------cccccHHHHHHHHHhhcCCceeeecccCCchhhhccc
Confidence            999999999999988421                      1224678899999999999999999998887766543



>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1ji1a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1wzla2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ea9c2 b.71.1.1 (C:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1j0ha2 b.71.1.1 (A:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uoka1 b.71.1.1 (A:480-558) Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a1 b.71.1.1 (A:521-598) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3bmva3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1cxla3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1ua7a1 b.71.1.1 (A:348-425) Bacterial alpha-Amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1wzla1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure